Dbfetch

ID   AP011123; SV 1; circular; genomic DNA; STD; PRO; 182940 BP.
XX
AC   AP011123;
XX
PR   Project:PRJDA31129;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-020 DNA, complete
DE   genome.
XX
KW   .
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
OG   Plasmid pAPA01-020
XX
RN   [1]
RP   1-182940
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma Y., Hosoyama A.;
RT   ;
RL   Submitted (06-APR-2009) to the INSDC.
RL   Contact:Yoshinao Azuma Yamaguchi University School of Medicine, Department
RL   of Microbiology and Immunology; Minami-Kogushi 1-1-1, Ube, Yamaguchi
RL   755-8505, Japan URL    :http://www.bio.nite.go.jp/dogan/Top
XX
RN   [2]
RC   DOI:10.1093/nar/gkp612
RX   DOI; 10.1093/nar/gkp612.
RX   PUBMED; 19638423.
RA   Azuma Y., Hosoyama A., Matsutani M., Furuya N., Horikawa H., Harada T.,
RA   Hirakawa H., Kuhara S., Matsushita K., Fujita N., Shirai M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37(17):5768-5783(2009).
XX
DR   MD5; 420c7a63710e2010a26883f61737018d.
DR   BioSample; SAMD00060943.
DR   EuropePMC; PMC2761278; 19638423.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF01497; ALIL.
DR   StrainInfo; 481055; 0.
DR   PubMed; 19638423.
XX
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty
CC   of Agriculture, Kyushu University, Department of Biological
CC   Chemistry, Faculty of Agriculture, Yamaguchi University and Mizkan
CC   Group Corporation Central Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..182940
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT                   /plasmid="pAPA01-020"
FT                   /strain="IFO 3283"
FT                   /sub_strain="IFO 3283-01"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /db_xref="taxon:634452"
FT   CDS             20..256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00966"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN9"
FT                   /protein_id="BAI00966.1"
FT                   /translation="MKGPAFLMAMDTVIGGIHIQNDPGGCALMLVHEERDEQGSQGLMI
FT                   SNDAAVTICLVATALQPVQRGFSCQCCAVCPAS"
FT   CDS             290..586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00967"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP0"
FT                   /protein_id="BAI00967.1"
FT                   /translation="MPQGIVIIEIFIAQCQAHDPLTDKVFNPVFHKAGMPLIAKTGSKA
FT                   AAETQNVISLLHQNDAPIRTHATPVKTGHNTPSTGGWKFIRACATLCLHRVFL"
FT   CDS             680..973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41810"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00968"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP1"
FT                   /protein_id="BAI00968.1"
FT                   /translation="MDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQRLALGQTSLET
FT                   ATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLRQAI"
FT   CDS             complement(1139..1738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41820"
FT                   /product="type I endonuclease restriction R subunit"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00969"
FT                   /db_xref="GOA:C7JIP2"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP2"
FT                   /protein_id="BAI00969.1"
FT                   /translation="MSFLSENEIEDWACDILRECGYTIAWGPDIAPGGKKPERASLSDV
FT                   VLEKRLRTTINKLNPHLPQASKDEALLALMREDTPDHVDENRRLHDYLVNGVPVDVVRK
FT                   DGTQSGDRVRLLDFENPENNDFLVVRQFVVEKDEANRRPDLVLFVNGMPLGVVELKSPS
FT                   SESATLDSAWNQFQTYRSFIPSLFRFNEALTRISHT"
FT   CDS             complement(1735..2079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41830"
FT                   /product="type I DNA specificity S subunit"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00970"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP3"
FT                   /protein_id="BAI00970.1"
FT                   /translation="MTTNQAISSLIPKGIGKSYIFLHMLHSKVNLANKATGSAQQNLSK
FT                   NLIETFETLIPNDKILYEFENKTSLLFDKIIKNFDEPHILAQLRDLLLPKLMSGEISIR
FT                   DAEKMVEDAA"
FT   CDS             complement(2326..2700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41840"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00971"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP4"
FT                   /protein_id="BAI00971.1"
FT                   /translation="MIADGHGKAFGFALAPGQAHELPLAPAMLDSLPATPLWVVADKGY
FT                   ASNAMRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKEWRAVATRYEK
FT                   TATSFLAVIHIAAAADWIKP"
FT   CDS             complement(2697..3122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41850"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00972"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP5"
FT                   /protein_id="BAI00972.1"
FT                   /translation="MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFW
FT                   RHENGAKWRSIPAELGPWWRAAQLFIRWAKLGVWERLLALVQEQQGVAFGMTFLDGTNI
FT                   RAHHKAAGAQKKGPLSKSETIVKHLAALAAAMAQKSA"
FT   CDS             complement(3144..3854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41860"
FT                   /product="type I DNA specificity S subunit"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00973"
FT                   /db_xref="GOA:C7JIP6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP6"
FT                   /protein_id="BAI00973.1"
FT                   /translation="MLMEASKLVLYGTQLHASDYVTSGVPCIMPQDIIDGKISTGKIAY
FT                   ISEENANRLSNFRLAQNDIIYPRRGDITKHALITSRENGWLCGTGCLRIRLNTSSILPQ
FT                   YLYYYLTLPHVKEWISQNSVGATMPHLNTSLVGQISVSYPTYDEQHTIASILGSLDDKI
FT                   ELNRRTNETLEAMARALFRDWFVDFGPTRAKMAGEAPYLAPELWELFPGRLDNEGKPEG
FT                   WKIGELHELGPVRS"
FT   CDS             complement(3925..4245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41870"
FT                   /product="DNA polymerase beta subunit like
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00974"
FT                   /db_xref="GOA:C7JIP7"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP7"
FT                   /protein_id="BAI00974.1"
FT                   /translation="MTGLIEITPEERAIVLRILNEIVPDREVRAFGSRVTGKAKLFSDL
FT                   DLAIMGDEPLLLETRARLEEAFSESELPWKVDVLDWALADKMFQDIIMKTSLVFRKQQK
FT                   RF"
FT   CDS             complement(4242..4643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41880"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00975"
FT                   /db_xref="GOA:C7JIP8"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP8"
FT                   /protein_id="BAI00975.1"
FT                   /translation="MLYLTPLERALNRLKEGWTRHLAHPDDEQLRDGLIQRFEFTYELS
FT                   HKTLKRFLETNSASPDEYDRMGFPDMIRSANEAGLLKSAWPQWSVFRKMRNLTSHTYNE
FT                   ATAKQVVATIPDFIVEAEFLLVTLKERTT"
FT   CDS             complement(4643..6256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="APA01_41890"
FT                   /product="type I DNA methyltransferase M subunit HsdM"
FT                   /note="Restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00976"
FT                   /db_xref="GOA:C7JIP9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIP9"
FT                   /protein_id="BAI00976.1"
FT                   /translation="MSRGRPRKNPDAASAPKKTTKARKAKAATATLGFEQQMFLAADKL
FT                   RKNLEPSDYKHVALGLIFLRYISTAFEARHAELMLEDPEAAEDPDEYLAENIFWVPETA
FT                   RWSHLKDNARSANIGKMIDEAMLAIEKANPEQLKGVLPKDYGRPALDTVMLGELIDLIS
FT                   DIGMGDTDDKARDVLGRVYEYFLGGFAGAEGKRGGEFYTPSSVVRTLVSMLEPYKGRVY
FT                   DPCCGSGGMFVQSERFVETHGGKLGDIAIYGQESNHTTWRLARMNLAVRGIGADIRWNN
FT                   EGSFLRDELKDLRFDYILANPPFNVSDWWNASLEEDPRWQYGKPPAGNANYAWLQHILW
FT                   HLAPDGTAGVVLANGSMSSNQNSEGEIRRRMVEADVVDCMVALPGQLFYSTQIPACLWF
FT                   LTRTKNPKGWRDRRGEILFIDARKLGKLVDRTRRELTDEDVARIADTYHAWRGEKNAGK
FT                   YEDIPGFCKSATLDEVEQHGFVLTPGRYVGAEEAEEDSVPFTERFAALEKTLKEQFAQG
FT                   ETLNAKITASLKLIVQKESV"
FT   CDS             complement(6781..7854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41900"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00977"
FT                   /db_xref="GOA:C7JIQ0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ0"
FT                   /protein_id="BAI00977.1"
FT                   /translation="MTSLFEPIELGSIYAKNRILMAPLTRGRGTRDHVPTPIMAEYYAQ
FT                   RAGAGLIISEATGISREGLGWPYAPGLWSQEQVEAWKPITAAVHAKGGKIVAQLWHMGR
FT                   MVHSSVTGQQPVSCSATKAPEALHTYDGKQAPEVARPLTKEDIARILNDYENAARNALQ
FT                   AGFDGVQIHAANGYLIDEFLRDGTNHRSDEYGGSPENRIRFLREVTERVIATIGAHKTS
FT                   VRLSPNGDTQGCIDSHPEQVFVPAAKLLNDLDIAFLELREPGPNGTFGKSDQPKLHGPI
FT                   REVFRKPLVLNQDYTREEAIETVATGVADAISFGRPFLANPDLVRRLEDNLPQNKDDIR
FT                   TWYSQGAEGYTDYPLAR"
FT   CDS             8112..9362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41910"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00978"
FT                   /db_xref="GOA:C7JB26"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JB26"
FT                   /protein_id="BAI00978.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTQLR
FT                   TRQSLSAGPFRRSGASS"
FT   CDS             complement(9486..10493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00979"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ2"
FT                   /protein_id="BAI00979.1"
FT                   /translation="MYGSDARFNPTIGMGSGSLHGLYQWAPTQAHLDVHLPWIFKRGID
FT                   VQIGQMYGIMGAEGTPALARPFYTYNYASDYIVPFQTVGILATMHLTRHMDWILGVDAG
FT                   NSTTFGASGNNNKPKGYFGLAWNKLMDGKLDVHAIGHFGPQGNNGRTIVSPTGWVSAGI
FT                   GKQANSLMQYNADVMATYHINDKMTVSVDGTYLHDDSLRDDAYGVTTYFSYDIHLWLTF
FT                   NARGEIFRDNTGGVITEYSSFNSLTQALSNQPFPYYNALPTTYGELTLGVSYRPEFVNK
FT                   KLALGGFTIRPEIRLDKSLNGTHPFNQAGTVQNPTVNNGTNNMLWFSCDATWSF"
FT   CDS             complement(10687..11961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41930"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00980"
FT                   /db_xref="GOA:C7JIQ3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ3"
FT                   /protein_id="BAI00980.1"
FT                   /translation="MKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALG
FT                   YEDLNDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADH
FT                   EALATLFVTLFLDQHEHAPARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCG
FT                   DHLLSATLRTADRDPGKEALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDN
FT                   HVDFLFGLAGNTRLYDRIASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAK
FT                   AEWRHGNRYHRFIVTTLPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSNRTSSHTI
FT                   RANQLRLWFSAAAYVLLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLS
FT                   MPDMFPCQHEFALAHARLRRLRQAI"
FT   CDS             complement(12129..12650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00981"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ4"
FT                   /protein_id="BAI00981.1"
FT                   /translation="MRQTLIDRSAFKFVLLSCCAAFLCETGMPTAHAQTSAPAQVQVGD
FT                   IAKTLKPEETEKGAGTPTDGEEPPATSLSEEEEAMKPKAGNLFHVKPGHTPTYWEGLEG
FT                   HVSIEAGISGNPWTRSGRNFAQYYSDRANTVTLNQIIGSLSHPVTSVGSGYGIGFVLDA
FT                   EISQKGCTSG"
FT   CDS             complement(12977..13903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="APA01_41950"
FT                   /product="transcriptional regulator LysR"
FT                   /note="Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00982"
FT                   /db_xref="GOA:C7JIQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ5"
FT                   /protein_id="BAI00982.1"
FT                   /translation="MKVKFSLRQIEYFVATAELGSIVQASRQIPISQPAISAAIAHLES
FT                   VFGVSLFIRHHAQGLSLTAEGRLVLQEARTLLLHAQELGTSLNGMLKRVQGEVRVGCMT
FT                   TLFPLLAPDLIQNFSAAYPEARLRVIAGHHEELIDKLRNGEISVMIGYNMTLPPMIGFQ
FT                   PLSALPPYVFTSSDHPLAAKECVRLQDLADEPFLLLDLPFSKEYFLQLFASAGITPCIA
FT                   GHYPSMDVIRSLAARGVGFGLGNARPRNQQALDGKSLAYLTLEDECAPLLYGLFTIVDQ
FT                   KFPFRVSAFLDMCEQDLSGKPLPGTLN"
FT   CDS             complement(13998..15152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="APA01_41960"
FT                   /product="acetylornithine deacetylase ArgE"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00983"
FT                   /db_xref="GOA:C7JIQ6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ6"
FT                   /protein_id="BAI00983.1"
FT                   /translation="MTSMYDLSVQDILSQLVAFPTICRTENQNLIDWVEEFLRACGARC
FT                   LRVPGEQAGRFNLLASIGPDTPDGIVLSAHSDVVSVEGQPWKTAPFTLTAYDGNLYGRG
FT                   TSDMKGFLACMLVAARYAAQKTTLRAPLHLAISYDEEIGCVGVHSLLRSLAVHKFQARG
FT                   CVIGEPTNLHVVSGHKGKLAARIVCHGLAAHSANPARGSNAILLASDMVQAIKFLQDEL
FT                   QNNGAQDENFEVPYNTLQVGLIQGGVALNIVPDLCEVHFEMRLLPGVDPALYIERLKQE
FT                   GARLCTTYPSARIEIETLNTYPGLNTRDGTPFLQEIMAITGDNAPSYIGFGTEGGLFKE
FT                   YLDIPVVVCGPGSIDRAHKADEFIRLDELSAGVQFVEKIVEKLL"
FT   CDS             complement(15149..16765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41970"
FT                   /product="alcohol dehydrogenase"
FT                   /note="Glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00984"
FT                   /db_xref="GOA:C7JIQ7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ7"
FT                   /protein_id="BAI00984.1"
FT                   /translation="MSGQNDFPTEFDFIIVGAGAAGCVLANRLSARSNLRVALLEAGQA
FT                   DNTPRIHVPAGTISLYKSRKYTYQYYSTPQKYLNNRRIHVPRGRMLGGSSSMNSMIYIR
FT                   GARSDYDDWEAMGCTGWGYDAVLKYFMREENNHLHQDPHFHGTGGELVVDQPRDPLGVS
FT                   RLFIKAAEEVGLKENTDFNGAKLDGVGIYDVTQKDGKRLSAYRAFVAPVRSRPNLHVVT
FT                   GCKVVSLVTDGKEVQGVTIERNGQFHVLRARRETILSAGAIGSPHLLMSSGIGNARELL
FT                   AAGVPVVADLPEVGRNLQDHVDGLVTIRSDSASTLGFSTASLSSVVPSPLQFLLKRKGW
FT                   LTTNYVEAGGFASTRYAKDVPDIQFHFVPGYRSHRGRLFEWGHGFALHTCVLRPYSRGS
FT                   IRLARDGSRNPDIDFNFLSDERDTHVLLEGVKLARSILRASPFDAIRGKEMAPTANIQT
FT                   DDQLIEYLRASASTVFHPSGTCRMGADDTSVVTPDLKVRGLKGLRVADTSIMPTLVSGN
FT                   TNAPTMMIGDKASDMILADAV"
FT   CDS             complement(16765..18159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41980"
FT                   /product="cytosine/purines/uracil/thiamine/allantoin
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00985"
FT                   /db_xref="GOA:C7JIQ8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ8"
FT                   /protein_id="BAI00985.1"
FT                   /translation="MTDTTTARGPEAHTIYQIPLDQRHGRPRDLFTVWFGSNIMMLTII
FT                   TGALATTVFGLPFWPAMLSAVLGNMIGGLFMALHAAQGPQLGVPQMVQTRGQFGSVGAM
FT                   AVICLVVIMYVGFFASNLVLGGESLHTVATFLPEKTCVILLGLVSLIATIYGHDLIHAY
FT                   TRFMTVVSGIALVLCFVWILCINGVSSATLAHGTFTLSGFLGGLSTAALWQIAYAPYVS
FT                   DYSRYLPPGTGNRQAFMASYWGCVLGSLFPMILGALLGVIAGGGDVVATLTKEVGPLAL
FT                   FIIPVLSLGIASTNAMNLYCGALSAITVIQTIFPSWKATHVGRAGTAVVLSGLSLLIAL
FT                   GTEANFMEEYTNFILLLLYVMVPWTAINLADFYLIRHGEYDVASFFRADGGIYGRYCWP
FT                   ALSAYVFGILIQIPFVSNGLYTGPIATMLGGADISWIVGLIFVTVFYVWLMRHERHTQP
FT                   VAGSAE"
FT   CDS             complement(18281..18688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41990"
FT                   /product="endoribonuclease"
FT                   /note="L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00986"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIQ9"
FT                   /protein_id="BAI00986.1"
FT                   /translation="MAHTRLRPFNTKDTYPEQELDNDLCQAVITQNTIYLRGQVPQDLD
FT                   TRENVGVGDPAAQAEKVIDNIELLLSEAGAKLTDICKVTVYLTDIRYREATYRVLGRRL
FT                   KGVFPVFTGLVVVALARPEWLIEVDVIAERE"
FT   CDS             complement(18826..20307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42000"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00987"
FT                   /db_xref="GOA:C7JIR0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR0"
FT                   /protein_id="BAI00987.1"
FT                   /translation="MKSLSYYTQRADALKFRNNCWIDGKFVPARSGKWFEDVNPATSSI
FT                   LTQVARGGAEDIDRAVKSARRAFEDGRWSRLTPSARKETLLRLAVLIREHLDEFALLDT
FT                   LDMGKPISETTNVDVPGAAQCLQWHAEAIDKLYDEVAPTGGRDVAMIRRIPLGVVGAVV
FT                   PWNFPLDIAIWKLAPALVTGNSVVLKPAEQSPLSALRLAELAAEAGLPDGVLNVVPGLG
FT                   EEAGQALGLHDDVDCLVFTGSTTVGKLFMRYAGESNMKQVWLETGGKSPNIIFPDANLD
FT                   VAADQAAFGIFFNQGEVCSANSRLLVHESIVDEMIERMRLRAEAIIPGNPLDPDTKMGA
FT                   MVDSRHAARVAEFLNSGRESSRLVAGGNRITVGASDAFIQPTVFADVPRNTLIAREEIF
FT                   GPVLAIQTFRDEEDALQLAHDTPYGLAASVWTRDIGRALDLSERLQVGTVSVNTVDALS
FT                   PMTPFGGVKQSGFGRDLSLHSFDKYTALKTVWIQY"
FT   CDS             complement(20307..21566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42010"
FT                   /product="flavin-containing monooxygenase"
FT                   /note="Flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00988"
FT                   /db_xref="GOA:C7JIR1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR1"
FT                   /protein_id="BAI00988.1"
FT                   /translation="MTIEKTEVLVVGAGQAGIAMSEHLRGYGIEHVVLERNRVAERWRS
FT                   CRWDSLVANGPAWHDRFPHLEFQHDGPDDFVPKERVADYLAAYAQKIDAPIRCGVEVKE
FT                   VRRNAGRLGFTVQTSEGVIEAKAVVAATGPFQIPVIPPIVPEASGIAQIHSASYRNPEQ
FT                   LPEGAVLVVGAGSSGAQIAEELMRSGRKVYLSVGPHDRPPRHYRGRDFVWWLGVLNKWD
FT                   AEATPGVEHTTIAVSGANGGHTLDFRRLASEGMTLLGRTETFHDGVLTFAPDLAENIAK
FT                   GDANYLSLLGEADTYVTRNGLDLPEEPTARDMLPDPECMKHPVLELDLQNAGINTIIWA
FT                   TGFGVDYSWLKVEALDEQGRPHHQRGVSAEPGIYFLGLPWQTRRGSSFIWGVWHDAKYV
FT                   ADHIAKQRGYMAYKPSREEG"
FT   CDS             complement(21626..22396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00989"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR2"
FT                   /protein_id="BAI00989.1"
FT                   /translation="MFRFGNDGGTVRSYLTPAVWLDYVSSERGSSMTFSIVARCPQSGQ
FT                   FAVAVSSSSPSVAARCGFARAGVGAVTTQNVTDPRLGPWALDLLEAGASATEARDIIVR
FT                   NCTFPHYRQMSLIDREGRTAVYTGSKALGLSTDLCGVNIASTGNLLASKCVVEAIVRSF
FT                   EQSEKSKELGARVIVAMKAGLAAGGEAGPVRSAGLQVVAQEAWPLADLRVDWDEAPITK
FT                   LEELWTIWQPQMHDYVTRCLNPEVAPSYGVPGDE"
FT   CDS             23141..23404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42030"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00990"
FT                   /db_xref="GOA:C7JBI0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI0"
FT                   /protein_id="BAI00990.1"
FT                   /translation="MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             23401..24228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42040"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00991"
FT                   /db_xref="GOA:C7JIR4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR4"
FT                   /protein_id="BAI00991.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYREQELNLRIKPRRRL
FT                   VREKPEKLSVPALPNRVWSMDFMADRLMDGRAFRLLNILDDFNREGLAIEGDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(24480..25454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrA"
FT                   /locus_tag="APA01_42050"
FT                   /product="nitrate/nitrite transporter ATP-binding protein
FT                   NtrA"
FT                   /note="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00992"
FT                   /db_xref="GOA:C7JIR5"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR5"
FT                   /protein_id="BAI00992.1"
FT                   /translation="MSTPLRIGVLKLADSAPVIMARQKGIFARYGLEVELVVSPSWANI
FT                   ADGLAWNRLDAAVIFAPLAIMTALGRRGHDTGLHPLGRISRGGNTIMLRGVNPISEPWR
FT                   KGEEGRKAFDIWQTVIGRKPRIAVVHMYSTHLLILRRFLKMIGIHMESQIELLVMPPAD
FT                   MIHAFAEKAIDGACVGSPWGTEAERIGLAFRVGGSSTVLPNHLEKILVASGKLRNLNDT
FT                   ARNLCLAIQDSLDFCQKSVHRMEIAQDLGRNVASGGLGLPMEATSTILPGGNASETITF
FT                   SGGSLVRSDLEWIISDMTDLGWLKTVRQQDLERWMTPTSMAPV"
FT   CDS             complement(25451..26062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42060"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00993"
FT                   /db_xref="GOA:C7JIR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR6"
FT                   /protein_id="BAI00993.1"
FT                   /translation="MDEKISSTVHLKVLVADENPRRGQALSEVLYTDSSLDVQTVPCGM
FT                   ALIDAVRDYGPDVVLVDMSRADRDALDSIRALSCSELERPVALFVDEDDVELMETAFDT
FT                   GICSYNVMEALPRDVKPLLRAAIALYARFRRTRDELSEAQRVLAERRIIEQAKRCFMKN
FT                   EKTSESQAYRWFQRRAMQTSSRIVAVAEKYLLSQKKDETS"
FT   CDS             complement(26062..29400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42070"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00994"
FT                   /db_xref="GOA:C7JIR7"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR7"
FT                   /protein_id="BAI00994.1"
FT                   /translation="MPIRPGTDLALLNGLLHLLVKNDAIDRDFIAQTTTGWEAMESFLE
FT                   EYAPQTVAEITGLAVEDILTAACWIAEAGEWMSLWTMGLNQSIAGTWNTNALCNLHLAT
FT                   GAICRPGSGPFSLTGQPNAMGGREMGYMGPGLPGQRSALVAADRAFVEKQWSLAPGTLR
FT                   ETGGNGVIAMFEAMERGEIKACWVICTNPVATVANRRHVVQALEAAEYVIVQDAFADSE
FT                   TTHFADIVLPAALWAEGDGVQVNSDRTMTLARKAVPPPGEALPDWDIIARVARAMGFEK
FT                   DFAFTSAADVFAEASRFSNSKTGYDITGISHARLRKGPVQWPAPAGDQQDRHPIRYLPP
FT                   DGHDPVFATADGKGVFFARPWMRPSEWPDEEFPFVLNSGRLQHQWHTLTKTGRVDSLNR
FT                   LNPGPFVEVAPQDALTLGLQQDDHVQITSRRGRIVLPVQISTRIQSGICFAPFHWNDRF
FT                   GEDLTVNAITPDAVDPVSLQPGFKLCAVALERVEQSVYQNTDDAEPIRKGHPDMMMRTL
FT                   STHLGLEQSDKSVIASLPEDARAWLSGFLEGLEMAPPNVGEVPILPASAPLPPKIHARV
FT                   GGILAGLYSRAHVNHPAMMPQEEITEAVLTPRITVWWASQTGRTEGLATTITSWLQEAS
FT                   HEAESKCLDTFDAKRDLSGLALFVVSTFGDGDPPDCAVPFWDMLREHKKPISDLKFSVL
FT                   ALGDSSYANFCGFGRVLDGRLQELGATPLLERMECEPDFEDAVETWRAVMLKAFAGTKT
FT                   DEAALPLPTTAVVPASGTREAPVMARLCINERLCSVGCERDTRRIGLDVSGTDLNWAPG
FT                   DALGIWPSNPEPYVETVLRALRLPDDTSIVLRGCGTVGLREALVRHLDLCRPNPAMLKI
FT                   LGSCAPGFLPHLLKDASLSVVAEEVPTLFRRMQPRLYSIASSPNVSGRVVELTIGVNNT
FT                   PWPGICSNWLAGSEEGADVPVFIQPTTHFQLPADDVAIIMIGPGTGIAPFRGFLQERAA
FT                   RKATGWNWLFFGERHAKESFYFHDELAAFLTEGVLTRLDTAFSRDQPERIYVQDQMEAA
FT                   GAELWKWLQKGAHIYICGDATRMARDVDAALRRIVARHGNLSVSEADTFVSNLTREGRY
FT                   RRDVY"
FT   CDS             complement(29466..30029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42080"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00995"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIR8"
FT                   /protein_id="BAI00995.1"
FT                   /translation="MGAAARTGSGTTGSGIRNDFSGWHKHQGSPQSGGSPKKGASFEER
FT                   DHREALGRSRGGYGTKVCVIADGHGKAFGFALAPGQAHELPLAPAMLDSLPATPLWVVA
FT                   DKGYASNAMRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKEWRAVAT
FT                   RYEKTATSFLAVIHIAAAADWIKL"
FT   CDS             complement(29837..30262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42090"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00996"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE2"
FT                   /protein_id="BAI00996.1"
FT                   /translation="MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFW
FT                   RHENGAKWRSIPAELGPWWRAAQLFIRWAKLGVWERLLALVQEQQGVAFGMTFLDGTNI
FT                   RAHHKAAGAQKKGPLSKSETIVKHLAALAVAMAQKSA"
FT   CDS             complement(30291..30884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42100"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00997"
FT                   /db_xref="GOA:C7JIS0"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS0"
FT                   /protein_id="BAI00997.1"
FT                   /translation="MAREEVRTVCPYCGVGCGIILEVENDRIAKVRGDTAHPANGGRLC
FT                   TKGSSCDKPLLSDQRLHQALIRPQRGEKAVPVAMQQAIKDTAARLRTILNTHGPDAIAF
FT                   YVSGQMSLEAQYLINKLAKGFVRSQHIESNSRLCMAAAGTGYKLSLGADAPPGSYEDFD
FT                   CTDLFFVIGANMADCHPILFLRLMDRKRAGARAC"
FT   CDS             complement(30892..33048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42110"
FT                   /product="nitrite reductase [NAD(P)H] large subunit"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00998"
FT                   /db_xref="GOA:C7JIS1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS1"
FT                   /protein_id="BAI00998.1"
FT                   /translation="MARECGLAIGSRGGVVIDDTCRTSDAAIFAIGECACWNGQVFGLV
FT                   APGYTMARTVASILAGEQVAFAGADMSTKLKLLGVDVGSIGDAHGRTPGCRSYRFIGEI
FT                   DGSYRRLVLSEDGHHVLGAVLVGDNAYYDTILQCVQNDIKPPADPAALILPRGEGADLL
FT                   GADALPDTAMICSCHNVTKGAICASIENGCTDLAGLKQSTKASTGCGGCSALLKNVFET
FT                   ELEARGITVDHSLCEHFSYTRQDLYALVRVHGIQTFEDLMAQYGNGGLGCDICKPAVGS
FT                   ILASAWNKPITDPLYIPLQDTNDTFMANMQKNGTYSVVPRIAGGEITPEKLIVLGQVAK
FT                   KYGLYTKITGGQRIDLFGAQLDKLPDIWSELMDAGFETGQAYGKSTRTVKSCVGSTWCR
FT                   YGVQDSVGKALDLENRYKGLRAPHKLKFAVSGCTRECAEAQSKDVGVIATENGWNLYVC
FT                   GNGGMRPRHAELFATDLDSETLVKYIDRFLMFYIRTADKLQRTSVWRENLEGGLDYLRE
FT                   VIIADSLGICTELEKQMQMVVDNYHCEWRDALTDREKLKRFRTFVNDRRPDPNIRTVAE
FT                   RDQVRPADNLPETTSSAGPIEWTELCQGDDLVAKSGVVAWYDGNQIALFYLPETEVAPA
FT                   QVYAIDNHDPFSNANVIGRGIMGDLKGQLVVASPLYKQHFRLEDGQCLEDPAIRLRTWD
FT                   ARLENGKVMIRAKINEYTPETLLA"
FT   CDS             complement(33157..33819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42120"
FT                   /product="nitrite reductase (NAD(P)H) large subunit NirB"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00999"
FT                   /db_xref="GOA:C7JIS2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS2"
FT                   /protein_id="BAI00999.1"
FT                   /translation="MPSLTIGETVMITTENIVIIGNGMVGHYCAEQLVTHGLHKTHAIH
FT                   IFGDELHDAYDRVHLTDYMSGQDALALRLHKDDFHTHHGLTLHRGVRVEHIDRDAKTVE
FT                   SIEGVLPYGTLILATGSTPFVPPIPGNTGTAGLVYRTLDDLDMIRAAANGATHGVVIGG
FT                   GLLGLEAANALAGLGLSTAVVEFAPRLMPVQLDEDGGQALKQRIEALGINVLTAHAT"
FT   CDS             complement(33819..35474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01000"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS3"
FT                   /protein_id="BAI01000.1"
FT                   /translation="MTRIFFSSHSASFSTASVAMLAGLCLHQTAWADNAQPANKQTTNA
FT                   QVLAKSTIMPALKQKAPYSNSTPHSPDWGVFNTGKGVASGFGIIGGPGQPRWAEDWSDL
FT                   ATMSPAKRRADWFNRLKYIPLTDNGDIWLSINGEERLRYIFENQPMMGTAGKTNANRVL
FT                   LRNQYGADLHIGEHIRAYAEFLWGVAGGSNYYGYQTGVQRERLDLQQGILEVKGNLLGA
FT                   KMGAIGGRQVFLDAPLSMQSSRDLTNAQQTWDGFRGYAVWKSFRMDLFDFMQTNKLPRN
FT                   VFADGTNYNARMYGIYTSTALPNFTVMGQKSQIFADVFFIGYLFNGTPAAISTTTGTQS
FT                   GSTRRDNVGSRIWGNVGPFNVSLTGVFQGGEFRPAASQGATRAVRACAVNGVFGWTAKN
FT                   LKSAPSFSLQADMFSGGSYHSKDGAVGTFATPYFPFPYYNDVTLALTSQNLIGVGPVIT
FT                   ATPVPHLLLKLHVPVFWRESTQDAVYGTGKIYSWRNNLSGGFIGATPQTQIAWNFAPHW
FT                   TWTHDIAGFVASNGMRQAGAKDGAFYMQTMEFKF"
FT   CDS             complement(35508..35972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42140"
FT                   /product="nitrate transporter"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01001"
FT                   /db_xref="GOA:C7JIS4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS4"
FT                   /protein_id="BAI01001.1"
FT                   /translation="MHSFGCVCWFVRAPLGRGHIGGERALSILYTLAAGIFAVIGVGLP
FT                   TIWLAFPAFFLGMLVLGLGNGAVFQLVPTRFPTRVGILTGLVGMSGGVGGFYLASSLGA
FT                   ARQMTGSYGPGFLCFAVIALAALACVSFCRRRWMAKSNGIPTGANAPGAL"
FT   CDS             complement(35894..36748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42150"
FT                   /product="nitrate transporter"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01002"
FT                   /db_xref="GOA:C7JIS5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS5"
FT                   /protein_id="BAI01002.1"
FT                   /translation="MLMTETGCDDVDKGFLKAGNPRTLLAAFLYFDVSFMVWVLLGPLG
FT                   ISIAHDLHLNAGQKGLLVATPVLAGALLRVVAGALVDHFGPRRVAIGAQIFVIAGLFVT
FT                   WLVAPHSYAALFGVALVLGVAGASFAVALPLASAWYPPQYQGTALGIAGAGNSGTALAS
FT                   LFAPGLAALYGWVNVLGLATLPLMAVLIVFCFLASEPPERRVGGGLTTWLPVLRNADCW
FT                   ALMFFYGVTFGGFVGLASFLTIYFNDQYGLSPAIAGTCTALVVFVGSFVRPLGGAILAV
FT                   NAR"
FT   CDS             complement(37202..37906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42160"
FT                   /product="nodulin-related Integral membrane protein DUF125"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01003"
FT                   /db_xref="GOA:C7JIS6"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS6"
FT                   /protein_id="BAI01003.1"
FT                   /translation="MENNILNSQKETHATSRLGWLRAAVLGANDGILSTSSLIIGVASA
FT                   HAGRENILLAGISSLVAGAMSMAAGEYVSVSSQADSEKADLAREKQELGSSWDTEVGEL
FT                   ADIYRQRGLDDALARTVAQQLMQHDALGAHARDELGISDATSARPIQAACASAGAFSSG
FT                   AILPVLAALLSSSSIVSWAVSAVSLISLALLGVVGARAGGAAPLRPTLRVIFWGIVAMV
FT                   GTTFVGKIFGGS"
FT   CDS             complement(37963..39315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42170"
FT                   /product="two component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01004"
FT                   /db_xref="GOA:C7JIS7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIS7"
FT                   /protein_id="BAI01004.1"
FT                   /translation="MKNWSLATRIVSGVLCVVTLSLLALSIAVAGFTRYEITERLDNSL
FT                   QEVSERLQAIITIQPHKAQSDNVAWVPDVGPRTLAYQVVDQSGHVVLRSQNAPVDPFVP
FT                   DIHTGFSNTPLFRVYIAAPTATAYRVLVGEPTLHRRGATWRATAMAVLPILIFLPVIWV
FT                   LVRLIVRRALRPLNRLHDEMQSRGSGNLSPISSLDLPVELVSIQHAVNTLLSRLKTALS
FT                   TERAFAASAAHELRNPLGALLAQVQMLGRMLPEGSSANKRVEIIADRTQRLARTVEKLL
FT                   QFSRASSGVAFRRDRFDLLAVLYVLVDDLGHLPRDGRSINLKAKGIGHIFVYGDMDATG
FT                   ILLRNLLENALLHGTSDMPVKVEVKPEGCIDVINDCPALAPDTLAQLTSPFVRGGSSSN
FT                   GSGLGLAIASNIARQMDARLQLQSPLTGSARGLSVSLCFPNPEIILLSEET"
FT   CDS             complement(39312..39983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="APA01_42180"
FT                   /product="two component response regulator KdpE"
FT                   /note="Winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01005"
FT                   /db_xref="GOA:C7JBI6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI6"
FT                   /protein_id="BAI01005.1"
FT                   /translation="MRILIVEDEHDLGAAVQERVRQDGHAVDWFMTLEDARAAVATVDY
FT                   DFMLLDLGLPDGNGRDLLREIRRTSFDTAILITTAEDQISDRIAGLSDGADDYIVKPYD
FT                   LNELVARIAAVARRYVAPRRQACYQMGEIVIDRENRSVTRNEMELELTAREWAIMELLS
FT                   RRPGRIYSRQQIDTALYALDQDVGSNTVEVFISRLRKKVGNTVIKTVRGRGYCLADRAD
FT                   A"
FT   CDS             complement(39983..43057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="APA01_42190"
FT                   /product="cobalt/zinc/cadmium resistance heavy metal efflux
FT                   pump protein CzcA"
FT                   /note="Resistance-nodulation-division (RND) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01006"
FT                   /db_xref="GOA:C7JBI7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI7"
FT                   /protein_id="BAI01006.1"
FT                   /translation="MARKYLEALLRARMLVLGGLALILAAGMMAVLELPVEAVPDISPK
FT                   QVLVSVVAPGLATEEVEKLITFPVEASMTGIPGMTDLRSVSRGGVSVVYVQFADDTDIN
FT                   LDRTRVNERIQQARGSISVPGITVSMGPLATGMGEIMQFQIKGAGRSLMELNRIMNWTV
FT                   VPQMRLVPGVVDVNVNGGAEETYEVALDPARLIASNLSVSEVYRAVDANNAASGGGWIT
FT                   HHAEQQSVVGRGLISSLADFGNIAVRANADGSIIRLRDLGHITTGARTRLGAVTRDGQG
FT                   EIVIGVVMMESGASSNATLAAINRALPSIRQSLPTGVTLEPYYTRATLTGQTIATVRDN
FT                   LLMGAVLVIAVLVVVMGSWQAALVIASVIPVALVCAMAGMRYFGISANLLSLGAIDFGM
FT                   IVDGSLVVIEHILSRREEEPEAAFMPLVVSSVQQVMRPVGFAILVIIMVYLPILTLQGI
FT                   EGHMFRPMAQTVIMALLASLAYCFICIPVIAALALARVRPKGDTWLIARLRAPYVHLTE
FT                   WGEAHPQLLFGGTLAVLVLSAGLATRLGGEFIPQLDEGALAVTTTRLPSASLETVLASV
FT                   TRQEQILRGFPEVKTVVSNTGTSAIPTDPMGVNETDSFILLNPPSTWKTARTQAGLVAA
FT                   MDETLRRELPDALYSWSQPVQMRMDDLLSGVRTQIAVSIFGDDLATLATLGDKVVAAIS
FT                   SVKGAADVAAADDGSVPLVVVDIDRAQAASRNVAVQDILDTVEAIGGHIGARPVIVGNA
FT                   IISTQVRLNGRHVASAAAIAALPVRRMDGQGNVMLSQVAHVHEVDGTPRISRDGVRRRM
FT                   VVQANVRGRDLSSFVAEAQMRVAHDVHLPSGYTMQWDGQFRNLHSAVQRLEIVLPIALG
FT                   LIFALLVVTFGAIRPALLVFINLPVAATGGIMMLTLRGMPFSISAGIGFIALFGVAILN
FT                   GVVLVSEIAALRARGMAVAQAAFAGAKSRFRPVMATALVASLGFFPMAFSESAGAEVER
FT                   PLASVVIGGLVTSTLLTLLVLPSLYARVMREEVQN"
FT   CDS             complement(43057..44211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB/hlyD"
FT                   /locus_tag="APA01_42200"
FT                   /product="heavy metal/cation efflux pump CzcB/HlyD"
FT                   /note="Major facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01007"
FT                   /db_xref="GOA:C7JBI8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI8"
FT                   /protein_id="BAI01007.1"
FT                   /translation="MKGRILAYFAVCFCMSPLANAEDQILPSVVALDMAAIKNEGITVT
FT                   FAKSGKVSRILPVISRVMPDTTRLVYIHPAGSGKVLDVLVQPGASVRKGQVLLRYQDHS
FT                   LHGARLQAIQMRAALTAAIASRNNAAAAVQRAKQLVGQTLSLAELRRRQDILAQADATM
FT                   RARQADVDTLGHRFNEEFNSSSEQSSRKQQDEVSTLISPVDGMVQTLDTSVAADLTPTT
FT                   NVASVADLSDVWIVSDITPEQAARLQPGGLQTTETNDGAITSRIDTVDGMANPQTGLVR
FT                   VISRVSNPTGVLVPGMVLDASLTERDSVTGMVVPSDAIQKIDVHNVVFVQIDKTHYRPV
FT                   VVDVVLDNGMHAVVSSGLKEGEAVVSHGSFALKSIIGLAGMDAD"
FT   CDS             complement(44208..45443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="APA01_42210"
FT                   /product="cobalt/zinc/cadmium resistance heavy metal efflux
FT                   pump protein CzcC"
FT                   /note="Resistance-nodulation-division (RND) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01008"
FT                   /db_xref="GOA:C7JBI9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI9"
FT                   /protein_id="BAI01008.1"
FT                   /translation="MREILLLSIVTFSFGIFSANAQNMPEKIDFHRAVNMAWAVDPVRT
FT                   ELQVGHHSAKARSSAAGSWFAGGPTLSGEYMDDHAIGSNEGYTTYQGGVSVPLWLPGQG
FT                   SATRQVASAEAASLDEQLNVEYLSLSIRVLDGAAKAQIAQERLKAAHQLYEYASRINSL
FT                   IAHSAHVGESSSSESQIAQSEMENARNEQALAQEYLENSQAELEVLFAQPVEVDLSHGA
FT                   DMAHVRFVEPRDMEDNDPRVKAAHKNVEAAQANMKLARRSFMPNPELGIDVIHEKQYGS
FT                   PWDDRVGVNFSIPLPSEARNTPIMSEASNRLASANSQEIQARRMVHLEISRVRARLMAA
FT                   TAARQTTRIAAANMQKRAAAEEHAWRVGEATLETVMQAEQAACNAQFANARAEVEWHVA
FT                   TLRMMIAMGITP"
FT   CDS             complement(45462..45932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01009"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBJ0"
FT                   /protein_id="BAI01009.1"
FT                   /translation="MQRVIRYGLSILITLSLCGCVSYTETESICKGTEEGILLHIDGSY
FT                   AGYPHSVLRHAVLQSVACPTGETELQAFHAIAVPPPHMRVSIKRPAGQGRLGSLSVTLF
FT                   SQGRFVIGERMALTSFSRTQSPSSIKGDINLATVNLWNDLASRITHNKPIIP"
FT   CDS             complement(46335..46454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42230"
FT                   /product="DNA resolvase"
FT                   /note="Probably pseudogene, Middle domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01010"
FT                   /db_xref="GOA:C7JIT3"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIT3"
FT                   /protein_id="BAI01010.1"
FT                   /translation="MLAVLGGLADVERDLIRTRTSEGRIRAIRQGKKWDVLVA"
FT   CDS             complement(46615..47865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42240"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01011"
FT                   /db_xref="GOA:C7JB26"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JB26"
FT                   /protein_id="BAI01011.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTQLR
FT                   TRQSLSAGPFRRSGASS"
FT   CDS             complement(48701..49201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01012"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIT5"
FT                   /protein_id="BAI01012.1"
FT                   /translation="MRDMVPETDQRDICISARQRTRWMFYMRKTDICLLLSLDVPACAL
FT                   HAFGRMMQRQTLRWSRASGLIGNTVMLWADDRPDAESVAAPATVGGMLLVRSHRTWTTV
FT                   PTGDGKVGISQPGDLPSFSHQPSGGTTEGRREVYVCPLPVSVVPDESGNWIFSRHNLVP
FT                   CHF"
FT   CDS             49222..50310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01013"
FT                   /db_xref="InterPro:IPR015004"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIT6"
FT                   /protein_id="BAI01013.1"
FT                   /translation="MNGIYGFMKSNHFYSPFLSGIRNSTLLTAHMTKVSMIQESSFNIK
FT                   RIHFDENYHPSDRTRLTTNFANLARGGSRQENLRNVLRMIDNRFNGLAHWDNPLGDRYS
FT                   VELEIVSVEMDLAFAAKNDSFPLIEVLYTTIVDKKYNKRIEGLAGNSFSSYVRDYDFSV
FT                   LLPKYNKDKVEFSVPHNYGDLHGNLFKSAVNSTAYKKNFRKPPVICLSVSTNRTYHRTE
FT                   NQHPVLGVEYQQHEFSLTDQYFAKMGMKVRYFMPANSMAPLAFYFSGDLLSDYSTLELV
FT                   STISTMESFQKVYRPEIYNANSAAAGCYQPSLKHQDYSNTRIVYDREERNQLAVAQGKY
FT                   TEESFIKPYHDILEQWSASYAA"
FT   CDS             50338..51366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42270"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01014"
FT                   /db_xref="GOA:C7JIT7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR016456"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIT7"
FT                   /protein_id="BAI01014.1"
FT                   /translation="MKTLLPTSTAGSLPKPSWLAKPEALWSPWKLQGEELVEGKQDALR
FT                   LTLDDQDRAGIDIVSDGEQTRQHFVTTFIEHLSGVDFENRQTVKIRNRYDASVPSVVGT
FT                   VTREMPVFVEDAKFLRTLTKKPIKWALPGPMTMIDTLYDIHYKSREKLAWEFAKILNQE
FT                   ARELEAAGVDIIQFDEPAFNVFFDEVNDWGIAALERAIEGLKCETAVHICYGYGIKANI
FT                   DWKNALGEEWRQYEEIFPKLQKSNIDLISLECQNSRVPMDLIELISGKKVMVGAIDVAT
FT                   KTIETPEKVADILRKALKFIDADKLYPCTNCGMAPLPRDVARGKLNALGAGAEILRKEL
FT                   SV"
FT   CDS             51419..52402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="APA01_42280"
FT                   /product="transcriptional regulator LysR"
FT                   /note="Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01015"
FT                   /db_xref="GOA:C7JIT8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIT8"
FT                   /protein_id="BAI01015.1"
FT                   /translation="MEIVCLYDYMSFAHLLRQGMGVLERSHLTIIQEVAREGSLTAAAV
FT                   RLNLTQPALSHAIRKIENLLEVKIWRREGRSLVLTQAGEWLLSLANRLLPQFELAENRL
FT                   QQFANGERGTLRVGMECHPCYQWLLKVVSPYLERWPKVDVDVRQKFQFGGIGALFSNEI
FT                   DILVTPDPLYKPGLIFTPVFDYELVLVVGPEHPLRGAKFVVPEQLAGETLITYPVPPER
FT                   LDIYTQFLQPAGFGPRQQKQIETTDIMLVMVAHGRGIAALPRWLVEEYRSRFELHPVKL
FT                   GKKGIAKQIFLGRRETDEEIQYLRDFIECAGSPSSACRQLSPESGT"
FT   CDS             52463..52834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42290"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01016"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JCZ4"
FT                   /protein_id="BAI01016.1"
FT                   /translation="MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
FT                   GIPWRDLPARFGDWKNVHRRLRRWCESGVIERIFRYLAADYDNEYMMIDSTIVRAHQHS
FT                   AGALKKGARIRPSDDHEAG"
FT   CDS             52876..53217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42300"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01017"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JCZ3"
FT                   /protein_id="BAI01017.1"
FT                   /translation="MELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQ
FT                   RGITPVIPPKRNRTTRRKTDFSLYRERNLVERFFNKLKQFRAIATRYDKLKSTFLAAVQ
FT                   FASIIILLN"
FT   CDS             complement(53360..53656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xre"
FT                   /locus_tag="APA01_42310"
FT                   /product="transcriptional regulator Xre"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01018"
FT                   /db_xref="GOA:C7JIU1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU1"
FT                   /protein_id="BAI01018.1"
FT                   /translation="MSTYDSILQGLNEALAYSEAQVQNSVTHKVRVLSVNVAAIRTRTG
FT                   LSQAQFAKSIGVAKGTLLNWEHGRRQPTGPAQVLLAMLDKRPSLVSELLPAAR"
FT   CDS             complement(53653..53994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_42320"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01019"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU2"
FT                   /protein_id="BAI01019.1"
FT                   /translation="MSKLQTVVELPEFIKRAKALMSDDDRMALINTLAAMPDSGVSLGG
FT                   GLRKIRFAREGSGKRGGYRTLYVFGGRHMPLFLLTVFAKNEKDNLSRSEQAALVDLSKT
FT                   LIAKYGEPS"
FT   CDS             complement(54308..55387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42330"
FT                   /product="flavin-containing monooxygenase"
FT                   /note="Flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01020"
FT                   /db_xref="GOA:C7JIU3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU3"
FT                   /protein_id="BAI01020.1"
FT                   /translation="MAEQFDVVIVGGGQAALAASYFLRRTGLTYVILDNGTQAGGAWVH
FT                   GWDSLHLFSPASYSSLPGWPMPDTPDGSYPTRDEVLDYLHRYEARYAPPIHRPVMVGRV
FT                   ERTDQKFLNVRTSVGDFVSRAVIGATGTWSAPFIPDYPGRELFVRTQIHSSHYCNALPF
FT                   AGQRLLVVGGGNSGAQIMAELSLVAQATWVTQHDPVFLPDDVDGRVLFERATARVLGGP
FT                   SAMPTGGFGDIVMVPPVRAARERGVLHAVRQFVRMTATGVVWPDGREEAIDAIIWCTGF
FT                   RPALSMFAPLDVIEPDGLIRVNGQQAVREPRLWLLGYGSWCGPASATLLGAGRVARSMV
FT                   RQLAAWLASPAQGVRLPKP"
FT   CDS             complement(55396..56094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="APA01_42340"
FT                   /product="arsenical resistance protein ArsH"
FT                   /note="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01021"
FT                   /db_xref="GOA:C7JIU4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU4"
FT                   /protein_id="BAI01021.1"
FT                   /translation="MTEPDLPALHPEYLERVDLARLEPQPRVDHPPRILLLFGSLRPRS
FT                   FSRLLVLEAERILKVLGAETRVFDPTGLPVADSVPATHPKVQELRDLSIWSEGQVWCSP
FT                   ERHGNITAVFKNQIDWLPLSEGAVRPTQGRTLAVMQVSGGSQSFNSVNALRVLGRWMRM
FT                   FTIPNQSSVPMAYTQFGDDDRMKPSPLYDRMVDVMEELMKFTWLLRDRADYLVDRYSER
FT                   KAEFRLPESL"
FT   CDS             complement(56118..57413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42350"
FT                   /product="arsenical membrane pump protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01022"
FT                   /db_xref="GOA:C7JIU5"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU5"
FT                   /protein_id="BAI01022.1"
FT                   /translation="MLALLIFVATLVFVIWQPRGLGIGWSAMAGAAVALAAGVIHWHDI
FT                   PVVWHIVWDATFTFIALIVISLLLDEAGFFHWAALHVVRWGKGRGRTLFPLIVVLGAAI
FT                   AAVFANDGAALLLTPIVIAILTQLRLSHGAALAFIIATGFVADTTSLPLVISNLVNIVS
FT                   ANFFGIAFDRYAAIMVPVDLVALGATLAVLWLWYRRQVPATYPVAELPAPAAAIRDHHV
FT                   FRAAFPLLVLVLAAYFLTAPFHIPVCVVACLAAGILLLVAGYGRVIPVRKVLRGAPWQI
FT                   VIFSLGMYLVVYGLRNAGLTDYLATALVWLGHQGTFTATIGTGFLAAVLSSIMNNMPSV
FT                   LVGALAIQQAHDITPLTRDLMIYANVIGCDLGPKFTPIGSLATLLWLHVLASRNHRVTW
FT                   GQYMKVGLAITPPVLLVTLAALSLWLPWISHS"
FT   CDS             complement(57413..57835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42360"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01023"
FT                   /db_xref="GOA:C7JIU6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU6"
FT                   /protein_id="BAI01023.1"
FT                   /translation="MTIMIYHNPACGTSRNVLALIRNAGIEPTTIEYLKTPPGRAELVD
FT                   LIARMGVPVRSVLREKGTPFHELGLDNPALSDDALIDAMMAHPILINRPIVVTPLGAAL
FT                   CRPSETVLDILPNPQRGAFVKEDGEKIVDESGKRII"
FT   CDS             complement(58322..59059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42370"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01024"
FT                   /db_xref="GOA:C7JIU7"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU7"
FT                   /protein_id="BAI01024.1"
FT                   /translation="MGDKDHRILTYGDEHIRVELLPRARPGTTLRIKVHPDLTVQVVVP
FT                   EDTIETDLDRALKQKTRWIWQKLRDFRAVQEHATPRAYVSGESHFYLGRRHLLKVQHQP
FT                   DAPETVRMLRGRLEVSVQERNALRIQKLLELWYFARAQDVFRTRLDALLPSALWVTTPP
FT                   TLKLQVMQTQWGNCSAGGTITLNPHLVKAPRDCIDYVILHELCHLKEHNHGPAFWALLA
FT                   RVMPDWERHKVRLDGMAEMMLQN"
FT   CDS             complement(59062..62358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42380"
FT                   /product="type I/III endonuclease restriction R subunit"
FT                   /note="Restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01025"
FT                   /db_xref="GOA:C7JIU8"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU8"
FT                   /protein_id="BAI01025.1"
FT                   /translation="MVSAPKFQEEYSAKLPALALLSTLGWRFLPPSEALALRGDRQSAV
FT                   VLDTLLRAELKKRCFTFEGQEHSLSDQAINTLVSHVTHPDFVSGLRDANDKMTTHLLFG
FT                   IAIPEFINGHKANPTIALIDWQNPENNSFTFTEEFSVLRTDLTQTRRPDIVCFVNGIPL
FT                   AVIEAKRPDGQPGKGPTVEAGISQSIRNQNKDEIPQLFAYSQLLLSINGHDGRYGTCGT
FT                   PKKFWASWKEEDIPESRMEALKNMPLSGTQKDVLFADRKPPARIWFEDWASRPLHVSDQ
FT                   DRLLIGLLSPQRLLDMTRYFTLVDRKVGKIVARYQQVFGIKRLLERIKSRRSDGGREGG
FT                   VVWHTTGSGKSFTMVFLSRALILDDDLKQCRIIVVTDRKDLERQLSITFSTGGELADKK
FT                   DKEEALATSGRRLAQQIGHGQERIIFSLINKFHTATGYPECHNDSADIIVLVDEGHRSQ
FT                   GGENHARMKHALPNAAFIAFTGTPLLKGSETTNRFGKIIHSYTMQQAVADGTVTPLLYE
FT                   ERKPDLDVNDRAIDAWFERITQGLTEEQVTDLKKRFARANQVYKADDRIRLIAMDLATH
FT                   FDSNIDSGLKGMLACDSKLSAIRYKRYLDEVGLFESAIVMSPPDTREGHTEVDERKQPE
FT                   IQTWWKENVGSQSEEDYTRDVIDRFENDPNLKLIIVVDKLLTGFDEPKNAVLYIDKPLK
FT                   QHNLLQAIARVNRLHDQKKHGLLIDYRGILAELDTTLAKYDELAAENVGGYDPKDIAGL
FT                   YSQMSTEYRELPALHKALWAIFDGVKNKSDIQQLRAVLMPRMVEEHGQMVDVNLKRRDD
FT                   FYEALTKFAACLKVALQSVAFFEDTSFTEKDRATYKETLKQLTSLRQMVMQDTGEKVDF
FT                   DQYAEQVKKLLDRHVAGVKVHESEGLYAVGKMGQKPDDNQPETWSEEKTRNETDLIRTR
FT                   VTKMIDHEMQDDPYAKEAFSALLRKVIAEAESLFDHPLKQFMLFQEFEEQVANRKLENI
FT                   PTVFDGHRHAQAYYGVFLKTLAAIFNHKQTDEENQRWIDLAFQIDTIVDKAVRENSLSR
FT                   PDMEKAVRKELLPLLFSTGQKAGFGVDKAQEIIEQVIQIMRAGPADTLRS"
FT   CDS             complement(62390..63544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42390"
FT                   /product="type I DNA specificity S subunit"
FT                   /note="Restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01026"
FT                   /db_xref="GOA:C7JIU9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU9"
FT                   /protein_id="BAI01026.1"
FT                   /translation="MLPEGWKETTLEKYIHVKHGYAFKGEYFSNSGKYIVLTPGNFFET
FT                   GGFKEQKDKIKYYSGEIPKEYILKKGDCILAMTEQGAGLLGSAAFIPNDDKFLHNQRIG
FT                   LIEITDPNSVSSDFLYWLYNDPKNRLIISNEAGGTKVKHTSPKKLVDISILLPPLSEQK
FT                   KIAAILSTWDRAIEETEKLLANSQQQKKALMQQLLTGKKRLPGFTGEWKTKYLGDIADI
FT                   QTGSSNRQDSLTNGEYTFFDRSEDIRTSNRYLFDCEAVIVPGEGQDFVPKYFVGKFDLH
FT                   QRTYAISCFQACDGKFIFYTVGYHRSHFLSQAVGSTVKSLRLPMFQKMPLKLPPLSEQR
FT                   AIAAVLTTADEKLAALESDLSRLRQEKKALMQQLLTGKRRVTVD"
FT   CDS             complement(63534..65060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="APA01_42400"
FT                   /product="type I DNA methyltransferase M subunit HsdM"
FT                   /note="Restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01027"
FT                   /db_xref="GOA:C7JIV0"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV0"
FT                   /protein_id="BAI01027.1"
FT                   /translation="MTEQISQDTINKALWNACDTFRGTVSPDTYRDYVLTMLFLKYISD
FT                   VWQDHYDTYKKEYGDNPELIEAMMAQERFVLPKGADFYTLYKERNTPGNGERIDKALHA
FT                   IEEANGTKLKDAGKSVFQDISFNSDRLGDEKQKNTVLRHLLEDFAKPDLNLRPSRVGNL
FT                   DVIGNGYEFLIKNFAASGGQKAGEFYTPPEVSELLARILSPQPGESICDPACGSASLLM
FT                   KCGKQVTQNHNGSKDYALYGQEAIGSTWSFAKMNMFLHGEDNHRIEWGDTIRSPKLLDD
FT                   KNHLMRFDVVTANPPFSLDKWGHEDAAEDVHHRFARGVPPKTKGDYAFILHMISTLKDR
FT                   TGRMGVVVPHGVLFRGSSEGRIRQKLIEENLLDAVIGLPEKLFFGTGIPAAILIFRKDR
FT                   KTKDVLFIDASREFKAGKNQNVLTEENITKIVNTYRTRKDVDKYAHLATPDEIRENDYN
FT                   LNIPRYVDTFEEEEEIDLNAVRKERAEIKAELAKLEAQMDAYLKELGYAS"
FT   CDS             complement(65096..65692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01028"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV1"
FT                   /protein_id="BAI01028.1"
FT                   /translation="MKPNGAQKMDLVAVASISAGHPFRGRIDPVAGVETAVVQMRDTSS
FT                   SGVDWTSCVRTEVAGRREPDWLRPGDILFPARGNVSLAVLVNESIGSLQAVAAPHFFLL
FT                   RVMHPNVLPAYLAWWLNQEPAQRHLEQNAQSSTLVRNIARPVLEATPVILPPLPRQEQI
FT                   VGLANAMQREEDLLHRLRQTNQQIMTGLARDLLAG"
FT   CDS             complement(65928..66755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42420"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01029"
FT                   /db_xref="GOA:C7JII3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII3"
FT                   /protein_id="BAI01029.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYREQELNLRIKPRRRL
FT                   VREKPEKLSVPALPNRVWSMDFMADRLMDGRAFRLLNILDDFNREGLAIEGDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVPWAEKQGITLIYTQPGNSQQNASIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(66752..67015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42430"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01030"
FT                   /db_xref="GOA:C7JC92"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC92"
FT                   /protein_id="BAI01030.1"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             67131..67442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42440"
FT                   /product="nodulin-related protein"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01031"
FT                   /db_xref="GOA:C7JIV4"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV4"
FT                   /protein_id="BAI01031.1"
FT                   /translation="MKHDALGELGLSEATAARPIQAAFASATAFSSGALLPVLAAVLTP
FT                   VAWVSWGVSLTSVVVLAVLGVVGALVGGAAPLRPALRVTFWGIVAMIVTGGIGRLFGV"
FT   CDS             67870..68292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42450"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01032"
FT                   /db_xref="GOA:C7JIU6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIU6"
FT                   /protein_id="BAI01032.1"
FT                   /translation="MTIMIYHNPACGTSRNVLALIRNAGIEPTTIEYLKTPPGRAELVD
FT                   LIARMGVPVRSVLREKGTPFHELGLDNPALSDDALIDAMMAHPILINRPIVVTPLGAAL
FT                   CRPSETVLDILPNPQRGAFVKEDGEKIVDESGKRII"
FT   CDS             68292..68822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42460"
FT                   /product="arsenical membrane pump protein ArsB"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01033"
FT                   /db_xref="GOA:C7JIV6"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV6"
FT                   /protein_id="BAI01033.1"
FT                   /translation="MLALLIFVATLVFVIWQPRGLGIGWSAMAGAAVALAAGVIHWHDI
FT                   PVVWHIVWDATFTFIALIVISLLLDEAGFFHWAALHVVRWGKGRGRTLFPLIVVLGAAI
FT                   AAVFANDGAALLLTPIVIAILTQLRLSHGAALAFIIATGFVADTTSLPLVILNCPGFCG
FT                   DRKTREVRRIHEQ"
FT   CDS             68812..69135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42470"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01034"
FT                   /db_xref="GOA:C7JIV7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV7"
FT                   /protein_id="BAI01034.1"
FT                   /translation="MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHP
FT                   DTLSKWTRLHERANAPAVSELPDREKIRQLERENRELRQANDILRKASAYFAQAELDRI
FT                   FKP"
FT   CDS             69132..70022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42480"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01035"
FT                   /db_xref="GOA:C7JIV8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV8"
FT                   /protein_id="BAI01035.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNNNFCVYGARKVWHQLRREGLDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVGWRV
FT                   SSTAHTDFVLDALEQALCQRRPEGKVTHHSDRGCQYVSIRYTQRLAEAGLVASVGSVGD
FT                   SYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNIPPAEA
FT                   EARFYAQQKSHALAA"
FT   CDS             70134..70883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42490"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01036"
FT                   /db_xref="GOA:C7JIV9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIV9"
FT                   /protein_id="BAI01036.1"
FT                   /translation="MIVAFRRHTLLPLDDCLYALQASIPYLTRSALHRCLQRHGISRLP
FT                   DIERDKAKRQRFKRYPIGFFHLDIAEVQTAEGKLYLFVAIDRTSKFAVTQLVEKADRKT
FT                   AWEFLEHLLSIIPYRIHTILTDNGIQFADQPRNRNTAWSRPMRFDMICEAHGIEHRLTK
FT                   PNHPWTNGQVERMNRTIKEATVKRFHYDSHEQLRTHLNDFMAAYNFGRRLKTLSGLTPY
FT                   EYLCKIWTSEPERFIINPTHQTPGPNT"
FT   CDS             complement(71062..71973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="APA01_42500"
FT                   /product="transcriptional regulator LysR"
FT                   /note="Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01037"
FT                   /db_xref="GOA:C7JIW0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW0"
FT                   /protein_id="BAI01037.1"
FT                   /translation="MRGYDLDLLRFLQVLIEEQSVSNAARRMNVSEPAMSRHLSKLRTV
FT                   FGDPILVPSGRRLIASTFALNIRDRLQAVLRAADGLIETQALANLRNMAPKFTVRANDV
FT                   IIAAIALPLLQALRQDCPNCELVFAPEFDEAANLALRDDSIDLYIGATDVLKPEIRRQT
FT                   IFHHVMKALVRADHPILSEGVTVESLTRFEHISVSRRGRAHGPIDTILRDQFGLTRRVV
FT                   LVVPNYKAMIDSIRGTDFIVTLPDMALNNVLLTETGLAAIDYPFPLPRVEAFQAWHPRR
FT                   DNDPVHRWLRETLFRVAQKFQN"
FT   CDS             72092..73789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42510"
FT                   /product="multidrug resistance transporter"
FT                   /note="Major facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01038"
FT                   /db_xref="GOA:C7JIW1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW1"
FT                   /protein_id="BAI01038.1"
FT                   /translation="MNSSHDGTPDDIRGLGERTHQLSPARSFSPAAPIIHPSPPLPSYI
FT                   PPFGRRTIIGCLGVLLAVHMASFNEHVTEIGLSDIRGAMHIGHDEGTWFTTIYEAFNIA
FT                   SMAFTPWFYATFSIYRFSIFMTAMIALLAIPAPFMPDVTSLCILRGFQGLTAGCLPPVL
FT                   MTVMLKYLPAEIRVFGIGAYAMSATFGPNLGVPLEAFWFEYVGWHWLYWEIIPLAVLSI
FT                   FMIAYGLPRDPLQLERFGKFNWLGLLTGLPAICSLVIVLYQGDRLDWFRSPVITDLAFW
FT                   GCAAFIVFLVNESFHPSPFFKIHYWGSRSIAASLLSLIGILAICGLLSALPMSYLEEIR
FT                   GYRPQQISPVSLVVALPQLIMLPLIAAICNSRKVDCRYVLAAGMLCLAVASWLGTWLTP
FT                   DWVRDNFYVMQALQAFGQPMTVIPTLMLSALALGPADGPFISGMVNMLKGLANAVAFAL
FT                   FAALTRRREHYHSVMLLDHYGNHGLALQGMGDPIGHQLANTSPDAQHVVHNALEVFHTF
FT                   VHEQALVLGFADIYFILIWVCIFFAILNIILPRRVYPPRAPSILNSAK"
FT   CDS             73978..74289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42520"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01039"
FT                   /db_xref="GOA:C7JIW2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW2"
FT                   /protein_id="BAI01039.1"
FT                   /translation="MGKVTRKRYAAEFKSRVALEAIRGELTLAELASKHGVHQTMIAQW
FT                   KRQAIEGMASLFSGKSVTEPSVSPADVEKLHAKIGQLLVERDFLRDASARLGVIRGGR"
FT   CDS             74286..75170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42530"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01040"
FT                   /db_xref="GOA:C7JIW3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW3"
FT                   /protein_id="BAI01040.1"
FT                   /translation="MIDPKRACLPIIRQCTLLQLNRSGVYYRPVPQSEANLELMRLIDA
FT                   QFLETPYYGSRQMTWHLRRLGHEVGRKRVRRLMVIMGLRAIYQKPRTTVPHPEHRKYPY
FT                   LLRDLVINRPDQVWCSDITYIPMKRGFLYLVAIMDWFTRKVLSWRLSNTMDVEFCIEAL
FT                   QDALMRYGAPDIFNTDQGSQFTTPRFTGILEERQIRISMDGRGRWRWLDNVFIERLWRS
FT                   LKYECVYLHAFETGSELRAGLGIWIAHYNERRPHTALAGRTPDEAYHDVPTPSGPGLTP
FT                   DQMANSNAVRRAA"
FT   CDS             75289..76020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01041"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW4"
FT                   /protein_id="BAI01041.1"
FT                   /translation="MFSNSTLWKYGISPDFSIQVHTIVDYGWKHAEGHSHGPKTGDVPV
FT                   DLIYRLVRPNPKRYIPAFNLFVGMVFPTGDYTKLGDKQDGVGSGAYVFRTALTEQSTYT
FT                   LPGNHELRLRVWNWFRRAVTSAKLVDTTSYGTAYGFRGRGQPGMSGQTGFSLEYGLSQK
FT                   WVLAMDIAHDWSNGSTLRGHDKNGTYIHKTGAAGTDWQIAPAFEYNWNANWGVIVGSAF
FT                   YFAGHNKSIQVSPQFAVNAMF"
FT   CDS             complement(76062..76451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrR"
FT                   /locus_tag="APA01_42550"
FT                   /product="transcriptional regulator NtrR/PilT"
FT                   /note="Nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01042"
FT                   /db_xref="GOA:C7JIW5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW5"
FT                   /protein_id="BAI01042.1"
FT                   /translation="MFDTNTISDIIRADERVLLHVEALDPDQCCVSAVTAGEVAYGLAK
FT                   RPSATRLQRLTRTVMDRLTILPWNNDVAEHYGKLRAEQERRGQILGSLDLMIAAHALTE
FT                   HLMLVTSDHAFSQVRGLTVRNFRNS"
FT   CDS             complement(77817..78131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42560"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01043"
FT                   /db_xref="GOA:C7JIA5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA5"
FT                   /protein_id="BAI01043.1"
FT                   /translation="MRFDMICEAHGIEHRLTKPNHPWTNGQVERMNRTIKEATVKRFHY
FT                   DSHEQLRTHLNDFMAAYNFGRRLKTLSGLTPYEYLCKIWTSEPERFIINPTHQTPGPNT
FT                   "
FT   CDS             complement(78141..78791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42570"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01044"
FT                   /db_xref="GOA:C7JIW7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW7"
FT                   /protein_id="BAI01044.1"
FT                   /translation="MEGSIMGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTV
FT                   AKWRKRQSVEDQKTGPKEPRSTVLSETDEAMIVAFRRHTLLPLDDCLYALQASIPYLTR
FT                   SALHRCLQRHGISRLPDIERDKAKRQRFKRYPIGFFHLDIAEVQTAEGKLYLFVAIDRT
FT                   SKFAVTQLVEKADRKTAWEFLEHLLSIIPYRIHTILTDNGIQFADQPRNRNTA"
FT   CDS             78990..79253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42580"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01045"
FT                   /db_xref="GOA:C7JBI0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI0"
FT                   /protein_id="BAI01045.1"
FT                   /translation="MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             79250..80077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42590"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01046"
FT                   /db_xref="GOA:C7JIW9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIW9"
FT                   /protein_id="BAI01046.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYREQELNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             80271..81869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42600"
FT                   /product="potassium transporter Kup system"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01047"
FT                   /db_xref="GOA:C7JIX0"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX0"
FT                   /protein_id="BAI01047.1"
FT                   /translation="MSLTAPASVQVGKGAAGHDARPAGFAAILGALGVVFGDIGTSPIY
FT                   ALRTTAQVVSDHGTIAASEVLGVESLLFWTLMLIVTVKYVILVMRADYNGEGGIIALMS
FT                   LAQQTAKRRSVKLLLGMTGVIGACLFFGDGIITPAVSVISAIEGIEVSFPAASHLVVPL
FT                   SIVVLIGLFSIQFHGTGRIGIIFGPVMVVWFLMIGILGVLAIIHHPGILLALSPIYAIM
FT                   FIAQHGYLSFLALGSVVLAVTGAEALYADMSHFGRRPIREAWLFFVLPCLALNYFGQGA
FT                   LLISDPATISNPFFLLGPQWLQVPMIIISTIATVIASQACISGGFSLCRQLIQLGYVPR
FT                   MRIMHTNPTEESQIYLPGLNHSLMVGALLLVIAFRSSEALASAYGIAVTGTFLCTCILA
FT                   AVVYRDRYKWSPWATIAVFGGFFIIDGIFFASNTLKIIEGGWVPVLLAAVLILMMFTWK
FT                   KGRSLVLARQQHDAMSVAAFMARLPHSRSIIRVPGTGVFMTANPEFIPTSLLHNLKHNK
FT                   VLHEHVVIPPFLVGH"
FT   CDS             complement(81878..82705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42610"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01048"
FT                   /db_xref="GOA:C7JI80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI80"
FT                   /protein_id="BAI01048.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(82702..82965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42620"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01049"
FT                   /db_xref="GOA:C7JC92"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC92"
FT                   /protein_id="BAI01049.1"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             83080..83394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42630"
FT                   /product="potassium transporter Kup system"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01050"
FT                   /db_xref="GOA:C7JIX3"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX3"
FT                   /protein_id="BAI01050.1"
FT                   /translation="MTDQRAEVAEVAPNIYRVTLRYGFMEMPNLPPALAQLQFESTGFD
FT                   VSQASYFVSRELLVRSRPSHISRWRMALFLLMTKNATPITDFLRIPLDRVVELGVRIGI
FT                   "
FT   CDS             complement(83677..84450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42640"
FT                   /product="transposase"
FT                   /note="IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01051"
FT                   /db_xref="GOA:C7JIX4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX4"
FT                   /protein_id="BAI01051.1"
FT                   /translation="MILRLLHLWSCSVDCGCMACPRPRPTSSSRGAPAFEAAIPILSQL
FT                   LKAELAEREVRSIAYQTKTARFPAYKDLSGFSFADTQVNEPMIRQLHSGDFIERAENVV
FT                   LIGGPGTGKTHLATALAIQAITHHRKKARFWSTVDLVNALEQEKTANRAGQIADRLLRL
FT                   DLVILDELGYLPFSASGGALLFHLLSRLYERTSVIITTNLSFSEWGDVFGDPKMTTTLL
FT                   DRLTHHCHILETGNDSYRFRASTAASKNRKDRSSS"
FT   CDS             complement(84447..85712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42650"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01052"
FT                   /db_xref="GOA:C7JIX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX5"
FT                   /protein_id="BAI01052.1"
FT                   /translation="MALGYDGSYGRVAAFIRQWKHEQHQARQTTGRGVFVPLCFQPGEA
FT                   FQFDWGEDWAVIAGRRVKLQVAHTKLSFSRAFILRAYPLQTHEMLFDALTEAFRVLGGV
FT                   PRRGIFDNMKTAVDRIGSGKARQVNLRFMALASHYLFETTFCNPAAGWEKGQIEKTVQD
FT                   ARRQIWQDLPAFPDLGALNAWLEARCLDCWERLQHIELARSIAEVHASERPHLMVPGRP
FT                   FDGFVEQTKRVSPTCLIQFDGNRYSVPASFANRPVSLRVYPDRLRIIAEGQVLCVHDRI
FT                   ITRSHGVPGRTVYDWRHYLAVIQRKPGALRNGAPFTELPAAFRTLQDQLLRRPGGDREM
FT                   AEILALVLQHDEQAVLCAVELALEDGVATKTHVLNTLHRLIDAKRTVVPRLDAPQALVL
FT                   EHEPCADTGRYDILRRDSRHAS"
FT   CDS             85722..85889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01053"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX6"
FT                   /protein_id="BAI01053.1"
FT                   /translation="MQSSRRAPVLAGASGFQDQPSPQPVSKRVQSAGTFGDLEPRFNTL
FT                   CPEIFPDRIA"
FT   CDS             86004..87389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42670"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01054"
FT                   /db_xref="GOA:C7JBK8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBK8"
FT                   /protein_id="BAI01054.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             87619..88104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42680"
FT                   /product="conjugal exonuclease V alpha subunit TraA"
FT                   /note="Probably pseudogene, Middle domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01055"
FT                   /db_xref="GOA:C7JIX8"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX8"
FT                   /protein_id="BAI01055.1"
FT                   /translation="MPTGGDPHAHFHNTMFNMVVTDDGHVGSLDTKQLRSRVHEFGAYF
FT                   QAILAQELRKIGIAQTYDANEQATVVSAVPQEISDFFSKGRRNVLKAAQSYASEQGLEW
FT                   DKLSIERKQKMLSMAGLAARLGKDLDADDHDIWKRQAKELGWVEQSLMGPEIDPGLD"
FT   CDS             complement(88142..88771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42690"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01056"
FT                   /db_xref="GOA:C7JIX9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX9"
FT                   /protein_id="BAI01056.1"
FT                   /translation="MRRMGLKGVIRGKGVRTTRPDPQRPCPQDLVQRQFHAPAPNRLWV
FT                   SDFTYVSTWQGFVYVAFIIDVFARVIVGWRVSSTAHTDFVLDALEQALCQRQPEGKVPH
FT                   HSDRGCQYVSIRYTQRLAEAGLVASVGSVGDSYDNALAETINGLYKTELIYRQGPWKNR
FT                   EAVELATLKWVDWFNNRRLLSSIGNIPPAEAEARFYAQQKSHALAA"
FT   CDS             complement(88968..90353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42700"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01057"
FT                   /db_xref="GOA:C7JIY0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY0"
FT                   /protein_id="BAI01057.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFMDQHERAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(90411..92441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traGD/dotL/trbC"
FT                   /locus_tag="APA01_42710"
FT                   /product="conjugal transfer protein
FT                   TraG/TraD/DotL/TrbC/IcmO"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01058"
FT                   /db_xref="GOA:C7JIY1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY1"
FT                   /protein_id="BAI01058.1"
FT                   /translation="MVKRQIGGPLGHQQIKRGATYRDTRPLFERFTAEMRTSSSGFVLL
FT                   IVAGLSWFIPALVGLTLPLALLLTCWVVTRKPLLPFHLPRYSELPDAHDLDPSTRKPKK
FT                   AGGIIYLGTDAHTGQQLWFSSDAGRQHAAMPGTTGAGKTTSALSLMANPLSHGSGFLLI
FT                   DGKGDNTVYGDVAALLRRFGLDDQLLTLNLLTASSIRESNTFNPFATGNADAIREMLVS
FT                   QLGEPVSNDANGVFRDRAVNLIGTLTPALVWMRDRHGISINIETIRFATELRWLATLAR
FT                   HKIFLVRSPGQPQPIKIPVPDIPDDVLYPFQAYLGELPGYDIGLEWNQQKESRPSEQHG
FT                   FATMYFSKIFTQFAVSLGHIFKCENGDIDMRDVVLNRRVLVVILPSLENSSDTLAGLGK
FT                   IIVASVRAVMAQLLGARLNGPASEIFKLKAGSGDAPYQFFFDELSAYATDGMDRMLAMG
FT                   RGLNCMFWLGFQDLPGLTSRIGDKAFTLLGNANLTHAMRLQDAMRTREWIEKQADRVEV
FT                   TQATHYEGNSAGSYREGRGAEIREVARIPWADLQSLIEGEAITMFGGKVVHSKTFFAAV
FT                   NGRTGVIRTAQPVMLSAPLVLDGSAPDDETRAVLETIENGSYRSELHAPVTEPAFERLV
FT                   AEVKSAGNTPAAIGRRFPIIAQATVGLSVDAEISQKGCTSG"
FT   CDS             complement(92445..93077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01059"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY2"
FT                   /protein_id="BAI01059.1"
FT                   /translation="MTTITIETEGQPPIVITVGHSNTMTVSKKDYLTHPQPHPLSPPAH
FT                   ALPSTSPTAASPSGWKNCLRNYAPGVALGVIAAIVIIGSRPAQIPTPMMQDPGNTIPQQ
FT                   PMLPPLSGGPIGASSPSGGYGPDGQEGPRSVNETVRDTQRAIASDRIGLPQQRPDGTGP
FT                   TGAGLNQGGAPTAGVAPTIKGAPVVGLPQPGSSDTSSKSNSPFGLEP"
FT   CDS             complement(93090..94238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01060"
FT                   /db_xref="GOA:C7JIY3"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY3"
FT                   /protein_id="BAI01060.1"
FT                   /translation="MSSSSTPWSSSDDYALFSIIAIIVGGAGLSYMVWSNWHAEISLLY
FT                   IRALVWQIDFLHLHSQPLVQLRQQLVTASWSPEHVRAIQLWYGLMILGSALRWPVAIII
FT                   AALGITCIFRATPGRFAKALDLEGLIEVQARMFPTLRGFAERRLTKLVAPAQGMPRPAD
FT                   PALHAHEWRARFATDRNGHFSEAGAISAFTAQLGRHWTGLDAATPVERVLFAAFIAHHS
FT                   QERAEAMDLLGRLSESLRKAGLDGPEGPKSALSVPSEIISIADEKLSVPGVSAKIDTIC
FT                   ARNGWTTTALMTLLTEARRKAGVLAPPAFAIVKLIDRSLWYALHSLDFPHERPEEDVHP
FT                   NPRVEAAGARAHWEAERKARRPIYTPTVSVAVATLQKNSDQS"
FT   CDS             complement(94235..94750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42740"
FT                   /product="conjugal muramidase TrbN/BfpH"
FT                   /note="Type IV pili biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01061"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY4"
FT                   /protein_id="BAI01061.1"
FT                   /translation="MKSLSLLTATFLALGLTRISHAQTAQDDAFVQGQRVQACLTAAAS
FT                   NARVPAGVLLVLLYVENGRPGMVSTNSNGTVDLGPMQVNSTWVRKVAAHWHSTPLRTYT
FT                   ALRDNVCANIEAGSWILGQALSETHGDLWQAVAYYHSHTPRYGEAYLRRFYHIATDMMV
FT                   RARKGRAS"
FT   CDS             complement(94750..95436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01062"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY5"
FT                   /protein_id="BAI01062.1"
FT                   /translation="MIDVARNRLTRKVSYSGRQKLSAHFAGSCSLELDNIDHRSAGHSL
FT                   FWHHFVFWAHLACCPADGAPLAHWQETHGSPDMEATEILMNISASIVRVDDVAHGVLTL
FT                   LSEIERPAIVVDRATGQEASVSHEEIARADGYLPVIVVAAEALWFDLTGTGFALDVREN
FT                   AEATLGYSLHGIRAGSWSVLMLCIIDLFETLALNEETLRLNDLVELWGNARSRLQTVPV
FT                   PLQEAS"
FT   CDS             complement(95429..96595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotB/traJ"
FT                   /locus_tag="APA01_42760"
FT                   /product="secretion system type II protein DotB/TraJ"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01063"
FT                   /db_xref="GOA:C7JIY6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY6"
FT                   /protein_id="BAI01063.1"
FT                   /translation="MNVIITPPEERETWENEGRSGYTWVVERRKYAPGLDDLLKWAYRL
FT                   GASRIDFKTGHPVTILVHGKVRCATRGATDDFAIADVVSHMYAQDGMSMLAIYHDLDSA
FT                   YSVSLNRRETLRFRVNFTPCEVMRGQGVNIVMRPIPSRPPSLASQNVEPEVLASNDIPS
FT                   GMKLIGGATGQGKSSLTFALAEEKVMRPDANCNIATGESPVEFLMDYIRSPTGSKITQT
FT                   EIRPPHMTFAKFVRGTTRREMTELIVGECRDHETMDAAINCAITGSILGTTIHADNVGL
FT                   MMQRAVSLCAREERDNLVSALAQSMRFCLNQRLLPRKGGGRVAIREFLTFDRDLRFRLM
FT                   RTDPQCWPEFINDVLKTDGQSYARAIDARLEQGLITEETALMAKRRDD"
FT   CDS             complement(96592..97626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotC/traI"
FT                   /locus_tag="APA01_42770"
FT                   /product="conjugal transfer protein DotC/TraI"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01064"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY7"
FT                   /protein_id="BAI01064.1"
FT                   /translation="MRKTIHYTLMACTMLATFVRPGLAEEAPHIDGRLIPFKTSAPPTA
FT                   PNGTLVPMPQPPEPAADDIEQAEPALANPTNKPITGAQELDKIVGGDRPLSLEALQNTR
FT                   PNDEGSDGLKPGRKEALQEAAHIYGAQGGLAARSFAINEMLRRYEDTLDATFDFRSLVL
FT                   PIGSGQTLMQPPIVTEAQMAFALNGTGQVAHETQCVFEITREAQLTSAPPNWRTYLVRS
FT                   WRKPQHPAAAALPMNRKEVGYWNDWVAEGWAAGEKQATEIFLSDLSRLQRDIVGMARYR
FT                   VLLANGRVEEPHVVFEQKASVGGGDTLHVGDRVVRITSQPGLRGLRRDRGYGFSAPLYP
FT                   ERCR"
FT   CDS             complement(97619..98077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotD"
FT                   /locus_tag="APA01_42780"
FT                   /product="secretion system type IV protein DotD"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01065"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY8"
FT                   /protein_id="BAI01065.1"
FT                   /translation="MKKTSFLFATLTIGLTACSGHIKPGPIETTGMPNPELALQRSISS
FT                   TTADLRELGTIHAAPSVPVADQSSTPDDINRRIWFVWKGPLNAGVRKLGKEIGYTVTVF
FT                   GKSHDIPVQTNSVAAVLDILRSFGDQAGDAATVQVDPFHHQIAVVYHA"
FT   CDS             98773..99042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_42790"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01066"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIY9"
FT                   /protein_id="BAI01066.1"
FT                   /translation="MTSSNAISQVNLKVNTQLKENAYATLKELGTTPSDFFRDILEYVV
FT                   REKKLPIKRLTVSDEDAEFYALVRERLKNPGKIHRNVDLESLLR"
FT   CDS             99044..99319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_42800"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01067"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR035095"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ0"
FT                   /protein_id="BAI01067.1"
FT                   /translation="MLDAAKKELAALPKTENNQIIKRLIKLQDNPHIPALALSGNLAGC
FT                   YEIKLRTAGIRAVYSVDDGKMTLLVIAIGKRERKQVYKTASDRFNE"
FT   CDS             complement(99542..102232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotO"
FT                   /locus_tag="APA01_42810"
FT                   /product="secretion system type IV protein DotO/IcmB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01068"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ1"
FT                   /protein_id="BAI01068.1"
FT                   /translation="MGGLPYVLWTRKGVLSREERKQVSEEQAATAKAFPNIGDTQRFAL
FT                   RSEIMLARHTAAVHRIEGALNGLDISCTLINPHEALRITREIVYRETAASKWNPCLIGD
FT                   RVMPRLPDAPDAEGPLLEGELWPAIRDQIFNADADTIGGQLVNIGDYCYAPVDMELGPE
FT                   DPRPFSELSATLGRKRIPWRSAMILESGGGAAFALKEVGAGFLAMLPGNEDIRRSFAAL
FT                   RTMREKKNHNSVRLRMTAATWAPIGEDAKLRRQASALSQAIEGWGNCKTTRVSGDPLEA
FT                   AMGSVPTLSLGSTANPSLAPLGEAFTMMPWVRSASPWQRGSILFRRPDGSIWSFDPTGG
FT                   GLREAIVDIIVAPPGGGKTVMSNTINLGLVLSSAALSGNGAKLPFIGKVDIGPGGQGFV
FT                   SLLQAALGQERAHEVAYLKMQKTQGYEVNVFDLQLGLEYPLPLERVFLENFISLLATPL
FT                   GKPPFEGMDHLVQDVIDEAYRLCTDVSGGEPKLYRPGTEPMVDAAIQHHNLTLPHHGGE
FT                   EDPTWWRDVVDALIDVGDYRMAGIAQRHAVPVLQDLLRAARTPEISKRYEKIRIETGES
FT                   LIDVFDRYIMNVIKNFPTLAAPTQLDLGDARVIMIDLAEVAPKGSAAADRQTALMYMLA
FT                   RHLIARNFFLHPEYADEPVMPSKMRDYHLARFTEMKEAVKRLDYDEWHRAESAPQVNAQ
FT                   AVRDAREGRKHGVQLGFISQRPRDFSDDLMGQSTGRWVLKKGDGKDAEQLISRWELTTA
FT                   SAWIVRNALPGPGRNGAPFFLQLNAAEGMYEVQLINVLGPIELWSFSSTPGDTALRSRL
FT                   FNAIGSQMALRYLAVVFPDGSAIGEITRRRHARINETGLSAEEAELGVIDDLAKEILEG
FT                   RGIAVGVHDRVRSMDHDNDIPIAAE"
FT   CDS             102289..102552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42820"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01069"
FT                   /db_xref="GOA:C7JBI0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI0"
FT                   /protein_id="BAI01069.1"
FT                   /translation="MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             102549..103376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42830"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01070"
FT                   /db_xref="GOA:C7JIZ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ3"
FT                   /protein_id="BAI01070.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYREQELNLRIKPRRRL
FT                   VREKPEKLSVPALPNRVWSMDFMADRLMDGRAFRLLNILDDFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNNDRPNMGNSGLTPAQKLKTAA"
FT   CDS             103418..103954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01071"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ4"
FT                   /protein_id="BAI01071.1"
FT                   /translation="MALCLGLLATPAFAQQTEQGSVGCAELTQAAANAINQRVQANDAY
FT                   EKQPDSIGPLSCLDGFLHGQGLNVITSGLDPMSLIQNLESQLGSQICQAAQSAWGNAMG
FT                   GTQCSLSLSGINLGLGFGNVGSGTMCPSLNFGGGGPPLASGGFGTTGGSGGLYVESNPL
FT                   LPSGYSADSAMDGVF"
FT   CDS             103954..105141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01072"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ5"
FT                   /protein_id="BAI01072.1"
FT                   /translation="MSKQNRRITHTALLAAGVCLLTVSIQPQRAYGFMGEAAVVGAIHA
FT                   LQSFMGKQMDKVGENITNSLNDMTNPNSVSSMIRDAATQEANYAKGQVAAQSRIADAQN
FT                   TAMAAFLRRQQETGIRDEHMMSPEFCGGLDSQQTTMAAARASRSALGAITTIVEPRGEA
FT                   AKGTPSYYGRAQGVDANTNFHLRRYCSQEDVDAGLCSAVSRLPNADQRASTLFIADTLS
FT                   GDGAVDAANDYSTTLIQPVAPAAIRGEQASSTMGREQMLQRRAYNARMSLARFVMAFIT
FT                   SLETPSVSLTTEQKREMQAEGLQPLDRASWLQAMSLEVNRRVSSVSWNAALQAMPTASI
FT                   LREIATELAQSNYLAMQNYRLGLYQASIGATGIAQNEEARLQHASNKMPSPTINP"
FT   CDS             105156..105308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01073"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ6"
FT                   /protein_id="BAI01073.1"
FT                   /translation="MSETLTQIADLANVMDYLDRTKDVVREHAPDVVQRFERLKERVST
FT                   RISHT"
FT   CDS             complement(105474..106859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42870"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01074"
FT                   /db_xref="GOA:C7JC93"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC93"
FT                   /protein_id="BAI01074.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(106917..107225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42880"
FT                   /product="oxidoreductase"
FT                   /note="Probably pseudogene, Middle domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01075"
FT                   /db_xref="GOA:C7JIZ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ8"
FT                   /protein_id="BAI01075.1"
FT                   /translation="MPIRPMAEVNTDEWDQMIDVNLKGTLYGIAAALPGFLEQGSGHII
FT                   NLSSVAGIKVFAPGGTVYSGTKFAVSAISEGLRHEVGEKVRVTSIDAEISQKGCTSG"
FT   CDS             107281..107604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42890"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01076"
FT                   /db_xref="GOA:C7JIZ9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIZ9"
FT                   /protein_id="BAI01076.1"
FT                   /translation="MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMLIAPKLDIHP
FT                   DTLSKWTRLHERANAPAVSDLPDREKIRQLERENRELRQANEILRKASAYFAEGELDRI
FT                   FKP"
FT   CDS             107601..108023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42900"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ00"
FT                   /protein_id="BAI01077.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNDNFCVYGARKVWHQLKREGLDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVST"
FT   CDS             108039..108491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42910"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01078"
FT                   /db_xref="GOA:C7JJ01"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ01"
FT                   /protein_id="BAI01078.1"
FT                   /translation="MAFIIDVFARVIVGWRVSSTAHTDFVLDALEQALCQRRPEGKVTH
FT                   HSDRGCQYVSIRYTQRLAEAGLVASVGSVGDSYDNALAETINGLYKTELIYRQGPWKNR
FT                   EAVELATLKWVDWFNNRRLLSSIGNIPPAEAEARFYAQQKSHALAA"
FT   CDS             108634..110535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42920"
FT                   /product="outer membrane protein"
FT                   /note="Adhesin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01079"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ02"
FT                   /protein_id="BAI01079.1"
FT                   /translation="MADDVTTISSNTSWLNYNGGGTQDSHTPPDNATSGLGTGPTLNVT
FT                   NGALLEISGYLNLNAATLNITDGATVSVVPNGLLGGDLTNAAGGTVNIDGGTLTLSNEF
FT                   NGNQSVYNITNGTLSVGNDFNGNQAVYNIYKGGVLDAGTNYSNINAGRYNIEGGTVIFS
FT                   GIANIDAGNKIDFHNIPGGQLVIGSTSLSDLSGDSLNVENFVYGDQIKIASSTSYSDDT
FT                   LSTAISGDDLLIQSTVDGKTTTVVTIKGYATSSAANVEPAPTVTYSDGYILFGEQSDTG
FT                   ACFLAGSMVRTPQGSVAVENIQAGTDIFVYDWKSNTETTQQVTWAGQAFTVVNSSLPDD
FT                   EAGYPVRILKDALADGTPYKDMLVTAEHCLFFNGRFVPARMLVNGASIFYDKSITSYPY
FT                   YHVETAEHAVISVDGVLTESYLDTGNRRSFRQNSKVVQLHSKTRTWEEDAAAPLGVDVD
FT                   FVKPLFDNFKNRARHVAGSQTPAAPGTLTTDPNLHLVTQTGAVIRPVRCANQHYSFMLP
FT                   SGTRSVQIVSRASRPADVIGPFVDDRRQLGVAVADIQLVTARQHATPITAHLQPNKPAG
FT                   WHNTGWAECAWTNGNATLPLDAQTEHNDIAMLSITLQATGSYPLAAEVQENVQRHSA"
FT   CDS             complement(110980..112185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42930"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01080"
FT                   /db_xref="GOA:C7JJ03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ03"
FT                   /protein_id="BAI01080.1"
FT                   /translation="MIQDMMSGGASVEETLALWASGLRSAKERMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFATYVSTRGHAFVDRALYLPK
FT                   DWTSKPERLKQAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATNPLIAGEARDIASDLSEQDWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTHRR
FT                   TR"
FT   CDS             complement(112634..114073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42940"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01081"
FT                   /db_xref="GOA:C7JCB2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JCB2"
FT                   /protein_id="BAI01081.1"
FT                   /translation="MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
FT                   RMSSDGGVILVKQADDILGLSCRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDL
FT                   NDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALA
FT                   TLFVTLFLDQHEHAPARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLL
FT                   SATLRTADRDPGKEALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDF
FT                   LFGLAGNTRLYDRIASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWR
FT                   HGNRYHRFIVTTLPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQ
FT                   LRLWFSAAAYVLLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDM
FT                   FPCQHEFALAHARLRRLRQAI"
FT   CDS             114326..115231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01082"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ05"
FT                   /protein_id="BAI01082.1"
FT                   /translation="MKPDGRVFLKSVFGQISDEWPCISFSRSSVGNMLRQEFVPGRDIL
FT                   IYVGTLNGNLTEDPEHRGRLIAAVVIEPSQVLETRRIISKNFWSNLGEQWPHAMAVLKA
FT                   AVMEGPPYPKAHDVIPNAYRQFALMENRGGIAEAIGEERAAVMALPITPLDLHLSPEVQ
FT                   AYINVRASVSETPKSIREEATRMADLIINRVRNGGTQRIVTNANRTAPNISDLYPMLTR
FT                   KWQVDQCGLCALCGGLLLPGTRNKMLQPSADRIDSSNEAYDEENVHITHLACNLAKNKY
FT                   GTDDFEEWLIALRGNDPRNE"
FT   CDS             115474..116307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01083"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ06"
FT                   /protein_id="BAI01083.1"
FT                   /translation="MNCNLSDKSICERSFQKNNARWYYPTHPNHSWFEGFSRNFLSPDV
FT                   RIWADYNDSVTEWYGWESRHLNDVKAPQDFVDRSAALKAVFDGAMFLYLGKIYQPIIFG
FT                   AAEAHAVADQPFIRHLPESADVRVDPFSQIEINKTVVSTEYPFDNPVSTMLFAARYDYV
FT                   VRDILKYIGVQNLTYVTLYALHDWMTMKECGWTTNELASHAGWTKAELKDFTQTANNPA
FT                   YLGPFCRHGGVDTPPKRPMPLDKAIDPILTATTAFIEKRIQSIDLQDKWDTLIAP"
FT   CDS             complement(116427..116702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="APA01_42970"
FT                   /product="pilus retraction motor protein PilT"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01084"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ07"
FT                   /protein_id="BAI01084.1"
FT                   /translation="MSIVSLWEIAIKIRIGKLDADMNDILAAIPAEGFSLLQIQPEHLQ
FT                   ILMSLPLHHRDPFDHLLMAQAQAEHATFLSEDGQMDHYPIKRIRCS"
FT   CDS             complement(116742..117569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42980"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01085"
FT                   /db_xref="GOA:C7JFG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JFG7"
FT                   /protein_id="BAI01085.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLMDGRAFRLLNILDDFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(117566..117829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_42990"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_42990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01086"
FT                   /db_xref="GOA:C7JBI0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI0"
FT                   /protein_id="BAI01086.1"
FT                   /translation="MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             complement(117895..118011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="APA01_43000"
FT                   /product="pilus retraction motor protein PilT"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01087"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ10"
FT                   /protein_id="BAI01087.1"
FT                   /translation="MKVLLDTHALLWWLSGSDRLGETAREIIADPVHDILVR"
FT   CDS             complement(118008..118346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01088"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ11"
FT                   /protein_id="BAI01088.1"
FT                   /translation="MPQEFSTSSLCVHVMMTHGEETMSQHLSDNAPLPQKIGVREFRGN
FT                   LTAYLRQVRQGSTILVTSHDQVVAELRPPAPSYRPRRQPGALRGRIRMSEDFDETPPDL
FT                   LESMERDL"
FT   CDS             complement(118354..118992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43020"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01089"
FT                   /db_xref="GOA:C7JJ12"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ12"
FT                   /protein_id="BAI01089.1"
FT                   /translation="MEKKTRFPSPTLKASVPWNAGKMVGAKRALKEKHVWAIRFWLGSE
FT                   QRVRDRALFDLALDSKLRGCDLVSLRIGDIVTSGQVRHRAMVVQQKTRRPVQFEITETT
FT                   RESVRAWLEHRGGGLNEYVFPSRLSAKAHLSTRQYARLLDQWVQAVGLIAGEYGTHSLR
FT                   RTKVAMIYKRTGNIRAVQILLGHSKLDSTVRYLGVDVEDALALSEATDL"
FT   CDS             complement(119604..122738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="APA01_43030"
FT                   /product="cobalt/zinc/cadmium resistance heavy metal efflux
FT                   pump protein CzcA"
FT                   /note="Resistance-nodulation-division (RND) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01090"
FT                   /db_xref="GOA:C7JJ13"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ13"
FT                   /protein_id="BAI01090.1"
FT                   /translation="MTGRSFSLQAAIIGFSIRFRGVVIATACLLFFYGLYGLRHASYDV
FT                   FPEFIPPRVTIQTEAAGFTPEQVETLVSRPMEIALSGLPGIQRVQSTSIQGLSVVNVLF
FT                   ATSTDIYRARQLVGEQMNVVAQQLPAGVHAPTMTPLTSSAGLVLVIGLTSEQQSLMQLR
FT                   TLTDWSLRPRLLALPGVAGVSVFGGERRSLQIQVHPDQLILHHIGLDDVLAAAQEATGI
FT                   QGAGFIDTPNQRVVLQSDGQALTPESLARTVIVRSDNGAVTLGSIATVTEAPIPAFGAA
FT                   SIEGKTGIVVNIWEQYGANTMAVTREIEAALTDFRPQLQGQGITLHADLFRPANFITTA
FT                   LGNATQALLLGGFLVVVVIFLFLFDLRTAAICCATIPLAILIALSLLETLGVTLNAMTL
FT                   GGLAIAIGEVVDDAVIGVENVTRRLRENRLLVQPASTARVVLDACVEVRSAVVYATFAV
FT                   IIVFLPVIALPGLSGRLFAPLATAYVLAVMASLAAAVTVVPALCAWLLATPGETRREPP
FT                   LAGWTARAYERLLARLMRHPRFVIGGMILTTLIGFAALPFLESDFIPDFKEGHLIIHMT
FT                   AAPGTSLEQSLKLGRQVTEKLRQLPEIRSVAQRVGRASLDEDTSGPHTSEFEVDLNQVD
FT                   GKASRQIDARVRKALDGFVGASFSVSSFLTMRVNETLSGSSSAVAINIIGDDLDVLDIQ
FT                   ANNIVRMLHQIHGATDVRIEAPPGVPELAIRLRPTDLERWGLRSADVLRSIHTAWQGET
FT                   VGQIYERSAAFNVMVRLDDASRNDVASVGFLPLHTVHGNYVPLRAVADIYETNGRYQVS
FT                   HLGAQRTQTVTANVTGRSAQSFVQDARTAIAKNIKLPLGTYVQFTSAAEAESQSRKELF
FT                   INSGLAAIAVMILLSIITQGWRNLALILVNLPFAFVGGILAIIVSGTTLTLGATVGFVT
FT                   LFGITLRNSVMMISHFETLVEREHLTWGVTTALRGARDRVVPVLMTSLVTALGLAPLAV
FT                   DMNAPGREIEGPMAAVILGGLMTSMILNLFVLPILAVKFGSFSENETGVPETLFK"
FT   CDS             complement(122738..123772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43040"
FT                   /product="multidrug efflux membrane pump"
FT                   /note="Resistance-nodulation-division (RND) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01091"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ14"
FT                   /protein_id="BAI01091.1"
FT                   /translation="MKARAFWLPLVGLSVFLVLNVADIAIADDDDPPVSVLGAEATVTV
FT                   SPEAVTKSGIASARPSIVPWRKLVPAYGYVLNATQLITLVSDYADMKARLESMQAQQTL
FT                   ARAKLDRDKGLYRDRQNISQEQFQETTARFQSNSAMVKAEQVRVNNALNIIRQQFGSVI
FT                   SDATEKNTIFITQLLQQQVVLVKVTLPPDTDLPTPPSQADVTDYGNTGGHGTMLHYLSP
FT                   VTMTDPAIQGRSFFYFASAESQLVAGMNVSVLLPTEEERPGIRIPASAIIWLQGKSWIY
FT                   RDNGHGKFTRLPLTTDVPDREGGYLIQDTPGQITHETQIVVGGTQLLLSEEFRAQLESG
FT                   GDDD"
FT   CDS             complement(123769..125211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodT"
FT                   /locus_tag="APA01_43050"
FT                   /product="secretion system type I outer membrane efflux
FT                   pump lipoprotein NodT"
FT                   /note="Resistance-nodulation-division (RND) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01092"
FT                   /db_xref="GOA:C7JJ15"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ15"
FT                   /protein_id="BAI01092.1"
FT                   /translation="MYKSYNTLEYIKQVRRRTRYNAAFILLIFPLLCGCTNSDHSNISP
FT                   ESDVQKFSSRQFTDAGLQEFITKVLGPNVSSQENAWGITRLTLATLYFHPDILVAKAEL
FT                   ETARAGIKTAGQLPNPSFTVLGGPSAHYVGYGASILIEFFGRRYHRIKEARYRAAVAQW
FT                   EVINTAWKLRSDTRSALLGVWAVSGRLKLVEETAAAKRELFTLEQARFDQGRASALEIS
FT                   QVRTEMIHAELSVSDLRREYAVRKAALAGAIGVPAEALDSIALDTKAFDVCPDLMEYRD
FT                   SQDMRYQAVMQRADLRELLASYDAARQALRVEVSRRYPDVTISPSYNWDFSNRFEVNPS
FT                   LQIPIFNQNEGPIAEAVGQEHEAAARLRRAENTVFKSISQATANYRGTTSILLQADELA
FT                   KTVRVRLNQMQHRLQSGAIDRPTMVMTHIEQIQAETALLEAEIQQRQAIGQIEDGMQQP
FT                   IFDHTSAAQVSGLLENNQRNSP"
FT   CDS             complement(125204..125854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43060"
FT                   /product="cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01093"
FT                   /db_xref="GOA:C7JJ16"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ16"
FT                   /protein_id="BAI01093.1"
FT                   /translation="MAGGCCGGCTDTPLPINKSWRRALLIALFLNASMFAVEAGAGVSV
FT                   GSASVQADAIDFLGDSANYAISLSVAGMALRWRAGAAFLKGLTLFMAGLWVMANAGWIV
FT                   MNSNHPPHPDAMGGIGLLALAVNLACALILWTHRKGDANRRSVWICSRNDAIGNVAVVL
FT                   AALGVFGTRSAWPDIAVAAILAMLGISGGVQIMRQSRVELTDNKSDISRHINV"
FT   CDS             125928..126326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR"
FT                   /locus_tag="APA01_43070"
FT                   /product="transcriptional regulator MerR"
FT                   /note="Heavy metal resistance"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01094"
FT                   /db_xref="GOA:C7JJ17"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ17"
FT                   /protein_id="BAI01094.1"
FT                   /translation="MRSIGALGKATNTKVETIRYYERIGLLAPPQRTDGNYRTYDDEAL
FT                   ARLSFIRRSRDLGFSLDQVRALLSLTDQGTQDCKTVDRIARDHMAEIERKIADLIALRH
FT                   ELSTMIESCGGGNISECRIIEALSPFDN"
FT   CDS             complement(126648..127097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01095"
FT                   /db_xref="GOA:C7JIA8"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA8"
FT                   /protein_id="BAI01095.1"
FT                   /translation="MIKNIPGFEKISSIFDLFEEIAMLVLTLCIMVVAALGLIHVLYAV
FT                   FEMLRTATLSPTNPVVLQSLFGLFFTVLIALEFKHSILVSPDTPSHSMVRMRSVLLIGM
FT                   MATVRKFIVLDLSGLDVMEVLALSAAILALGIVYWLVRGNNKITS"
FT   CDS             complement(127134..128456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01096"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA9"
FT                   /protein_id="BAI01096.1"
FT                   /translation="MSDPFYAAFLSGESTTMMTRVYLDKSAFLKWTPRSGNVGFFLTAA
FT                   ITMVLLDMNDAIAKPATEWLDDITLAGQIEGGINANVSRPANGINFGQFFGDRANQAQL
FT                   DQLTLTAARAVDTTASSYDVGFMVRGLYGADGRYFNIAGITDRLMTSRYQFIVPQAHLD
FT                   VHLPWLTRHGLDMQAGILASPMGVESLDPSLRPFYTLSYTTEYSTPFEHVGAMFQWHLT
FT                   DHIDALFGVDTGNQVSFGGGDNNHTAAGYFGLTASSLANGKLSLTYLGRVGPENSTRSL
FT                   GQRANSAQRYWNDLSGSYKISDRLTFTGELNFLHDEGLHANTYSFVSYLSYQLTPTLLL
FT                   NYRGEIYRDDTGLFVTSFIANNAYMQATLGKPTVTQSAPPTTYGALTLGATWRPVLGHS
FT                   VKLFEIRPEVRFDRSLNGTRPFNDLRNVGQFTFGADAVLGF"
FT   CDS             128824..130530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="APA01_43100"
FT                   /product="potassium transporter ATPase A chain KdpA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01097"
FT                   /db_xref="GOA:C7JIB0"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB0"
FT                   /protein_id="BAI01097.1"
FT                   /translation="MSFYGWVAIMAFLICVIAMTRPLGGFLKRVLEGEQHVLGRIFGPV
FT                   ERGIYRIAGIHKDREQSWSQYAIAVIVFKVICFIAVYTLLRVQGVLPLNPNGMGGVAPD
FT                   LAYNTAISFLTNTNWQSYGGETTMSHLTQMLGLTVQNFVSAAAGIAIAAAVIRGFARRS
FT                   ATSIGNFWADLVRTTLYVLLPICVVLALFFVLEGVPQTLLGSVTVSTLEGARQTIAFGP
FT                   VASQEAIKMLGTNGGGFFNVNSAHPFENPNALTNFVQMLAIFALGAGLTNMFGRMVGRE
FT                   RQGWAIFSAMALLFLIGTGVAYWSEAHANPLITALGADPSAGNMEGKETRFGIIGSALF
FT                   ATVTTDASCGAVNSMHESFLPLGGMVPLLNIMLGEIIFGGVGSGLYGFLLFAIIAVFMA
FT                   GLMVGRTPEYLGKKIEAREIKMTMLAVLCLPLVMLGFTALAVVVSPGLSALSASGPHGF
FT                   TEALYAYTSAAGNNGSAFGGLTANTFWNVTLGIGMMAGRFFVIIPVLAIAGAMAAKKTA
FT                   TPTPGTFPTDTGLFIALVTGVILIVGGLTFLPALALGPIVEHLAMLGGTLF"
FT   CDS             130545..132653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="APA01_43110"
FT                   /product="potassium transporter ATPase B chain KdpB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01098"
FT                   /db_xref="GOA:C7JIB1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB1"
FT                   /protein_id="BAI01098.1"
FT                   /translation="MALHLPHSEAPHGGRHSEHRSQSSLMQASLLLPAIRESFRKLDPR
FT                   IMWRNPVMFVVEVVTILTTVLLIRDIVAGGTHLGFAIQINLWLWFTLLFANFAEAVAEG
FT                   RGKAQADSLRRTRTETLGKRLLMNDEGGYSHLGLYEEVPAPELVVGDVVLVQAGDFIPS
FT                   DGEVVDGIASVDESAITGESAPVIRESGGDRSAVTGGTRVLSDWVIVRITAAQGSTFLD
FT                   RMISLVEGAQRQKTPNEIALTILLAGMTLIFIFAVATIPSFVHYAGGHISVLILVALFV
FT                   TLIPTTIGALLSAIGIAGMDRLIRFNVLAMSGRAVEAAGDVDTLLLDKTGTITIGDRQA
FT                   TAFVPVSGVTEHELADAAQLASLADETPEGRSIVVLAKEKFGIRGRDMRDLGAHFVPFT
FT                   AQTRISGVDVGDRQIRKGAVDSVIASLGETLPSVEQIRQIADDIARQGGTPLAVADNTR
FT                   LLGVVHLKDVVKGGIRERFAELRRMGIRTVMITGDNPMTAAAIAAESGVDDFLAQATPE
FT                   AKLALIRSEQASGKLVAMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDPT
FT                   KLIEIVGIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFVGFYPALSALNIMHLATPES
FT                   AVLSAIIFNALIIIALIPLALKGVRYRPVGAASLLRRNLLVYGIGGLIVPFIGIKLIDM
FT                   LVTSIGLA"
FT   CDS             132664..133287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="APA01_43120"
FT                   /product="potassium transporter ATPase C chain KdpC"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01099"
FT                   /db_xref="GOA:C7JIB2"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB2"
FT                   /protein_id="BAI01099.1"
FT                   /translation="MTLIRQLRPALVIFGFLSVLTGLLYPLGITAISHLLLPEKAGGSL
FT                   VHENAQTVGSALIGQNFTQPRYFHGRPSATTGADPNDPTKTVPTPYNAAASMGSNASPT
FT                   SRALIERVRIAVAQLKTENPDAIAAGWSIPMDLVTTSASGLDPDISPQAALFQVKRVAH
FT                   ARNLPEQTVRQLVEHMIAHPLMGWLGEPHVNVLELNMALDALHR"
FT   CDS             133287..135974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="APA01_43130"
FT                   /product="two component sensor histidine kinase KdpD"
FT                   /note="Osmosensitive K+ channel"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01100"
FT                   /db_xref="GOA:C7JIB3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB3"
FT                   /protein_id="BAI01100.1"
FT                   /translation="MEAHLIRPDPDALLRQTVLDGESRKRGRLKVFLGAAPGVGKTFEM
FT                   LTVAHQLQRDGVDVVIGVVETHGRAETAALVNGLELVPLRTMTYRDRMAQEMDLDAVLR
FT                   RAPCVAAVDELAHTNVPGSRHPKRWMDVEELLAAGIDVLTTVNIQHLESLNDIVASITR
FT                   IRVRETVPDHVIGDADEVELIDLTPNDLLQRMRDGKIYAEHTAGRAMLHYFSPGNLTAL
FT                   RELALRQTAQQVDAQLVDHMKANAIVGPWAAGERIMVCLTLQDGDASLLRYGKRLADHL
FT                   HAPWIVLHVETNRDLSDAARATMASQMHLAQSLGAELVTIPGQDVALDAVAYARTQNVT
FT                   QIVAAHPVGRGWSARVRQWLGRSTTERLIQFAQGFPVHVVPRSPGENAPTEQLLNIAPF
FT                   TARPYVVGTLIVLGALVVALLLRQSFEVSNVSLAFLTAILGVAVAYGLWPSLWASLMAM
FT                   LCFNFFFLPPFYTLTIAAPDNVVALFFFLVTALIASNLGARVRNQAVVARHRADITQSL
FT                   YHFSRTITGILQLEDLLWSASHQIATMLDCDVAMLLPDGEILKVKASYNGGKAVGAADL
FT                   AAATWAWKNNKVAGRGSDNLPGGRWLFIPLRTGRGPVAVIGLHAERTGPILDLEQQGLL
FT                   DALADQTASAIESILLAGELDQARLDVETDKLRGALLTSISHDLRTPLASILGATSSLE
FT                   SYGEELDENARKELLSTIHDEADRLNRFVANLLDMTRLEAGALQPRKERVDIGEVIASA
FT                   LCRAARLLSDHETEMVIEPDLPMLLLDDVLLEQALFNILDNAGKYTPVGTKIVVTASVA
FT                   ADTLLIRVTDEGEGFAAHDPETAFSKFKRFKSADRSRPGTGLGLAISRGFIEALGGKIV
FT                   SRNRKDCSGAELVMTFPLDEKNTK"
FT   CDS             135971..136654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="APA01_43140"
FT                   /product="two component response regulator KdpE"
FT                   /note="Winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01101"
FT                   /db_xref="GOA:C7JIB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB4"
FT                   /protein_id="BAI01101.1"
FT                   /translation="MSNPSVLVVDDEPAIRRLLRTALGSQAWRVIEARTGEMALNMAME
FT                   VVPDIVVLDLGLPDMDGVDVLRRLRSAHPTLPVVILSVRDDERGKVAALEAGADDYVTK
FT                   PFSMAELVARMRNAVRHALQQEGTIPLFVSGDLSIDLVRRQISRGESEIRLSPREWDIL
FT                   RMLVRYAGRVLTHQTIMSQLWGATGDVQQLRVYIRQIRQKIEIDPERPRHIITETGVGY
FT                   RMVQL"
FT   CDS             136958..137527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="APA01_43150"
FT                   /product="transcriptional regulator TetR"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01102"
FT                   /db_xref="GOA:C7JJ25"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ25"
FT                   /protein_id="BAI01102.1"
FT                   /translation="MARPLSEEKRAAILRAATELVATIGISAATSQIAKRAGIADGTLF
FT                   TYFPTKDDLLNQLYLSIKSALAEAIMADYPSRAGVFERTRHCWDRLVNWGAEHPAQHKA
FT                   MRQLSVSDRISENTRDAVNLAFQDINRMIRDNLNRGAAGDESAAFVGALIIAMSDVTLD
FT                   CIAAHPEKIDLYRESGFQVFWNGIRS"
FT   CDS             137579..138406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43160"
FT                   /product="oxidoreductase"
FT                   /note="Short-chain dehydrogenase/reductase (SDR)"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01103"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ26"
FT                   /protein_id="BAI01103.1"
FT                   /translation="MSKIWFVTGSSRGLGRDIVEAALAAGDSVVATARKPADLDAVVAQ
FT                   YGDRVFPLALDVTDARAAQAAALRAKEHFGRIDVVVNNAGYANIASVEDITIEDFTQQV
FT                   QTNFFGVAYVSKAVLPILREQGHGHIFQIASIGARIATPGLSAYQAAKFAVRGFSLALA
FT                   QEMAPLGVKVTTIEPGGIRTDWAGSSMKIPPISAPYEQTVGTFVKMIRESSGHQSSDPA
FT                   KIASLIVDLANRADAPTELLVGVDAVEYAKQAAEAVTENDRKWRSLSITTAAD"
FT   CDS             138413..139216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43170"
FT                   /product="protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01104"
FT                   /db_xref="GOA:C7JJ27"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ27"
FT                   /protein_id="BAI01104.1"
FT                   /translation="MTGQQMKRAHILVYTSSATKIPLVGGGTHDVGIFLGELVEPIEPL
FT                   IRAGHLVEFVSPDGKGCVIDPASYRITNWGLSRSRMEHARNFFETTLQELGVGNPVKLS
FT                   DILADKTRLNSYDVVFIPGGHAPMTDVLHKDWLVSDEYNDQTGELLLHFHKNNKITSAI
FT                   CHGSAALGAAPQVNGKWIYADYNMTCVSMAAEWLTEDIPFFNIGGHMPDYPVRILKRLG
FT                   GKVHTKMLGRSNVVEDRELITGQDPYSAKELGEKLMKKIEVRQNF"
FT   CDS             complement(139994..142552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43180"
FT                   /product="type I/III endonuclease restriction R subunit"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01105"
FT                   /db_xref="GOA:C7JJ28"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ28"
FT                   /protein_id="BAI01105.1"
FT                   /translation="MDMVLFLNGLPIVTLELKNAWTHQTARYHGQKQYRERDANQTLLR
FT                   FGRVLVHMTADTDEVWMATKLAGASTFFLPFNKGHNEGAGNPPNPNGHKTSYLWEEVLQ
FT                   PQSLAGIIQHFVLLEGKKTDPLTKKTLIFPRYHQLNVVRKLLSHAAQTGVGHKYLIQHS
FT                   AGSGKSNSITWAAYQLIETYPAKLDLPGVRALDAPLFDSVIVVTDRRLLDKQLRDNIKD
FT                   FSEVKNIVAPALKSSDLKAALENGKKIIITTIQKFPFIIDGIEDLGDKRFAVIIDEAHS
FT                   GQSGIASDKMNQAMGGDPDEDDAQDKILAAMQARKMRGNASYFAFTATPKPITLEKFGE
FT                   QQSDGRFRPFHLYSMKQAIEEGFILDVLANYTTYKGYYEIQKSIEDNPLFDTSKAQKKL
FT                   RAYVERSQQTINTKAEIMVENFIDKVVNPKKLRGKGKGMIVTQNIEVAIRYYKAVQAEL
FT                   AKRGNPFKALIAFSGEKEVDGVKYTETEMNGVPEDKTRSEFDKDEFRLLIVANKYLTGF
FT                   DQPKLCAMYVDKKLQSVLAVQALSRLNRSSPKLGKRTEDLFVLDFFNSIEDIKAAFDPF
FT                   FTVTTLSEATDVNVLHELKAALDDVGVYEWSEVEEFCKRFFDGEDSEKLSPLIDVAAER
FT                   FNTGLELEDPEKIDFKIKAKQFVKIYGQMAAIMPFEVEAWEKLFWFLKFLVPKLNIKDP
FT                   NQDALDDLLKAVDLSSYGLERTKLNQTIGLDTSEAELDPQNPTPRGYREGEVQEDPLEE
FT                   IIRSFNERWFQGWSATPEEQRIKFLNIVESVQAHPDFEKKFDENSDPYSRNLAFEKIMK
FT                   EVMLKRRKEELELYKLHNQDEAFRSALYLSVKEALTQSLR"
FT   CDS             complement(142586..143047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43190"
FT                   /product="type I endonuclease restriction R subunit"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01106"
FT                   /db_xref="GOA:C7JJ29"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ29"
FT                   /protein_id="BAI01106.1"
FT                   /translation="MCRGRNSFESNAMNVAVSNTKEIALEQAVERRLCGASSEELAAGA
FT                   IASGPFRIGQPADFDATLALDRAKFWEFLETTQSKDLDKLKQHNPADWQAKITGQLDKL
FT                   IKSKGLLHVLKKGLPVDNAHFHLMYPAPLASSAQKVHDNFAANIWSVTR"
FT   CDS             complement(143063..144325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43200"
FT                   /product="type I DNA specificity S subunit"
FT                   /note="Restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01107"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ30"
FT                   /protein_id="BAI01107.1"
FT                   /translation="MTIAAYSKYDAYRDSGVQWVGQFPANWELARLGGLFEERRHKVSD
FT                   TDFEPLSVTKNGIFPQLANAAKTNDGENRKLVRAGDFVINSRSDRKGSSGISPLDGSVS
FT                   LINIVLEPKRILPEFCHHLLKSYAFVEEYYRVGRGIVADLWTTRYDEMRTILIALPSPD
FT                   EQRTIAAFLDGKCALIDEAVRIKEKQIRLLVERRQILIQQAVTRGLNPDAPMKDSGIDW
FT                   IGQIPAHWEVKRNKHMFVEINERSAKGEEQHLSMSQKLGLVPADLVEKSLASESYQGAK
FT                   LVRTGDLVLNRLKAHLAVFSLAPMEGLVSPDYSVFRPLVQGASSDYFEILFKTSKYLGE
FT                   FRLRVRGIVEGFYRLYTDDFMDCPLLLPPLDEQLQIVEHVRATTAQFHNVIAIKESQIT
FT                   ALREYKTSLINAAVTGKIKVL"
FT   CDS             complement(144322..146715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="APA01_43210"
FT                   /product="type I DNA methyltransferase M subunit HsdM"
FT                   /note="Restriction-modification system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01108"
FT                   /db_xref="GOA:C7JJ31"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ31"
FT                   /protein_id="BAI01108.1"
FT                   /translation="MNQTSHSSLVSFIWRIADDCLRDVYVRGKYRDVILPMVVLRRLDT
FT                   LLEPTKDAVLEEVRYQKEDIGVTELDDEPLKDASGYVFFNTSHWTLKKLYNTATNNQQI
FT                   LLANIEDYLDGFSDNVKEIIGRFNLFEQMRHMAEKQVLLDVIEKFVSPWVNLTPNDIED
FT                   PEGNTLPGLSNLGMGYVFEELIRKFNEENNEEAGEHFTPREVIHLMTHLVFDPIKDRLP
FT                   QILTIYDPACGSGGMLTEAQNYITDADGPFHAHGDVYLYGKEINDETYAICKSDMMIKG
FT                   NNPENIRIGSTLSTDEFSAHRFDFMLSNPPYGKSWNSEVKYIKDGKGVIDPRFQVKLAD
FT                   YWGNVETMDATPRSSDGQLLFLMEMISKMKPTSASPLGSRIASVHNGSSLFTGDAGSGE
FT                   SNIRRFIIENDMLDTIIQLPNNLFYNTGITTYIWLLSNAKPEARRGRVQLIDANLMFRK
FT                   LRKNLGDKNCEFSDEHIQQITEAFLNFAPVERQIDAAGDPEGIAVQVFDNADFGYHKVT
FT                   IERPDRRRAAFSAERLAPLRFDKSLREPMEWLYDEHGDQVYQPGFLKEQAKQITAWCEE
FT                   AGLTLNAKAKAKLLDTRYWVKLRDLLATATQIMGDVGLEETDDFNAFRKVVNAAIKARK
FT                   IKLGVTEKNAILNAVSWYDETAQKVIAKKHKLTGAEVEELTTHLGCAAEDLADFGWYRQ
FT                   KDGSYLTYESTAELRDAESVALKDNIHRYFLAEVKPHVEEAWINLDSVKIGYEISFNKY
FT                   FYRHKPLRSLEEVTQDILALEEKADGLIADILGVEVATKLETAE"
FT   CDS             147120..147539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01109"
FT                   /db_xref="GOA:C7JJ32"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ32"
FT                   /protein_id="BAI01109.1"
FT                   /translation="MSRIWPCQRVIMSRNAKCLSQLDSLEQKSGSQRISAYVRRGLMRY
FT                   QEAADYLGIAKGTLANWVSQRIGPRSIKIGSMRLFRQEDLDVFIEEKLFETERFEKRRR
FT                   RQRGRGALVLTCQHPDLFLFSVLVLALAVFIFTVP"
FT   CDS             complement(147588..148679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43230"
FT                   /product="phage DNA recombinase"
FT                   /note="DNA integration/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01110"
FT                   /db_xref="GOA:C7JJ33"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ33"
FT                   /protein_id="BAI01110.1"
FT                   /translation="MTKSPKETLKDPVTGKPLPKGVWYRGPGQYQARRMVNGKRHRETF
FT                   ASASLARRWLQDVRAKAHVGQLEPPARKRNQITFGELFERFGRERMTERDADRMGHLPA
FT                   LLGSDIASLKIDKWTNSDVRNFRDAMLAAGLAKGTVVKRLNMIAAIVEYANSEWDTTIL
FT                   NHASAKRTKRPEGADRKRNRRLKDGEEAELLRAASRPDGVFRHYPDVVWLIRWSIEQGC
FT                   RLGESLSLRWQDIDFRRQTISLARVKSDRHREELGPEIRPMTKGAQRVLMEKRATMEKV
FT                   PDRKDVVFSVGERKIFSVLFGRMTRQAGIQDLTFHDLRHEATSRLARYLNPIELTRVTG
FT                   HRDLKSLNRYYQPVPGDIADKTR"
FT   CDS             149045..149545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01111"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ34"
FT                   /protein_id="BAI01111.1"
FT                   /translation="MRVEIRARLKGRIRYNVTTDQIEVMVGEDDELLRWETIDRRTMSQ
FT                   HLPPTVIDRLWDMICDAAGSGVYADDRLAGVQFLGLHRIVDHLEREGLRIEAVPVPSLS
FT                   PPALVAVTLAAFLAARERTTLAEIMQNVIDVPPEKELLVMLKNAGWESRRTATGRFWVK
FT                   TRG"
FT   CDS             149668..151101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01112"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ35"
FT                   /protein_id="BAI01112.1"
FT                   /translation="MTQNPSEKPKSRASAKVGTTVTKDNLKALGADRLADLLIELAGQD
FT                   TALTRRLRMALTAVHAKDKLGKEIEKRLRTIQRSRGFLPWDRIRPLAAELDTLRQSILG
FT                   DVASADVGQAISAMRLLVEIAPSVYERSDDSSGYLSDVFREAASDLGVLWGRQANRDPA
FT                   IVVTDLLTLLDDDGYGTCDRLLAACGTALGETGAAMLRTMLLARLRDLPASKGNSDYHT
FT                   DIARMQVIRHLRDLADAMGDVDAYSEAVSLSDRQYAYTGDVARRLLDKGRAREALDWLD
FT                   RETEENSRFYKENDDLRIEAYEAVGDRDKAQALRWNVFRERLSLPHWKAYQRHLSDYDA
FT                   IDAEEQALDHIRNFPNRSVVLSTLLEWPALDEAARLVRHHTAELDGRDYGTLRPAAERL
FT                   SEAYPNEATLLYRLLVEAVLDRALSRYYAYAAKDLASCQRLAPMLTMAEGMESHETFMT
FT                   RLKASHKRKLGFWSLIAVP"
FT   CDS             151207..151431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43260"
FT                   /product="plasmid maintenance protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01113"
FT                   /db_xref="GOA:C7JJ36"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ36"
FT                   /protein_id="BAI01113.1"
FT                   /translation="MLTRTTLFLSNRSQAVRLPKAVAFDVNLKDVVIIPDGARRIIAPA
FT                   NAAWDDFFAAPGTPLPERDQPRMQERESF"
FT   CDS             151431..151769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrR"
FT                   /locus_tag="APA01_43270"
FT                   /product="transcriptional regulator NtrR/PilT"
FT                   /note="Nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01114"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ37"
FT                   /protein_id="BAI01114.1"
FT                   /translation="MLRYLLDTNFCIRVLRDRPQGLRERFNDNAEALCISDVVLYELLY
FT                   GAEKSHDPAKIRREVEHFAARLSVLPFDDDAAAHTAEIRAELEKRGCVIGPYDLMIAGH
FT                   ARSRGLVC"
FT   CDS             151877..153400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43280"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01115"
FT                   /db_xref="GOA:C7JJ38"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ38"
FT                   /protein_id="BAI01115.1"
FT                   /translation="MELLSVIRRWHCRDHLPIREIERRTGLSRNTIRKYLRAQSIEPRF
FT                   QVPERPSRLDPFADRLRGWLVLEAARPRKNRRTARRLHEDLVALGYDGSYGRVAAFIRQ
FT                   WKHEQHQARQTTGRGVFVPLCFQPGEAFQFDWGEDWAVIAGRRVKLQVAHTKLSFSRAF
FT                   ILRAYPLQTHEMLFDALTEAFRVLGGVPRRGIFDNMKTAVDRIGSGKARQVNLRFMALA
FT                   SHYLFETTFCNPAAGWEKGQIEKTVQDARRQIWQDLPAFPDLGALNAWLEARCLDCWER
FT                   LQHIELARSIAEVHASERPHLMVPGRPFDGFVEQTKRVSPTCLIQFDGNRYSVPASFAN
FT                   RPVSLRVYPDRLRIIAEGQVLCVHDRIITRSHGVPGRTVYDWRHYLAVIQRKPGALRNG
FT                   APFTELPAAFRTLQDQLLRRPGGDREMAEILALVLQHDEQAVLCAVELALEDGVATKTH
FT                   VLNTLHRLIDAKRTVVPRLDAPQALVLEHEPCADTGRYDILRRDSRHAS"
FT   CDS             153397..154170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43290"
FT                   /product="transposase"
FT                   /note="IstB-like ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01116"
FT                   /db_xref="GOA:C7JIX4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIX4"
FT                   /protein_id="BAI01116.1"
FT                   /translation="MILRLLHLWSCSVDCGCMACPRPRPTSSSRGAPAFEAAIPILSQL
FT                   LKAELAEREVRSIAYQTKTARFPAYKDLSGFSFADTQVNEPMIRQLHSGDFIERAENVV
FT                   LIGGPGTGKTHLATALAIQAITHHRKKARFWSTVDLVNALEQEKTANRAGQIADRLLRL
FT                   DLVILDELGYLPFSASGGALLFHLLSRLYERTSVIITTNLSFSEWGDVFGDPKMTTTLL
FT                   DRLTHHCHILETGNDSYRFRASTAASKNRKDRSSS"
FT   CDS             154544..154744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01117"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ40"
FT                   /protein_id="BAI01117.1"
FT                   /translation="MTLPAQLLEEARSLDLNISQACEQGLKSAIASVRAQQWLAENRSS
FT                   LEASRQYVEKNGLPLADYRNF"
FT   CDS             154745..155050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdB"
FT                   /locus_tag="APA01_43310"
FT                   /product="CcdB-like toxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01118"
FT                   /db_xref="GOA:C7JJ41"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ41"
FT                   /protein_id="BAI01118.1"
FT                   /translation="MARFDVYCLAGRGEARFVLDVQADLLDELGTRIVVPLLSQKVAPR
FT                   PAKRLNPIFVVDDQSFVMMTQFMAAVPDRDLKKVVTSLSLYQDEIIQAIDLLLTGF"
FT   CDS             155089..155613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43320"
FT                   /product="phage integrase (truncated middle)"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01119"
FT                   /db_xref="GOA:C7JJ42"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ42"
FT                   /protein_id="BAI01119.1"
FT                   /translation="MFLLWGLPKADISYHNQLGKAANTRRAYRSAIRGWYVWAARHDLP
FT                   ALPARSEDVATYLADLALRERKPATIELHRAALRYLHHISHLPIPTTHALVSETLAGIH
FT                   RSPRKTPPRQVKGLTWEMICEVVDRIPMTSLVDARDRAILLLGYGGALRRSELAAIQLD
FT                   AEISQKGCTSG"
FT   CDS             155671..157056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43330"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01120"
FT                   /db_xref="GOA:C7JC03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC03"
FT                   /protein_id="BAI01120.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(157199..158272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43340"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01121"
FT                   /db_xref="GOA:C7JJ44"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ44"
FT                   /protein_id="BAI01121.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIDADFSHLRQFRVIL"
FT   CDS             complement(158371..159600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43350"
FT                   /product="sugar transporter"
FT                   /note="Major facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01122"
FT                   /db_xref="GOA:C7JJ45"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ45"
FT                   /protein_id="BAI01122.1"
FT                   /translation="MGHDVILSDVLLHRYLRLPLVAVSWILLVARVVDAFCDPAIGYVV
FT                   DRIGGLIVPRLIRSLAIPFGITGFLCFLALPLSPTGKVVCAGATYIVFGAIYSCINTPY
FT                   GALAVMMSRSASQRVGLNAFRMMGCQAGSLLVALLTIPAITWLGGGESAAQHRYGMAVY
FT                   VLALSVFGTFLWLCVARGCAVRYPPAPVRQDLVSTLRHLLGNRRWVLSNLLAFFYFVGQ
FT                   AALFGFALYYARIVLGGTEQLGANIITFVTVLLFAGVPACLPLARRMGTVGAGIICLIV
FT                   QGIAYLAMAVAGASITGFFLSIALLALAQGVMSPLYYTLLAEAVDDGDSRTSTGSAGLA
FT                   YSINTWVTKLAMGLTGFVLAQFLSQGHYVEGGTTQSSDLSFWITAGFVWLPLGAVCLQV
FT                   FCLLAWPDKK"
FT   CDS             160029..160403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43360"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01123"
FT                   /db_xref="GOA:C7JJ46"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ46"
FT                   /protein_id="BAI01123.1"
FT                   /translation="MSQKSLPETTSGERLIRDIRRATRRQYSAEEKIRIVLDGLRGESS
FT                   IAELCRREGIAESLYYSWSKEFLEAGKKRLAGDTARNATTSEVRHLRDEARALKEVVAE
FT                   QTLELRLLKKSMIGAGGDLA"
FT   CDS             160400..161380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43370"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01124"
FT                   /db_xref="GOA:C7JJ47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ47"
FT                   /protein_id="BAI01124.1"
FT                   /translation="MRYMASEKLEIIRLVEQSALPVRQVLGKIGIPRSTFHRWCDLYRT
FT                   GGPEALADKPSGPNRIWNRIADDIRAQIIDLALETPELSPREIAVRFTDEQGYFVSEAS
FT                   VYRLRKAHDLIASPKFIVIKAAESFHTKTTAPNQLWQTDFTYLKVIGWGWFYLSTILDD
FT                   FSRYIIAWKLCTTMAASDVTQTLELALQASGPHQATVRHRPRLLSDNGPCYVADELAKW
FT                   LNQNSMDHVRGAPNHPQTQGKIERWHQTLKNRVLLEHYYLPGDLESQIEAFVENYNQHR
FT                   YHESLNNLTPADVWFGRGQTILFERERIKRATIQKRRLLHQQRAA"
FT   CDS             complement(161411..161674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01125"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ48"
FT                   /protein_id="BAI01125.1"
FT                   /translation="MSKTLDVTRQTCGRYVVETCLRPDGAVFLRTPNIFPVNARNWHGP
FT                   YDTMDAAITDFLDRTAIPKITRKKLSSLLSVVERFGTMDGVK"
FT   CDS             complement(161778..162113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01126"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ49"
FT                   /protein_id="BAI01126.1"
FT                   /translation="MRSVLRHSGLLLTDGAHYLAANGAAWLIDVLASVQYLPAMRAEER
FT                   QFWTLQVDLEKHAAVVVCTDGDKTGEGEIELYRQEIPYTDFPLNEAKLFAFREPGMGRV
FT                   VLLPSEY"
FT   CDS             complement(162091..163203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="APA01_43400"
FT                   /product="chromosome partitioning nuclease protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01127"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ50"
FT                   /protein_id="BAI01127.1"
FT                   /translation="MTELRRVDPRTLVPNPNNPRKTQPDARAEHQLALNIKTVGLIHAP
FT                   CVRELEDGRLMIVAGHRRVRACIAAKLDEIDVHVRSGDEKSDTMAAVAENVVRADMTES
FT                   EQWRGVLDMREKGATDTEICRAFMVTPAYLRGLMLLSQIHPPIIAAIDGGIGPSYTERN
FT                   AIARTPLERQRDVWAEIWAESADEGVDPTDYEMSREEFAHFDWEDFVRYLDQVELYARD
FT                   FEFDDETAQEAGVVWEEDLFGQGGQDNRYCTQFAAIFKAQQIWAEKKKPEGCVFIPANE
FT                   YGEGIVPEGHRSVGSWEMEQADDISTIWVSSRTLAIKTGRMRKITQRTAQSCEEGSLSF
FT                   SSAQSAEKPKERADISGTGQKIIGEVRTQA"
FT   CDS             complement(163390..168516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf2"
FT                   /locus_tag="APA01_43410"
FT                   /product="DNA methylase/helicase SNF2"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01128"
FT                   /db_xref="GOA:C7JJ51"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ51"
FT                   /protein_id="BAI01128.1"
FT                   /translation="MSMSASQLNLFDTTVLSGELAALWSLDDDQPIPEVCIPSPHPFRI
FT                   PQRDFRLNGVRGLAQGWKARAEANIAAIALLATLEREDRNATAAEQDVLARFTGFGAGE
FT                   LANSLFPPTGREVRKGWESLASELEQLTTETERAGLQRATQYAHYTPELIVHSMWDMAL
FT                   RMGFRGGSVLEPGCGTGLFIAARPEKLEGKIAFTGIENDPISARIARKLYPNQWIRSED
FT                   FTRAQLPQGYDLAIGNPPFSNRTVHGRDGLEKLGLSLHDFFIARSIDALRPGGIALFVT
FT                   SRYTLDKTDPNARRIIGESADLLGAVRLPEGAMRDDAGTDVVVDVLAFRKREMGEEPSN
FT                   ESWVETADIPDSDEGNGPLVINRYFHDHPEQVLGSHIWTTTQFGPGYTCSATAGAELDL
FT                   LLPQALNRIAPNTHFLPPREARIVRPAGEGVTIGTAASGADLKEGSYFVDRSVLHQIIE
FT                   GQAQIVPIRKAGQTEGIFAKHARIIRALVPIRDAARSVLRAQMQNLPYGAQQRTLKTAY
FT                   QSFVREFGPINHTRTTLRENPETGKTRETQRRPNLQPFMDDPDVWLVASIEEYDERTDT
FT                   GRMGPIFSERVIHAPTEPEIHGAHDALAVSLHETGRVDLPLIAELLGRSEADTLAELGE
FT                   SVYLDPERSVQGRDVWVTADEMLSGAVRTKLALSRDATQLDPRFARNVSALEGVQPPDL
FT                   RPSEITARLGAPWLPVTDIQDFVQEVMGIETTVRHTPEVACWSINRAPFLSRAEATSVW
FT                   GTERRNAAELLEDALSQSIPKIWDHWRDENGNDRRELNTQETEAAKEKLAAIKSAFEKW
FT                   VWGDPERSDRLVKLYNETYNNLVPRAFDGSHLCLPGASSVITLRAHQKRVVWRIIASGR
FT                   TYMAHAVGAGKTFSMAAAIMEQKRLGLISKAVIVVPGHCLAQMAREFLMLYPTARIIVA
FT                   DETNFVKAKRQRFIARAATENWDAIIITHDAFKFIPVEAGFEREMIEDQIASYEAILSG
FT                   LDGDDRISRKRIERMKEGMESKLEGLAAQKDDLLHMGEMGIDQILVDEAQLFRKLSYAT
FT                   NQSDLRGVDPNGSQRAWDLFVKTRYLAKKDPTRPLIMASGSPITNTIAELWNVGRYMDL
FT                   DALVARNLHEFDAWAANFGETRTELELQPNGLYKPVTRFTEFVNVADLMAMYRDFADVV
FT                   QSDELSRYVKLPSVKSGNRQIVVAESTEDFRAFQQTLAERMRAIEARSGRPQKGDDIIL
FT                   SVMNDARHGAIDLRFIAPWADDDPHSKLNVMIRKVFEIWHETSANRYTNPETGRAYDLP
FT                   GAVQMIFSDLGTQASQTKRGFSAYNWIRSELIRMGIPAEQIAFMQDYDKAAAKLRLFGD
FT                   LNAGRKRILIGSTATMGTGVNAQQRLKALHHLDVPWLVADIMQREGRIVRQGNQHDEVE
FT                   IYAYAQQGSVDATNWQLLERKMRFIGLAMSGDRTIRRIEDVGGEGNQFAMAKALASGDM
FT                   RLIQKAGLEADIARLERLQAAHFDDQFNVRRQIQRAERDIQTAQTRIPKIEAAIGQRVS
FT                   TKGEAFALHRDTTVVESREKAGAWILSQARLAEREGRTGQWSMGRIAGFEVMCEAHEQQ
FT                   FRTSDKRKPEVVSSIYLDTPAGEIEVETDRETKPLGLISRIEHAALRLDSDLAEARRSL
FT                   DEAQRRLPAYRAREGLPFAEAADLKAKCAELYALDAELEAEGKEEGTALKLASANDDAA
FT                   SDVGEKIEEMA"
FT   CDS             complement(170352..170693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43420"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01129"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JCZ3"
FT                   /protein_id="BAI01129.1"
FT                   /translation="MELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQ
FT                   RGITPVIPPKRNRTTRRKTDFSLYRERNLVERFFNKLKQFRAIATRYDKLKSTFLAAVQ
FT                   FASIIILLN"
FT   CDS             complement(170735..171106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43430"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01130"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JCZ4"
FT                   /protein_id="BAI01130.1"
FT                   /translation="MRRYSLRDDQWERIKDLLPGREGYVGGTAVNNRLFVEAVLYRYRA
FT                   GIPWRDLPARFGDWKNVHRRLRRWCESGVIERIFRYLAADYDNEYMMIDSTIVRAHQHS
FT                   AGALKKGARIRPSDDHEAG"
FT   CDS             complement(171897..172820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="APA01_43440"
FT                   /product="plasmid replication initiator RepA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01131"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ54"
FT                   /protein_id="BAI01131.1"
FT                   /translation="MGQIHSLLDRFGVEEMRRLASLEDKTQRLCVEAAHEVMSDEDQAI
FT                   GIAHAGFAMAALPHKKISESIWRREGGSIQLLVESGLDKENKAVGVPFGAMARLILLYL
FT                   QTQAVRTRSREVELGSSMNAWLKAMGVSVGGKTYIAVRDQANRISRCRLTFTRINAGAE
FT                   IITNGAFVRDAIMPIESENGNQLSFWKEAVRLDEGFYESLIEHPLPLREIAIRQISNKS
FT                   KAIDIYIWLAYRLHVLNDPLTLSWNTLKNQFGPEYKELRYFKKDIVTPLKIALSVYPEA
FT                   KVQMDDKYGIILYPSPPPIPEKRIGK"
FT   CDS             complement(173313..174803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43450"
FT                   /product="phage DNA recombinase"
FT                   /note="DNA integration/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01132"
FT                   /db_xref="GOA:C7JJ55"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ55"
FT                   /protein_id="BAI01132.1"
FT                   /translation="MLDTLHITGSWPVLRSYVLEQVDRLTCQRLNDPQASIDVLRPILS
FT                   TAHFSPPLPVLIAGSALPDGSFLPDTELPRHAEHAAAAGEAVKATFPTLPSGYQIELAL
FT                   EIDCEKLAFVATLVSSKISSNSGPRAEKEDTSKILPPAPIGQAPANVTRWFSALCEIDI
FT                   PEHDGRLETSQAAVGAFVQHGKSANTRRAYRSAIKGWCAWTNRHGLPALPARSTDVATY
FT                   LADLALRGRKPTTIELHRAALRYLHHIAQLPIPTAQALVTETVAGIHRSPGKEMPRQVK
FT                   GLTWDMMCEVIDAIPMTTLVDARDRAILLIGYGGALRRSELASIRLEYVTLDDDCMRIT
FT                   LPQSKGDKQNKGTVVAIPRGITRFCPVRAWETWLRLSGLKPRKKTANDHSTTAAFPRIW
FT                   SPAASKPGVSPPLPKIGTQSLSDWSVAKIIKQRCLAAGLEGDFSGHSLRRGAITTGAQD
FT                   NYDLMALKRFSRHRDYRVLEAYIEDDQALTRHPGKSRF"
FT   CDS             174996..176246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43460"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01133"
FT                   /db_xref="GOA:C7JB26"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JB26"
FT                   /protein_id="BAI01133.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTQLR
FT                   TRQSLSAGPFRRSGASS"
FT   CDS             176621..176890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01134"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ57"
FT                   /protein_id="BAI01134.1"
FT                   /translation="MITCPIFGDDVLEERVISLFRRLGHDGRGVTLTSLQTYTGVLGTR
FT                   LRALLASLVQRGKLAPAGCDPLASDFAFRLPLSAKNARSTSIAA"
FT   CDS             177446..177985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01135"
FT                   /db_xref="GOA:C7JJ58"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ58"
FT                   /protein_id="BAI01135.1"
FT                   /translation="MEEISMKRSWHSRDWSRLVRLFNGLTFYERFEQAIILILIALIML
FT                   VTAIATVHLISAVWHLIVDIGIDPIKQEIFQEIFGAIFTVIIALEFKHSLLVVLAQHEN
FT                   VIRVRTIVLIALLAVARKFILLDLNKVSAMELFALSVAVLALGIVYWLALQLHFVLSSE
FT                   SMGNHDSGYDEWRYVC"
FT   CDS             177948..178304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43490"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01136"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ59"
FT                   /protein_id="BAI01136.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKG"
FT   CDS             complement(178369..179232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43500"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01137"
FT                   /db_xref="GOA:C7JJ60"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ60"
FT                   /protein_id="BAI01137.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNNNFCVYGARKVWHQLRREGLDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVGWRV
FT                   SSTAHTDFVLDALEQALCQRRPEGKVPHHSDRGCQYVSIRYTQRLAEAGLVASVGSVGD
FT                   SYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNIPPAEA
FT                   EARFYA"
FT   CDS             complement(179229..179378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43510"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01138"
FT                   /db_xref="GOA:C7JJ61"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ61"
FT                   /protein_id="BAI01138.1"
FT                   /translation="MYNPSVRFPRREKIRQLERENHELRQANEILRKASAYFAQAELDR
FT                   IFKP"
FT   CDS             complement(179360..179725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_43520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_43520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI01139"
FT                   /db_xref="UniProtKB/TrEMBL:C7JJ62"
FT                   /protein_id="BAI01139.1"
FT                   /translation="MPQGIVIIEIFIAQCQAHDPLTDKVFNPVFHKAGMPLIAKTGSKA
FT                   AAETQNVISLLHQNYAPIRTHATPVKTGHNTPSTGGWKLIRACATLCLHRVFLMIMEIS
FT                   FVQNRLFHNLTRCTTLL"
XX
SQ   Sequence 182940 BP; 42445 A; 49522 C; 48345 G; 42628 T; 0 other;
     agttatggcc gtaataccca tgaaaggccc ggccttcctg atggccatgg atacggtcat        60
     cggtggcatc cacatccaga acgatccggg cgggtgcgcg ctcatgctgg tccatgaaga       120
     gcgtgacgaa cagggtagcc agggcctcat gatcagcaat gatgcggcag taacgatctg       180
     ccttgtggcc actgcgctcc agccggttca gcgtggattt tcctgccagt gctgcgcagt       240
     ttgcccggcc tcctgacaga cggcccgagg ccagaccaaa gatcaggtca tgccgcaggg       300
     catcgtgatc attgagatct tcatagccca gtgccaggcc catgatccgc tgacggacaa       360
     ggtcttcaac ccggtattcc acaaagccgg gatgccgctt atcgcgaaaa caggcagcaa       420
     agcggcggct gagacccaga atgtcatcag cctgcttcac cagaatgacg cccccatccg       480
     aactcatgcg acccccgtca aaacgggcca caacacgccg tccacaggag gctggaaatt       540
     catacgcgcc tgcgctacac tctgtctgca tcgggttttc ttatagctta cgaaaatttc       600
     ttttacacaa aatagacttt ttcataatct aacccgatgt acaacccttc tgtgagattt       660
     ccgcgtcaag gaatgccaga tggatctgtt ctcagacagg acctcgtccc acaccatccg       720
     ggccaaccag ctccggctgt ggttctcggc cgcagcctat gtcctgctga ccgctctgca       780
     aagactggcc cttggccaga ccagcctgga gacggcgacc tgtggcacca tacgcgcacg       840
     gctgctcaaa atcgcgacac gtgtaacgct cagcgtccgt cggattgtcc tgtccatgcc       900
     ggacatgttc ccctgtcagc atgaattcgc cctcgctcat gcacgattgc gaaggctccg       960
     gcaggccatc tgaagaaaca gacagtgcac agaccacata gcttccacca acactgcctt      1020
     ctcaggccgt gacaccctca ctgcgttcag aacccgccgc cagaagcaga atatcgtcaa      1080
     tattccagat cgggctcctg tgggatgact gaattctaca aaatgacccg aaattgcctc      1140
     aagtgtgaga aatccgcgtc aaggcttcat tgaagcggaa cagggatgga ataaagctgc      1200
     gataggtctg gaactggttc caggctgaat ccagcgtggc gctctcggaa ctggggcttt      1260
     taagttctac cacgccaagt ggcatgccat taacaaacag cacgagatct ggcctgcggt      1320
     tggcttcgtc cttttcaaca acgaactggc gcacgaccag aaagtcattg ttctccgggt      1380
     tctcaaaatc cagcagacga acccgatcac cagactgggt gccatccttg cgtaccacat      1440
     ctaccggcac accgttgacc agatagtcat gcaggcggcg gttttcatcc acatggtccg      1500
     gcgtgtcttc ccgcatcagg gccaacaggg cttcatcctt tgaggcctgt ggtaaatgcg      1560
     gattcaactt gtttatcgtt gtccgcagac gtttttccag aacaacatcc gacaatgagg      1620
     cccgttcggg ctttttgcca ccgggggcaa tatctggccc ccaggcaatg gtgtagccac      1680
     attcacgcag aatatcgcag gcccagtctt cgatctcgtt ttctgacaga aaactcatgc      1740
     cgcgtcttcc accatctttt cagcatctcg gatgctgatc tcgccagaca tcagcttggg      1800
     gagaaggagg tctcggagct gggcgaggat gtggggctca tcaaaatttt ttatgatttt      1860
     atcgaatagt aaagaggttt tattttcaaa ttcatataga attttgtcgt ttggaataag      1920
     tgtttcgaaa gtttcaatta gatttttact caaattttgt tgagctgatc ctgtagcttt      1980
     atttgctaag tttacttttg agtgtagcat atgcaaaaaa atatatgatt tgcctatacc      2040
     tttgggtatc aaggacgata tagcttgatt tgtagtcatt ttagtagcgg ttaaaccaac      2100
     ttctcccgct gttgcaccat acaaggcgat aactatagac cccgcaggta tccattttgc      2160
     tgaactattt tctagccctt catttgtaat atgattttca gtttctgaga tatattgttt      2220
     tcgaacttct ccagacgtta accatggtat atcgccattc tcccaataag aagatttagt      2280
     tcttttggga gttccgccat tacagatatt aatggttagg gcctgttagg gcttgatcca      2340
     gtctgctgcg gcagcgatgt ggatgaccgc gaggaacgac gttgctgttt tttcatatct      2400
     ggttgcgaca gcgcgccact ccttgaggcg agcccagagg ttctcaacga gatgccgaca      2460
     ccgataggcc catttggggc aggcgaccgg gccatcgcgt cgtttcgcgg gaatggctgg      2520
     ccgtgctccc atgtcccata tccgttcacg catggcgttc gacgcgtagc ccttgtccgc      2580
     tactacccac aggggagtgg cgggaaggct gtcgagcatg gctggtgcca gaggcagttc      2640
     atgagcctgt ccaggggcca gcgcaaaacc gaaggctttt ccatgtccat cagcgatcac      2700
     gcagactttt gtgccatagc cgccgcgaga gcggccaagt gcttcacgat ggtctcgctc      2760
     ttcgaaagag gccccttttt ttgggctccc gccgctttgt ggtgagccct gatgtttgtg      2820
     ccatccagaa aagtcattcc gaatgccact ccctgttgtt cctgaaccag tgcgagcagc      2880
     cgctcccata cgccgagctt cgcccagcgg atgaaaagct gcgcagcccg ccaccacgga      2940
     cccagttcag cggggatact ccgccatttc gcgccattct catgacgcca gaaaatcgct      3000
     gctatcgtcc gccgcagatc atgtggcggc gtcttgcccc tcgggcgaac ctcctcaatc      3060
     agaggttccc agatcgccca tgtctcgtcc gtaaaggtgc ctgttctgtc tccttcttcc      3120
     atccctacaa tatgggaaga aattcaagat ctaacaggcc ctaattcgtg taactctccg      3180
     attttccacc cctcaggctt cccctcatta tccagtctac cgggaaagag ttcccacagt      3240
     tctggtgcga ggtaaggggc ttctccggcc atttttgccc gtgtcgggcc aaaatcgaca      3300
     aaccagtccc gaaacaacgc ccgcgccatg gcttccagcg tttcgttcgt ccggcggttt      3360
     agctcgattt tatcgtcgag tgagccgagg atggaagcta tggtatgttg ttcgtcatat      3420
     gtgggatatg aaacagaaat ctggccaact aaacttgtgt tcaggtgggg catggttgca      3480
     ccaacagaat tttgtgaaat ccattctttc acatggggta gagtaagata ataatatagg      3540
     tattgtggaa gaatgcttga cgtattcaat ctaattctta agcaaccagt tccgcaaagc      3600
     catccatttt ctcttgaagt gattagggcg tgcttagtaa tgtcgccacg cctaggataa      3660
     ataatatcat tttgcgcaag tctaaaattt gaaagacgat tggcattttc ttctgaaata      3720
     taagcaattt ttccagtcga aattttacca tcaatgatat cttgaggcat aatgcagggt      3780
     acgcctgatg ttacataatc agaggcgtgt aattgtgtac cataaaggac cagtttggat      3840
     gcttccatca gcatcacata agtaggatat aggacaggtc gtccattttt catgatacgt      3900
     taagttgctc attgtaaaat tcttctaaaa tcttttctgt tgtttacgaa ataccaagct      3960
     tgttttcata ataatatctt ggaacatttt atccgccaga gcccaatcca atacatcaac      4020
     tttccacggc aattctgact ccgagaaagc ttcctccagt cgtgctcgcg tttccaaaag      4080
     caaaggttca tcacccataa tcgctagatc aagatcagaa aaaagcttgg ccttgcctgt      4140
     gacacgcgaa ccaaaagctc gcacttcacg gtcgggcaca atctcattca gtatccgcag      4200
     cacaatagcc cgctcttcgg gcgtgatctc gatcagtcct gtcacgttgt gcgctctttc      4260
     agcgtgacca gtagaaactc cgcttctacg ataaagtctg gaatggtggc cacaacctgt      4320
     ttggctgtgg cctcgttgta agtatggctc gtcaggttac gcattttgcg gaacacgctc      4380
     cactggggcc atgcgctttt gagcagtcca gcctcattgg cggagcggat catgtccgga      4440
     aagcccatgc ggtcatattc gtcgggggag gctgaattgg tttccagaaa gcgcttcagg      4500
     gtcttgtggc tgagttcata ggtaaactcg aagcgctgga tcaggccgtc ccgtaattgc      4560
     tcatcgtctg ggtgggcaag gtggcgggtc cagccttcct tcaggcggtt caaagcgcgt      4620
     tccagtggag tgagatagag catcacacgc tttccttctg cacgatcagc ttcagggagg      4680
     cggtaatttt cgcgttcagg gtttctccct gcgcaaactg ctctttcagg gtcttttcaa      4740
     gggctgcgaa gcgttcagta aatggcacac tgtcttcctc ggcttcctct gcccccacgt      4800
     agcggcccgg tgtcagcaca aagccgtgct gctcgacctc gtccagtgtg gcggatttgc      4860
     agaaacccgg aatgtcctcg tatttccctg cattcttttc cccacgccat gcatggtagg      4920
     tgtcggcaat gcgcgctacg tcttcatccg tcagttcccg gcgggtacgg tcaacgagct      4980
     tgcccagctt gcgggcatca atgaacagga tttctccgcg tcggtcccgc cagcctttcg      5040
     ggttcttggt gcgggtcagg aaccacagac aggccggaat ctgggtggaa tagaaaagct      5100
     gtcctggtag ggccaccatg cagtccacca cgtctgcttc caccatccgg cggcggattt      5160
     cgccctcgct attctggttg gaggacatgg agccattggc cagcaccacg ccagcggtgc      5220
     catcgggagc cagatgccat agaatatgct gaagccacgc atagttggca ttgcccgctg      5280
     gcggcttgcc atactgccag cgcggatctt cctccagcga ggcattccac cagtccgaca      5340
     cgttaaaggg cgggttggcc agaatatagt caaagcgcag gtctttcagc tcgtcgcgta      5400
     gaaagctgcc ctcattgttc cagcgaatgt ccgcgccaat accccgcacg gcaaggttca      5460
     tacgggccag acgccaagtg gtgtggttgc tctcctgccc ataaatggca atatcaccca      5520
     gcttgccacc atgggtttcc acaaagcgtt cggactgcac gaacatgccg ccagacccac      5580
     agcaggggtc atagacccgg cccttatagg gttcgagcat ggaaaccagc gtgcgcacca      5640
     cgctggacgg cgtgtagaac tcacccccac gcttcccttc ggctccggca aacccgccaa      5700
     ggaagtattc atacacccgg cccagcacgt cccgcgcctt gtcgtccgta tcgcccatgc      5760
     cgatatcgga gatcaggtcg atcagctcac ccagcatgac ggtatcaagg gccgggcgcc      5820
     cgtaatcctt gggtagcacg cctttgagct gttccgggtt ggctttctcg atggccagca      5880
     tggcctcatc aatcatcttg ccaatattgg ccgaacgggc attgtccttg agatgagacc      5940
     atcgagccgt ctccggcacc cagaagatat tctcggccag atattcgtca ggatcttccg      6000
     ctgcttccgg gtcttccagc atcagttcag catgtcgggc ttcaaacgca gtggagatgt      6060
     agcgcaggaa gatcaggcca agggccacat gtttgtagtc tgaaggctca aggttcttgc      6120
     gcagcttgtc cgccgccaga aacatctgct gttcaaagcc cagtgtcgcg gtcgctgcct      6180
     tggccttgcg tgctttggta gttttcttag gagcagaggc agcatcaggg tttttacgtg      6240
     gacgaccgcg tgacatgaaa ctaaagcctt aatatgacaa taaattagag ccgcattttg      6300
     gcctattcta gccgtctggt cgagtaggaa gggcgggatt gtgggtttcc gttacaaggt      6360
     aaccgccgaa gtccacgcac tgatcgtatt gatagaaaac ttatcggcga acatggaaca      6420
     gatcttgtaa atgctctcaa attccactta tggcacgtag atatgggctc ccggagaaag      6480
     agaggtttgt cgaagttcct taattaggtg acaggccacc cgtttcacgc aggcctatca      6540
     ggcctatatc gtgacaaaga tccgttcgat gtcagcaatg gggggggaaa cagacagtcg      6600
     gctatcggga tagagttacc gaaaacagcc tttcgcagtg ttcacattca tggcagggag      6660
     tagaactatt caggtgattt cgcctacttc acgacaagta tcacgtcggc ggctaaatat      6720
     tttctatagt tcaaatgcaa gttccttcca ttggaaggaa cttgcgggaa aaatagggta      6780
     tcagcgagca agcggataat ccgtatagcc ttctgcaccc tgcgagtacc aggtgcggat      6840
     atcgtccttg ttctggggca gattgtcttc cagacgacgc acgaggtccg gattggcgag      6900
     gaaaggccga ccaaacgaaa tggcgtccgc aacaccggta gcgactgtct cgatcgcttc      6960
     ttcccgtgtg tagtcctgat tcagaaccag cggcttcctg aagacttcgc ggatcggacc      7020
     atgcaacttg ggctggtcgc tcttgccgaa cgtgccgttc ggtccgggct cgcgcagttc      7080
     aaggaaagcg atatcgaggt cattcagcag ctttgcggcc ggcacaaaaa cctgctctgg      7140
     atgactgtcg atgcagccct gcgtatcgcc attgggggac agccttactg acgttttgtg      7200
     cgcgccaatc gttgcgatca cgcgttcggt gacttcacgc aggaagcgga tgcggttttc      7260
     cggcgaaccg ccatattcgt cggaacgatg attggtgccg tcccgcagaa attcgtcgat      7320
     cagataaccg ttggcggcat gaatctgcac accgtcaaag cctgcctgaa gggcattgcg      7380
     agcagcattt tcgtagtcgt tcaggatgcg ggcaatgtcc tccttggtga gagggcgggc      7440
     gacttcggga gcctgcttgc catcgtaagt atggagggct tcaggcgctt ttgtcgccga      7500
     gcaggacaca ggttgctggc ccgtcacgct ggaatgaacc atccgaccca tatgccagag      7560
     ctgggccaca atctttccgc ccttggcgtg aactgcggcg gtgatgggct tccaggcttc      7620
     cacctgttcc tgcgaccaca ggcccggcgc atacggccag ccaagacctt cgcggctgat      7680
     cccggtcgct tctgagatga tcagaccggc tccggcccgt tgcgcgtaat attcggccat      7740
     gatgggggtg ggcacatgat cacgggtgcc ccgaccgcgt gtcagcggcg ccatgagaat      7800
     tctgtttttg gcgtaaatgc ttcccagttc aatcggctca aacaggctgg tcatgacaga      7860
     tccttcttaa aagacgcagt tcctatgaat ttgggaagcc tcacgaggaa tacaacagaa      7920
     ggcttacaac ctcgtctgac ttgaggtgag cactgcctgt ctgctgaatt ggtgaagccg      7980
     acaggcagat ttggggggaa atcggaatgg cggctattgg gcagaaatga acaaaagcgg      8040
     agattcgtaa ccgttcaggt tcctagcact acagttgcat tttgtgttga gttctgaatc      8100
     tatgggtaac catgattcag gatatgatga gtggcggtac gtctgttgaa gagacgctgg      8160
     aattatgggc gcgctcgctt cggtccgcca aggatcggat ggcgccgctg ttcacgcaaa      8220
     aacgtgtcgt agattcggcc tgtgcttttc ttgatgtttt gattggcaat gaaccacgca      8280
     agacgggatg gatgcgagcg gaagccgcag gagatcctgg tccatggcgg cagcaggcgc      8340
     ttctgggacg cgggcactgg gatgccgatg cccttcgtga cgtcgtcagg gattatgtga      8400
     ttgagcatct gggcactgaa gagggcgtgc tggtcattga tgagaccggt tttctgaaga      8460
     agggtcaggc gtcctgcggt gtggggcggc agtatacggg atctgccggc aagatcacga      8520
     actgccagat tggtgtgttt ggcgcttatg tttcggaacg ggggcatgcc tttattgacc      8580
     gcgccctgta tctcccgaaa gactggacat caaagcctga gcgtctgaag cgggcccacg      8640
     ttcccgatga cgtggtgttt gcaaccaaac cggcgttagc ctcgatgatg attgagcgaa      8700
     gtattgaggc cggtgtgccg ttccgctggg ttgcagcaga cagcgtgtat ggcgtgggcg      8760
     acgtagaacg cacgcttcgc cgggcaggaa ttggatatgt gcttggggtc aagggcaatc      8820
     actggttcgg atcatgggca acggaaccgc tgattgccgg agaggcgaaa gatattgcag      8880
     caggactgcc agaccaggcc tggcgtcgtc tgtcagcggg gcacggcaca aaaggtgagc      8940
     gactttatga ctgggcgtat cttccgcttg ctgatctgga tgctgaagaa tttgactgcc      9000
     ctatagccgg accatggaca cgtggcctgt tgatccgccg aaacatcgct gacggggacc      9060
     ttgcctattt tacgacctgg agcccgaaag ggacaaccac gcaggaactg gtgaacgttg      9120
     aagggacgcg ctggaggatc gaagaagggt tcgagacggc caaaaacgaa tttggtcttg      9180
     atcataacga gacccgctcc tggcatggtt ggcatcggca tgtctctctg gtcatgctgg      9240
     cctatgccgt catggccagt gtccgttacc aggcaaactc actgaaaccg aaaaaaacac      9300
     aactcagaac acgacagtcc ttgtccgctg gtccattcag gagatcaggc gcctcgtcgt      9360
     aaaacttgca caacgcagac tacccgtctc tcacatcctc agatggtccg tctttcgacg      9420
     aacgcatcag gccagtgcta tccgcgctca ctcacgacac aaaatgcaac tgtagtgcta      9480
     aacacctaga aagaccaggt tgcatcacag ctgaaccaga gcatgttatt tgtgccgtta      9540
     ttgacggttg ggttctgcac ggttccggcc tggttgaatg ggtgcgtgcc gttaagggat      9600
     ttatccagcc ggatttcagg ccggatggta aagcccccca gagccagctt cttgttcacg      9660
     aactctggcc ggtaggagac acccagcgtc agttcgccat aggttgtggg cagagcgttg      9720
     taatagggaa atggctggtt gctgagtgct tgcgtgaggg agttgaagct ggaatattcc      9780
     gtaatcaccc cacccgtgtt gtcacggaag atttcacctc gtgcattgaa tgtcagccag      9840
     aggtggatgt cgtaggaaaa gtaggttgtg accccatagg catcatcgcg cagggaatca      9900
     tcgtgcagat aggtgccatc cacggagacg gtcatcttat cattgatatg atacgtggcc      9960
     ataacgtccg cattatactg catgaggctg ttggcctgct tgccaatacc cgcactcacc     10020
     caccctgtgg gagagacaat ggtgcggcca ttgttgccct gtggtccaaa gtgcccgatg     10080
     gcatgcacat ccagcttgcc atccatcagc ttgttccacg ccagaccaaa atagcccttg     10140
     ggcttgttgt tgttgccaga agcgccaaag gttgtggagt tgcctgcatc cacccccaaa     10200
     atccagtcca tgtggcgtgt cagatgcatg gtggccagaa tacccactgt ctgaaacggc     10260
     acgatataat ctgatgcgta gttgtaggtg tagaacggcc gtgccagagc gggcgtgcct     10320
     tccgcgccca taatgccgta catctggccg atctgcacat caatgccgcg cttgaagatc     10380
     cacggcaaat gcacatccag atgcgcctgt gtgggtgccc actgatacag accgtgcaag     10440
     gaaccagaac ccatgccgat tgtggggtta aaccgtgcat cggaaccgta catggcttcg     10500
     acgcggattt ctcacacttg aggcaatttc gggtcatttc gtagaattca gtcatcccac     10560
     aggagcccga tctggaatat tgacgatatt gtgcttctgg cggcgggttc tgaacgcagt     10620
     gagggtgtca cggcctgaga aggcagtgtt ggtggaagct atgtggtctg tgcactgtct     10680
     gtttcttcag atggcctgcc ggagccttcg caatcgtgca tgagcgaggg cgaattcatg     10740
     ctgacagggg aacatgtccg gcatggacag gacaatccga cggacgctga gcgttacacg     10800
     tgtcgcgatt ttgagcagtc gtgcgcgtat ggtgccacag gtcgccgtct ccaggctggt     10860
     ctggccaagg gccagtcttt gcagagcggt cagcaggaca taggctgcgg ccgagaacca     10920
     cagccggagc tggttggccc ggatggtgtg ggacgaggtc ctgtttgaga acagatccat     10980
     ctggcattcc ttgatgcggt tttccatatc cccgcgtgcg cagtaaatct gttcgtagag     11040
     atggcggggg tcggacattc cctgcggtag ggtggtgaca atgaagcgat gatagcggtt     11100
     gccgtggcgc cattcggcct tggccacgac ccgcctgcgg cgcgtccagc tgtcctttgt     11160
     gatccagtca aaggaggcga aaccgcgcgc agctctgcct gtcgtggcgg cttcgtcacg     11220
     aacctcagcg gacaaagagg caatccggtc atacaggcgg gtgttgcctg caagcccgaa     11280
     caggaagtca acgtggttgt cttcgcacca tgtcatcaga ctgtcccggg cgaaaccgct     11340
     gtccccacgc accaggatac gcacccgggg ccaacggctc ctgatctgct ccacgatccg     11400
     gcggatgtct gccagtgctt ccttccccgg gtccctgtct gccgtgcgca gggtagcgct     11460
     gaggagatgg tccccgcaga agacatacag gggaagatag cagttatggc cgtaatatcc     11520
     atgaaaggcg cggccttcct gatggccatg gatacggtca tcggtggcat ccacatccag     11580
     aacgatccgg gcgggtgcgt gctcatgctg gtcaaggaag agcgtgacga acagggtagc     11640
     cagggcctca tgatcagcaa tgatccgaca gtaacgatct gccttgtgcc cactgcgctc     11700
     caaccggttc agtgtagatt tgccagccaa tgctgcgcag tttgcccggc ctcctgacag     11760
     acgacccgag gccagaccaa agatcaggtc atgccgcagg gcatcgtgat cattgagatc     11820
     ttcatagccc agtgccaggc ccatgatccg ctgacggaca aggtcttcaa cccggtattc     11880
     cacaaagccg ggatgccgct tatcgcgaaa acaggcagca aagcggcggc tgagacccag     11940
     aatgtcatca gcctgcttca ccagaattac gccccatccg aactcatgcg acccccgtca     12000
     aaacgggcca caacacgccg tccacaggag gctggaaact catacgcgcc tgcgctacac     12060
     tctgtctgca tcgggttttc ttgatgatta tggaaatttc ttttctacaa aacagacttt     12120
     ttcataatct aacccgatgt acaacccttc tgtgagattt ccgcgtcgag cacaaagccg     12180
     atgccatacc cactgcccac cgatgtgacc ggatgggaca gagagccaat gatctggttc     12240
     agcgtaactg tattggcgcg atctgaataa tactgtgcaa agttgcggcc agagcgtgtc     12300
     caggggttgc ctgaaatccc cgcttcaatg gagacatgcc cttccagccc ttcccagtat     12360
     gtgggggtat ggccgggttt gacatggaac agattgcccg ccttgggctt catggcctct     12420
     tcttcttcag aaagagaggt ggcaggcggt tcttccccat ctgttggcgt gcctgcaccc     12480
     ttttctgtct cttcgggctt gagggttttg gctatgtctc ccacctgaac ctgggcaggt     12540
     gcagatgtct gggcgtgggc tgttggcata cctgtttcac acaaaaatgc agcgcaacat     12600
     gatagcaata caaatttgaa ggcacttcga tcgatcaggg tctgtcgcat gtatcaccta     12660
     ctttgcacaa aagaaacata acgatcccga aacatttgga gcaaaaaaat ccatccttga     12720
     agaatacttt gtatgctctt catatcagga atatttcacg attaggtaat aatataaata     12780
     caaaatccat atattattac cgtccatatt tctaaaataa taatttatga atataatttt     12840
     ggtcaatata aattaaaatc atatagcgta attttttcct attttccatt tctggaaaac     12900
     tgaggcatat ctttaattgg acagccctct cgatttacgc ttccttctgc accaaaactt     12960
     ataggaagaa aatctgctaa ttcagagttc ccggcaatgg ctttccagaa agatcttgtt     13020
     cacacatgtc caaaaaagct gaaacacgaa aaggaaattt ttgatctaca attgtaaaaa     13080
     gtccatataa aagtggtgcg cattcatctt ctaatgttag ataagctaaa gatttgccat     13140
     ccagtgcctg ctgatttcgt gggcgcgcat ttcctaaccc aaagcccaca cctcttgcag     13200
     ccaaactacg gatcacatcc atacttggat aatgacctgc aatacatggt gtgattcccg     13260
     ctgaagcaaa caactgtaga aaatattcct tcgaaaaagg cagatcaagc aaaagaaaag     13320
     gctcatctgc cagatcttgc aatcgtacac attcttttgc agctaatgga tggtcacttg     13380
     aagtaaatac atatggcggc agtgcagaaa gcggctgaaa acctatcata gggggcaatg     13440
     tcatattata gccaatcatg actgatattt caccatttcg gagtttatct atcagttctt     13500
     catgatgtcc ggcaatgacg cgcaagcgtg cttccgggta agcagccgaa aaattctgaa     13560
     taagatctgg cgctagtaga ggaaatagcg ttgtcatgca acccaccctc acttcccctt     13620
     gcacacgctt gagcataccg ttcagagagg ttcccaattc ctgagcgtgc aataaaagtg     13680
     tgcgcgcttc ctgtaaaacc agacgtccct ctgcagtaag agacagacct tgtgcatgat     13740
     gacgtataaa aagtgatacc ccaaacacgc tttcaagatg cgcgatagcg gcagaaattg     13800
     caggctgaga gatcggaatt tggcgagaag cctgcacaat ggaacccagc tctgcagtgg     13860
     cgacaaaata ttcaatctgc cgcaaagaaa acttcacctt caacgtctcc ttctaggtag     13920
     tacttgaata gccacctatt ttctcatcat gctgtttaaa cctgctaatg taaaaatctt     13980
     tccatgtcgg ttttatttta tagaagtttc tctactattt tttctacaaa ctgaacgccc     14040
     gcagataatt catccaaacg aataaactca tctgccttat gcgcacgatc aatagatcct     14100
     ggtccacaaa ccactaccgg tatatcaaga tattctttga ataacccacc ttccgtgcca     14160
     aatccaatat atgaaggcgc attatctcct gtaatagcca ttatctcctg caaaaatggc     14220
     gtaccatccc gtgtgtttaa tcctggatat gtattaagtg tttcaatctc tatacgtgca     14280
     gaggggtacg ttgtgcagag acgagctcct tcctgcttta gtcgttcaat atagagcgca     14340
     ggatctactc cgggcaataa acgcatctcg aagtgcactt cacacaaatc tggcacaata     14400
     ttcagcgcaa caccgccttg gatgagccca acctgtaagg tattatatgg tacttcaaaa     14460
     ttctcatctt gcgcgccatt gttttgcaat tcatcttgca ggaacttaat ggcctgtacc     14520
     atatctgatg caagcagaat ggcgttagaa ccacgtgcgg gattggccga atgcgcagcc     14580
     agaccgtggc agacaatgcg tgcggccagt ttgcctttgt ggccagatac cacatgtaaa     14640
     ttggtgggtt ccccaataac acatccacgc gcctgaaatt tatgaacagc tagagagcgt     14700
     aaaagtgagt gcactcctac acaacctatc tcctcatcat acgaaatagc caaatgcaac     14760
     ggcgctcgca gggttgtttt ttgggcagca taccgcgcgg ccaccaacat acaagcgaga     14820
     aaacccttca tgtcacttgt tccgcgtcca tataggtttc catcatatgc agtcagggta     14880
     aaaggggcag ttttccatgg ctgcccttct acggacacaa catcactatg agctgaaagc     14940
     acaatgccat ctggagtgtc cggcccaata ctggccagca gattaaaacg accagcctgc     15000
     tcgcctggca cacgcaggca acgcgcccca catgcacgca gaaattcttc aacccaatca     15060
     ataaggttct gattttctgt gcgacagata gtgggaaaag ctaccaactg tgaaagaatg     15120
     tcttgcacag atagatcata cattgaggtc atacggcatc cgccaaaatc atatcggatg     15180
     ccttatctcc aatcatcatc gttggtgcgt tggtattgcc acttaccaac gttggcatga     15240
     tggatgtatc cgctacgcgt aggcctttta gtccacgcac cttcaaatca ggcgttacaa     15300
     cactcgtatc atctgctccc atgcggcagg tacctgaggg atgaaacact gtgcttgccg     15360
     atgcgcgcaa atactctatt aattgatcat ctgtctgaat attggctgtg ggcgccattt     15420
     ccttgcctcg tatcgcatca aaaggagatg cacgaagaat ggaacgcgcc agttttacgc     15480
     cttccagcag cacatgcgta tctctttcat cggaaaggaa attgaaatca atgtctgggt     15540
     ttcggcttcc atcacgtgcc aagcgaatgc tcccgcggct ataaggccgt agcacacatg     15600
     tatggagggc aaatccgtgg ccccattcaa acaaccgtcc acgatggcta cggtaacccg     15660
     gcacaaaatg aaactgaata tctggcacat ccttggcgta acgtgtggat gcaaaacctc     15720
     cagcttctac atagtttgtt gtcagccagc ccttacgttt aagcagaaat tgcaaaggtg     15780
     atggcacaac agaggagagt gaagctgttg aaaagccaag cgttgaagct gaatcagagc     15840
     ggatggtaac caacccatca acatgatctt gcagattgcg ccccacttct ggcagatcag     15900
     ccacaactgg cacgcctgca gccaaaagtt cgcgggcgtt accaatgcct gatgacataa     15960
     gcagatgtgg tgatccgata gcccctgcgg aaagaatggt ttctcgccga gcgcgcagaa     16020
     catgaaactg cccattccgc tctatggtga cgccctgcac ttccttgcca tcagttacaa     16080
     gggaaacaac cttgcaacca gtaacaacat gcaaatttgg gcgggaacgc acaggcgcaa     16140
     caaaagcacg ataagcactt aagcgttttc cgtccttttg tgtcacatca taaataccta     16200
     caccatcaag ctttgcacca ttaaaatcag tgttctcttt cagccctacc tcttcggcgg     16260
     ctttaataaa caggcgtgaa acccccaatg gatcacgcgg ctgatctaca accaattcac     16320
     cacccgtgcc atgaaaatgc gggtcttggt gcagatgatt attttcttcc cgcatgaagt     16380
     attttagtac tgcgtcatac ccccaaccag tacagcccat ggcctcccaa tcatcgtaat     16440
     ccgaacgcgc accacgaatg taaatcatgc tgttcatgga ggacgatcca cctagcatac     16500
     ggccccgtgg cacatggatg cgtctattat tcaaatattt ctgcggtgtg gaataatact     16560
     gataggtata tttacggctt ttataaagtg agatcgtgcc tgctggaaca tgaatacgcg     16620
     gtgtattgtc tgcttgccct gcttccagaa gcgctacacg caaattgctt cgcgcgctca     16680
     agcggttggc aagcacacag ccagcagcgc cagcacccac gataatgaaa tcaaattctg     16740
     tcggaaaatc gttctggcca ctcattattc tgcacttcct gcaacaggct gcgtatgccg     16800
     ctcatgccgc atcagccaga cgtaaaacac agtcacaaag atcaacccta caatccacga     16860
     aatgtctgcc ccaccaagca tggtagctat cggaccggta taaagaccgt ttgaaacaaa     16920
     cgggatctgg ataaggatac caaacacata ggcactcaac gcgggccagc agtaacggcc     16980
     ataaatgcct ccatcagccc gaaaaaaaga ggcaacatca tattcgccat gtcggatcag     17040
     atagaaatca gcaaggttga tcgcagtcca tggtaccatg acgtaaagca gtagaagaat     17100
     aaagtttgtg tattcctcca taaagtttgc ttctgtgccg agagcgataa gaagagaaag     17160
     gccagacaga acaacagccg tacctgcgcg cccgacatgc gtggctttcc atgaaggaaa     17220
     gatggtctga ataactgtaa tggccgacaa cgcaccacaa taaagattca tggcgtttgt     17280
     agaagcaata cccaatgaca gaacgggaat aataaaaagt gcaagtggac caacttcttt     17340
     tgtaagtgta gcgaccacat cgcccccacc cgcaatgaca cccagaagtg caccgagaat     17400
     catggggaat agcgagccca gcacacatcc ccaatagctt gccataaatg cctgacggtt     17460
     accggtgccc ggaggcaggt aacgcgaata gtctgaaaca taaggcgcgt aagcaatttg     17520
     ccacaaagca gcagtagaca aaccgccaag aaagccagag agggtaaatg tgccgtgggc     17580
     cagcgtggca gatgaaacac cgttaatgca cagtatccat acgaaacaca aaaccaatgc     17640
     aatgccggat acaaccgtca taaaccgcgt ataggcatgg attagatcat gcccataaat     17700
     agtagcaatc aagctgacga ggccgagcaa tataacgcat gttttttcag gcaaaaatgt     17760
     tgcaacagtg tgcagagatt ctccgcccaa aacgagattg gaagcaaaga agccaacata     17820
     cattatcacc accaggcaga taacagccat ggcccctact gaaccaaact gcccgcgtgt     17880
     ttgcaccatt tgcggcacac caagttgtgg cccctgtgct gcgtgcagcg ccatgaacag     17940
     accaccaatc atgttaccca agacagccga aagcatggcg ggccagaaag gcagaccaaa     18000
     cacagttgtt gcaagcgcgc ctgtgataat ggtcagcatc atgatgtttg agccaaacca     18060
     caccgtaaac aaatcacgcg gacgaccatg ccgctgatca agtgggattt gataaatggt     18120
     atgagcttct ggccctcgtg ccgtcgtggt gtcagtcatc ggacggttcc ttcctctggc     18180
     attcaacagc aattactgtt tgtatgcagg atatcatatt ggaatcgtaa cattatcaag     18240
     acataaaaac ccccgccaaa gcgcagcggg gtgttcgcaa tcattcacgc tcagcgataa     18300
     catctacctc aatcagccat tctgggcggg caagagccac aacaaccaac cctgtaaata     18360
     cagggaatac gcccttcagg cggcgcccca atacacgata agtggcttca cggtagcgaa     18420
     tatctgtgag gtatactgta actttgcaga tatctgttag ctttgcgcct gcttcagata     18480
     gcaaaagttc aatattatct attacctttt cggcttgagc cgccgggtct ccaaccccta     18540
     cattttcacg tgtatcaaga tcctgaggca cctgcccgcg cagatagatt gtattttgcg     18600
     taataacggc ctgacaaaga tcgttatcaa gttcctgctc gggataagtg tccttcgtat     18660
     tgaagggacg aagacgagta tgagccataa tctatgtgtc tcctgtatga actgtttcga     18720
     tacggcgaca cagcacgtat caaacgatca cattgcgatt gtggaatgtt ttgaggtatc     18780
     agaaaaagaa attatttctg accctctact tctgaattcc tgatgttagt actgaatcca     18840
     aactgttttc agcgcggtgt atttatcaaa gctatgcagt gataaatccc gcccaaaacc     18900
     tgattgctta acaccaccaa aaggtgtcat gggagaaaga gcatctacgg tattcacaga     18960
     aaccgtgcca acctgcagtc gttccgaaag atcaagcgcc cgtccaatat ctcgtgtcca     19020
     gacagaagca gccaaaccgt aaggcgtatc atgcgctagc tgaagagcat cttcttcatc     19080
     ccgaaatgtt tgaatagcta gaaccggccc aaaaatttct tcacgtgcga tcaaagtatt     19140
     ccgaggcaca tctgcaaaaa ctgttggctg aataaaggcg tctgacgcac caaccgtaat     19200
     acgatttccg cccgcaacaa ggcggctact ttcccgacca gagtttaaaa actctgcaac     19260
     acgtgctgca tggcgactat ccaccatagc gcccattttt gtatctgggt ctagcggatt     19320
     tcccgggata attgcttcag cccgcagccg catacgctca atcatttcat ctacaataga     19380
     ctcatgcacc aacaggcgtg agtttgcaga acagacttcc ccctgattga aaaaaattcc     19440
     aaaggcagct tgatctgccg caacatcaag atttgcatcc gggaaaataa tgttggggct     19500
     tttcccgcct gtttctagcc acacctgctt catgttgctc tcgcctgcat agcgcatgaa     19560
     caacttaccc actgtggtgg agcccgtaaa aaccagacaa tctacatcat catgcaagcc     19620
     tagcgcctgc cctgcttctt cccccagacc tggcaccaca ttcagaacgc catcgggtag     19680
     accggcttcg gctgcaagct ccgccaggcg caaagcagaa agtggagatt gttctgctgg     19740
     tttaagaact acggaattac ccgttacaag ggctggagct aatttccaga tagcaatgtc     19800
     cagcggaaaa ttccaaggca ccacagcccc aactaccccc agaggtatgc gccggatcat     19860
     cgcaacatca cgcccccccg ttggagccac ctcatcgtat agcttgtcta tagcctctgc     19920
     atgccattgt aggcattgcg ccgccccagg cacatccaca ttcgtggtct cggaaattgg     19980
     cttccccata tccagcgtat caagaagcgc aaattcatca agatgttcac gtatcagcac     20040
     agcaagacgt aggagtgttt ccttacgagc gctcggagta aggcgagacc accgcccatc     20100
     ttcaaacgcc cgacgggctg attttacagc cctatcaata tcctctgcgc ctcctcgtgc     20160
     tacctgtgtc agaatagatg acgttgctgg atttacatct tcaaaccact ttccagatct     20220
     ggcgggtaca aatttcccat caatccagca attattacga aatttcagag catcggcgcg     20280
     ctgtgtataa taggataggc ttttcattat ccctcctcgc gcgatggctt gtaggccata     20340
     taaccacgct gtttggcaat gtgatctgct acatattttg catcatgcca caccccccat     20400
     atgaaggacg agccacggcg tgtctgccac ggcagaccaa gaaaatagat cccaggttca     20460
     gcagaaacgc cacgctggtg gtgtggacgc ccctgctcat ccaacgcttc cacctttaac     20520
     cagctataat ctactccaaa accagttgcc catataatgg tgttaatacc agcgttttgc     20580
     agatccagct ccaaaacagg atgcttcatg cattctggat ctggcagcat atcacgagct     20640
     gtaggttctt ctggcagatc aagaccatta cgcgtaacgt atgtatctgc ctcccctagc     20700
     aaggaaaggt agtttgcatc ccctttggca atattttcgg ccagatctgg ggcaaacgtt     20760
     aacacgccat catgaaatgt ctcggtacgc ccaagaagtg tcatgccctc agatgcaaga     20820
     cgccggaaat caagcgtatg cccaccattt gcgccactta cggcaattgt tgtgtgctct     20880
     acccccggcg ttgcttctgc atcccattta ttgagaacac ctagccacca tacgaaatca     20940
     cgcccacgat aatgccgagg gggacgatca tgcgggccga cagacaaata aaccttccgt     21000
     ccactccgca tcagctcctc agctatttgt gcgccagaag atcctgcccc tacaaccaaa     21060
     acagcacctt caggcagttg ttctggattg cggtaagatg ctgaatgaat ttgggcaata     21120
     ccggaagctt ctggaactat aggaggaata acaggtattt ggaaaggccc tgtagcagca     21180
     acaacagcct tggcttcaat aacaccttcc gatgtttgca cagtaaagcc aagacgccca     21240
     gcgttacgcc gcacttcttt tacctctacc ccacaacgaa tgggagcatc gattttttgg     21300
     gcatatgcag caagataatc agcaacacgc tctttaggaa caaaatcatc cgggccatca     21360
     tgctgaaatt ccaaatgcgg aaagcgatca tgccatgctg gaccattggc cacgagagag     21420
     tcccaccggc aactgcgcca ccgttctgcc acgcggttac gttcaagcac tacatgttca     21480
     atgccatagc cgcgcaaatg ttcgctcatg gcaatgccag cctgaccagc cccgactaca     21540
     agaacttctg ttttctcgat ggtcatattg gtgtcttctt ccaaaaaaaa tagataattt     21600
     ttaaagaaat caagaatctt attttttact catcaccagg aacgccataa gatggcgcaa     21660
     cttctgggtt aaggcagcgt gtgacatagt catgcatttg gggctgccaa atagtccaca     21720
     attcttccag ctttgttatc ggagcttcgt cccagtccac acgcagatcg gctaagggcc     21780
     aagcttcttg ggccaccacc tgcaacccgg cagaacgaac ggggccagcc tctcctcctg     21840
     cggcaagtcc ggccttcatg gccacaataa cgcgggctcc cagttctttg cttttttccg     21900
     attgttcaaa gctgcgaaca atggcttcca ctacgcattt ggaggcgaga agatttccgg     21960
     tagatgcaat gttcacacca cacagatcag tgctcagccc cagcgctttg cttccggtat     22020
     acaccgctgt gcgaccttca cggtcaatta agctcatttg tcggtaatga ggaaaagtgc     22080
     agttgcgtac aatgatatcg cgcgcttctg tagccgacgc tcctgcctct agtagatcca     22140
     gtgcccatgg cccaaggcga ggatccgtta cattttgcgt tgtaacagct cccactcctg     22200
     ctcgtgcaaa cccacaacgc gcagcaacag aaggagagga tgaagataca gccaccgcga     22260
     attgtccact ttgtgggcag cgcgccacga ttgaaaaggt catggaagaa cccctttctg     22320
     aagagacata atctaaccag acagcaggcg tcaggtatga ccttacggtg ccaccatcat     22380
     tcccaaaccg aaacattgac ttttggaggt tgtgcttttg tttttctgat ccaaaaaata     22440
     tctaacgtcg ggaatgccgt ggggttcttt atttataaga agtttataaa gaggtaaggt     22500
     gatatcagtt ccgctctaga aatttactat aatatattta accttttcag gtagcccagc     22560
     atgccactaa agggttctaa aaaccctcct ttttcgatca cagtagattc ataactaatt     22620
     gatattacta ataatataaa agatcggata gagatttttc gagcccttca ggtggtgcct     22680
     tctatacaag tgctcgttgt aagatcgctt tgtttccggg ttcttcttcg gtggaatgca     22740
     gacggtaatg ttccgttcta tcagagatcg tctgatccag ttgcttcata actccaatcc     22800
     ccgatgacct tttctgttcc ttccagcagg accataagaa gaacatccgc cccattgagg     22860
     tatgtcgttt cgatcattag gagtgtgatt gaccagaccg ttcactaaat actgcaaata     22920
     cccagtcaaa aataccaaga aggcgccggc ggatgaaccg gttgtataag gtcttgtgcg     22980
     aaccatatgc ttccggcgcc tctcttcact gatggccgtt acgaatcaca taaacgatct     23040
     cacgcagaac ccgccggtca tccatgggta ggtaatcccc ccataaaaag agtgactttt     23100
     gaatgagaat tttctcagcg taagaattga ggagattctg atgaagagtg atcgctttac     23160
     tgacgcccag atcatgggtg tgatccgcca ggctgagggc ggtgtcccgg ttcctgacct     23220
     gtgccgggag catgggatca gcaacgccac gttttaccgg tggcgcgcga aatatggcgg     23280
     catggatgct tcgatgatca gtcagatgaa ggctttggaa gaggagaacc gtcggctgaa     23340
     gcgcatgtat gcggatttga gcatgcagac ggatatcctg aaggaagccc ttggaaaaaa     23400
     atgaagcggc cagcccagcg ccgggaactg gccgcacaag ctgtggcgca tcatggggtc     23460
     agcattgcgt tggcctgtcg gatttttggg atatccgaga cctgctttcg ctatcgtccg     23520
     cgactggcag cggagaatga caggattgcc gatcttcttg tgggactgac ccaggctcac     23580
     aggagatggg gatttggtct gtgtttcctg tatctgcgca atgtgcaggg acagctctgg     23640
     aatcataagc gggtttatcg gatctatcgg gaacaggaac tcaacctgcg gattaaaccc     23700
     cgcaggcgtc tggttcgcga aaagcctgaa aagctgtcgg ttccggccct tcccaacagg     23760
     gtctggtcca tggattttat ggcggacagg ctgatggatg gacgtgcttt tcggctcctg     23820
     aacattctgg atgacttcaa tcgtgaagga ctggcgatcg agggtgattt ttccctgcca     23880
     gcctgtcggg ttgtccgctg tctggaacag gttatggagt ggcgtggcag gccagaagcc     23940
     atccgaatgg ataatggccc tgaatatgtc agtcatacgt tggtttcatg ggccgaaaaa     24000
     caggggatta ccctgatcta tacgcaaccg ggtaatccgc agcagaacgc ctatattgaa     24060
     cgctacaaca gaactgtccg gcaggaatgg ctggagcagt atttgtttga aagcattcag     24120
     gacgtgcagg aggtcgcaac acaatggctc tggacatata accatgacag acccaacatg     24180
     gggaacagcg ggctaacccc cgcccagaaa ctaaaaacag ctgcctgaat tctcattcaa     24240
     tgccccacta aaaatggggg gattaccctt ccgctaatgt tgtaacggat tgtattacca     24300
     atatctcccg ttcctgtcgc gtaaagcggc accactggcg aaggctgagt tttactccgc     24360
     acagatcaag tttcatgcgg acaatcatgg gaatacagcg caacgatgtt gcaaaatcca     24420
     tttcgaaatt aaacaacact cacctattcc ttcatagcct catgtcagta tgcttgagct     24480
     tacaccggcg ccatggatgt cggagtcatc catcgttcaa gatcctgctg tcggacagtt     24540
     ttcaaccacc ccagatctgt catatcgctt atgatccatt ccagatcaga acgtactagg     24600
     ctcccccctg aaaatgtaat ggtttcactg gcattcccgc ctgggagaat ggtactggtt     24660
     gcctccatcg gaagacccag tcctccactt gccacatttc ggcccagatc ctgcgcaatt     24720
     tccattcgat gaacagactt ttggcagaaa tccagagagt cctgaatggc aaggcacaga     24780
     tttcgtgctg tatcattcaa attacgtagt ttacctgatg caacaagaat tttttcaaga     24840
     tgattgggca aaacagtgga ggagcctccc acacgaaagg caagtccaat acgttctgct     24900
     tctgtgcccc aaggcgaacc aacacaggca ccatcaatcg ctttttcggc aaaagcatga     24960
     atcatgtcag caggcggcat gacaagcagc tcgatctggc tctccatatg aattccaatc     25020
     attttcagaa atcgtcggag aataaggagg tgagtggaat acatatgcac aacagcaatg     25080
     cggggcttgc gcccaataac tgtctgccag atatcaaacg ccttccgccc ctcttctccc     25140
     ttacgccatg gttcacttat tggattaaca ccgcgcagca tgattgtatt gccaccccgg     25200
     ctaatcctgc ctaaggggtg taagcctgta tcatgcccac gccgacccaa cgctgtcatt     25260
     atggccagag gagcaaaaat aactgcagca tcaagacggt tccatgcaag accatctgct     25320
     atgttggccc atgatggaga aacaacaagt tcgacttcca gaccataacg ggcaaaaatt     25380
     cctttttgcc gagccataat gactggtgca ctatcagcca gtttcagcac cccaatgcgt     25440
     aatggtgtgc tcatgatgtt tcatcctttt tctgcgacaa tagatatttc tctgcaacag     25500
     ctacaatacg gcttgatgtt tgcatggccc gacgctggaa ccaccgatag gcttgagatt     25560
     cactggtttt ttcatttttc atgaaacatc tctttgcctg ctcaataatt ctgcgctctg     25620
     caagaacacg ctgtgcttcg cttagttcat cacgtgtgcg acgaaaacgc gcataaagtg     25680
     ctatggccgc acgcaaaagc ggtttgacat cacgcggcag cgcctccatg acgttgtacg     25740
     aacatatacc cgtatcaaaa gctgtttcca tcaactctac gtcgtcttca tcgacgaaaa     25800
     gcgcgactgg acgctccagc tcggaacagg acaatgcacg aatgctatcc agtgcatcac     25860
     ggtctgcccg gctcatatcc accaacacga catcaggccc ataatctcgc accgcatcaa     25920
     tcagcgccat gccacaaggc actgtctgaa catccaaaga agaatctgta taaagaactt     25980
     ctgaaagtgc ctgccctcgt cgtggatttt catctgcaac cagaactttc agatgcactg     26040
     ttgatgaaat tttctcatcc attagtaaac atcacgccgg taacggcctt cacgtgtcag     26100
     attgctcaca aatgtatcag cttcactcac ggaaaggttg ccatgtcgcg ccacaatccg     26160
     acgcaatgcc gcatctacat cccgcgccat acgtgttgca tcaccacata tgtaaatatg     26220
     cgctcccttc tgtaaccatt tccataattc tgcacctgca gcttccattt ggtcctgcac     26280
     atatatccgt tcgggttgat cgcgcgagaa agctgtatcc aaacgtgtca acactccttc     26340
     cgtcagaaaa gcagccagtt catcatgaaa ataaaaactt tcctttgcat gacgttcccc     26400
     aaaaaacagc caattccagc ctgttgcttt acgtgcggca cgctcctgca aaaatcctcg     26460
     gaacggggca ataccggtgc cagggccaat catgattatg gcaacatcat ctgctggcaa     26520
     ttgaaaatgc gtggtaggct gaataaaaac cggcacatct gctccctctt ccgagccagc     26580
     cagccagttt gaacatatgc ccggccaagg cgtattgttt acccctattg tcagttctac     26640
     cacacgcccg gatacgtttg gtgaggatgc aattgaataa aggcgtggtt gcatacgccg     26700
     aaacaacgtc ggcacttcct ccgctacaac tgataaagac gcatctttca gaagatgagg     26760
     tagaaaaccc ggcgcacagc tccccaatat cttcagcata gccgggttgg gacggcaaag     26820
     gtcaagatgt cttaccaaag cttcccttag ccctaccgtt ccacaaccac gcaaaacgat     26880
     agacgtatca tctggcagac gaagcgcacg cagaaccgtt tccacatagg gttcaggatt     26940
     actgggccat atccctaatg catcaccggg cgcccagttt aagtctgttc cacttacatc     27000
     caagccaata cgccgtgtat ctctttcaca acccacactg caaaggcgtt cattgataca     27060
     aagccgcgcc ataacaggcg cctcacgcgt tcccgatgca ggaaccaccg ctgttgtcgg     27120
     taaaggcaag gccgcttcat ccgtttttgt gcccgcaaaa gccttgagca taactgcacg     27180
     ccaagtttcg actgcatcct caaaatcagg ctcacattcc attcgctcca gcaatggtgt     27240
     tgcccccagt tcctgcaggc gtccatccaa cacgcgtcca aaaccgcaga aattcgcata     27300
     tgaggagtca cccaacgcca acactgaaaa ttttaggtct gatatgggtt ttttgtgttc     27360
     cctcaacata tcccaaaaag gaacggcgca gtctggcggg tcaccatcac caaaagtgga     27420
     taccacaaaa agggctaaac ctgagaggtc cctttttgca tcaaaagtat caagacattt     27480
     gctttctgct tcatggctgg cctcttgcag ccatgaagta attgtagttg ccagcccctc     27540
     tgtccgtcct gtctgagatg cccaccatac agtaatgcgc ggcgtcaata cggcttctgt     27600
     aatctcttcc tgaggcatca tagcaggatg atttacatgc gcacgactat acaagccggc     27660
     aagaatgcca ccaacccgtg catgtatttt aggaggaagc ggggctgatg ccggcaatat     27720
     gggcacttct ccaacattcg gtggagccat ctcaagcccc tccagaaaac ccgaaagcca     27780
     tgcccgtgca tcttcgggta aagatgcgat aaccgacttg tctgactgtt ccagaccgag     27840
     atgggtgctg agagtgcgca tcatcatgtc agggtgtcct ttcctgatcg gttccgcatc     27900
     atcggtattt tgatatacgg actgttccac gcgttccaaa gcaaccgcgc agagtttgaa     27960
     accgggttgt aacgatacag ggtcaacagc atcgggggtt atggcattaa ctgtcagatc     28020
     ttccccaaat cggtcattcc agtggaacgg agcaaaacag atgcccgact gtatccgtgt     28080
     ggaaatctgc actggcagaa caatccgccc ccgacgtgat gtaatctgca catggtcatc     28140
     ttgctgtagg cccagtgtca gcgcgtcctg cggtgcaact tccacaaaag gtccgggatt     28200
     aagccggttg aggctatcta ccctcccggt tttggtcagt gtatgccatt ggtgctgtag     28260
     gcgaccactg ttcagcacaa atggaaactc ttcatctggc cattctgatg gtcgcatcca     28320
     gggccgagcg aaaaagaccc cttttccatc cgcagtcgca aatactgggt catgcccatc     28380
     tggcggaaga tagcggattg gatgcctgtc ctgctgatct cccgctggtg ctggccattg     28440
     cacaggccct ttgcgcaacc gtgcatgact gatgccagta atatcatagc cggttttgga     28500
     gttgctaaag cggctggcct ctgcaaacac atctgccgca gatgtaaacg caaaatcctt     28560
     ttcaaacccc attgcacgcg ccacacgggc aataatatcc caatccggca gtgcttcacc     28620
     cggcggcgga acagccttgc gggcaagtgt catggtgcgg tcagaattaa cctgcacacc     28680
     gtctccttct gcccacaaag cggcaggaag cacaatatcg gcaaaatgcg tagtttcact     28740
     atccgcgaac gcatcctgta caatcacata ttccgccgct tccaaggctt ggacgacatg     28800
     acgccgattg gcaacagttg ccacagggtt ggtgcagatt acccagcatg cttttatttc     28860
     accacgctcc attgcctcga acatggcaat gacaccatta cctccagtct cacgcaaagt     28920
     gcctggagct aaagaccact gcttttctac aaaagcgcga tcagccgcta caagagcact     28980
     acgctgcccc ggcaggcccg gccccatata ccccatctct cgtcccccca tggcattggg     29040
     ctggccggta agtgaaaacg gtccgcttcc ggggcggcat atggcaccag tggcaaggtg     29100
     gaggttacac agggcatttg tgttccatgt tccggcaatg ctttggttca ggcccatggt     29160
     ccacaggctc atccattctc cggcttctgc tatccaacac gcagcagtta gaatgtcttc     29220
     aactgccagc cctgtaattt cagccacagt ttgaggagca tattcttcca gaaaagattc     29280
     catcgcctcc caccctgttg tggtttgggc aataaaatct ctgtctattg catcattttt     29340
     taccagaagg tgaagcaggc cattaagtaa tgccagatct gtgcccggac ggatgggcaa     29400
     gtataaatca gctttctccg ccgtcgctgt ccggcgtggg tcaacaacaa tcagcttagg     29460
     gcctgttaga gcttgatcca gtctgctgcg gcagcgatgt ggatgaccgc gaggaacgac     29520
     gttgctgttt tttcatatct ggttgcgaca gcgcgccact ccttgaggcg agcccagagg     29580
     ttctcaacga gatgccgaca ccgataggcc catttggggc aggcgaccgg gccatcgcgt     29640
     cgtttcgcgg gaatggctgg ccgtgctccc atgtcccata tccgttcacg catggcgttc     29700
     gacgcgtagc ccttgtccgc tactacccac aggggagtgg cgggaaggct gtcgagcatg     29760
     gctggtgcca gaggcagttc atgagcctgt ccaggggcca gcgcaaaacc gaaggctttt     29820
     ccatgtccat cagcgatcac gcagactttt gtgccatagc caccgcgaga gcggccaagt     29880
     gcttcacgat ggtctcgctc ttcgaaagag gccccttttt ttgggctccc gccgctttgt     29940
     ggtgagccct gatgtttgtg ccatccagaa aagtcattcc gaatgccact ccctgttgtt     30000
     cctgaaccag tgcgagcagc cgctcccata cgccgagctt cgcccagcgg atgaaaagct     30060
     gcgcagcccg ccaccacgga cccagttcag cggggatact ccgccatttc gcgccattct     30120
     catgacgcca gaaaatcgct gctatcgtcc gccgcagatc atgtggcggc gtcttgcccc     30180
     tcgggcgaac ctcctcaatc agaggttccc agatcgccca tgtctcgtcc gtaaaggtgc     30240
     ctgttctgtc tccttcttcc atccctacaa tatgggaaga aattcaagat ctaacaggcc     30300
     ctagccccgg cccgcttgcg atccatcaaa cgcaaaaaca ggataggatg gcaatcggcc     30360
     atattggcac cgataacaaa aaacagatct gtgcaatcga aatcttcata actgccaggg     30420
     ggggcatccg ccccaaggga aagtttgtat cctgttccgg ctgcggccat gcagaggcgg     30480
     gaattagatt caatatgctg gctacgaaca aatcccttgg ccagtttgtt aataagatac     30540
     tgtgcctcta gcgacatctg cccggacacg taaaaagcaa ttgcatcagg cccgtgtgta     30600
     ttcaggattg tccgcaatct tgccgcagtg tccttaatag cctgttgcat tgctacagga     30660
     actgcttttt ctccacgttg agggcggatc agcgcctgat gcaggcgctg atcggaaaga     30720
     agaggtttgt cacaggaact tcctttggtg caaagacggc cgccatttgc aggatgtgct     30780
     gtatctcccc gcacctttgc aatacggtca ttctccactt ccagtataat cccgcatcct     30840
     accccacaat aagggcaaac cgtacggact tcttcccgcg ccataattag gtcaggccaa     30900
     gagagtttcc ggcgtatatt cgtttatttt tgcccggatc atcactttcc cattttccaa     30960
     acgggcatcc catgtccgta aacggatagc cgggtcttcc aggcactgcc catcctccaa     31020
     acggaagtgc tgcttataaa ggggagatgc cacaaccagt tgccctttca gatcccccat     31080
     aatgccgcgt ccaataacat tggcattcga aaatgggtca tggttgtcaa tcgcatagac     31140
     ctgcgctggt gcaacctctg tttctggcaa gtagaataaa gctatctgat taccatcata     31200
     ccatgccaca acacctgatt ttgcaaccag atcatcccct tggcacaatt ctgtccattc     31260
     tatcgggcct gctgatgatg tggtttctgg caaattgtct gccggacgaa cctgatcacg     31320
     ctcggcaacg gtacgaatat tcggatccgg ccgccgatca ttaacgaagg tacggaacct     31380
     cttgagtttt tcgcgatctg tcagcgcatc gcgccattca cagtggtagt tatcaactac     31440
     catctgcatc tgtttctcta gttccgtaca aatacccaaa ctgtcagcga taataacttc     31500
     acgaagataa tccagcccgc cttccaggtt ttcccgccat acagaggtac gctggagctt     31560
     atctgccgta cggatataaa acatcaggaa acgatcaata tatttcacaa gtgtttcaga     31620
     atccagatct gttgcgaaaa gttccgcatg gcgggggcgc ataccgccat taccgcaaac     31680
     ataaaggttc cagccatttt ctgtggcaat aacaccgaca tccttgcttt gagcttcagc     31740
     acattcacgg gtgcatccag aaacggcaaa tttcagttta tgcggcgcac gcaagccttt     31800
     gtagcgattt tccaggtcca gcgccttacc cacgctatcc tgcacaccat aacggcacca     31860
     cgtgctgccc acgcaggact tcaccgttcg ggtggatttg ccataggctt gcccggtctc     31920
     aaacccggca tccatcaatt cgctccagat atcggggagt ttgtccagtt gcgcaccaaa     31980
     cagatctata cgctggccac cggtaatctt ggtataaagg ccgtattttt tggccacctg     32040
     ccccagaaca atcagctttt ccggtgttat ttctccacct gcaatacggg gtaccaccga     32100
     atatgttccg tttttttgca tattggccat gaatgtatca ttcgtgtcct gcagcggaat     32160
     atagagaggg tctgtaatag gtttattcca ggccgaagca aggattgaac caaccgcagg     32220
     tttgcagata tcgcaaccca aaccgccatt gccatattgc gccataagat cctcaaacgt     32280
     ctgaatccca tgcacacgga caagcgcgta aagatcttgg cgtgtatagg aaaaatgttc     32340
     gcataggcta tgatcaacgg taatgccgcg tgcttccagc tccgtttcaa atacattttt     32400
     aagcaaagct gaacatccgc cgcagcccgt actggctttg gtggattgtt tcagccctgc     32460
     caagtccgta cagccgttct caatggatgc gcagatcgct cctttcgtca cattatggca     32520
     cgaacagatc atggctgtat caggcagcgc atctgctcct agcagatcag ctccttcccc     32580
     ccgcggcagg atgagtgccg ctggatctgc cgggggttta atatcattct gtacacattg     32640
     gagaatggta tcataatagg cattgtctcc cacaagcacg gcaccaagca catgatgccc     32700
     atcttcagac aacacaaggc ggcgatagga accgtctatt tctccaataa atctgtaact     32760
     gcggcacccc ggtgtacgac cgtgtgcatc tccaatagag ccaacatcaa cccccagaag     32820
     cttgagcttt gtggacatat ccgctccggc aaaggccacc tgctcccctg ccagtatgga     32880
     tgccaccgta cgggccattg tataacctgg ggcaaccagc ccaaaaacct gcccattcca     32940
     gcaggcacat tccccaatag caaaaatggc tgcgtcagaa gtacggcatg tatcatcaat     33000
     tacaaccccg ccacgtgacc cgatagccag cccacattca cgtgccaaac ggtcctgagg     33060
     acgaatgccg gcagaaaaaa cgaccagatc cgtttccaga aacgttccat cggcaaaaac     33120
     aagcctatgc ctgtagtttt ctcctgcaac aatttcctac gtggcatgtg cggtgaggac     33180
     attgatccca agggcttcaa tccgctgttt caatgcctgt ccgccatctt catcaagttg     33240
     caccggcata aggcgtggtg caaactccac cacagcggtg gacaaaccta gcccagccaa     33300
     tgcatttgcg gcttccagcc caagcaggcc gccgccaata accacaccat gtgtagcgcc     33360
     attggctgct gcccggatca tgtcaagatc atcaagtgtc cgataaacca gcccggctgt     33420
     accggtgtta ccgggtatgg gcggcacaaa tggcgtagag ccggtggcaa gaataagcgt     33480
     gccataaggt agaacgccct cgatgctttc aaccgttttg gcatcacgat caatatgttc     33540
     caccctcaca ccacgatgga gtgtcaggcc atgatgtgta tgaaagtcgt ctttatgcag     33600
     gcgcaatgcc aatgcatctt gcccactcat ataatcagtg agatgcacac gatcataggc     33660
     atcgtgaagt tcatcaccaa aaatatggat agcgtgtgtt ttatgcaaac catgcgtaac     33720
     aagctgttca gcacagtaat gccccaccat gccgttaccg ataatgacaa tgttttctgt     33780
     agtgatcatg accgtctctc ctattgtaag gcttggcatc agaatttgaa ttccatggtt     33840
     tgcatataaa aagcgccatc ttttgccccg gcttgtctca tgccattcga ggccacaaat     33900
     ccggcgatat catgtgtcca ggtccaatgt ggcgcaaagt tccatgcaat ctgtgtttgt     33960
     ggtgtggccc caataaaccc accagaaaga ttgttgcgcc atgagtatat tttgccagtt     34020
     ccataaacag catcctgcgt actttcccgc cagaagaccg gcacatgcaa tttgagaagc     34080
     agatgaggaa caggcgtggc cgtaatgacc ggcccgacac caatcaggtt ctgagatgtc     34140
     agggcaagcg tgacatcatt ataataaggg aaaggaaaat atggggtcgc aaatgttcca     34200
     acagcaccat ccttgctatg ataggacccg ccagaaaaca tgtctgcctg caatgaaaaa     34260
     gacggtgcag atttcagatt ttttgctgtc caaccaaata caccattaac cgcacaggca     34320
     cgaactgcac gtgttgcccc ctgactggct gccgggcgaa actctccccc ctgaaacacc     34380
     cctgtcaggc tcacattaaa tggcccaaca ttgccccaga tacgtgaacc aacattatcg     34440
     cgccgggttg aaccactttg tgtgcccgtt gttgtggaaa tagccgcagg tgtaccgtta     34500
     aatagatacc ctatgaaaaa aacatctgca aaaatctggc ttttttgtcc cataacggta     34560
     aagttgggca gtgctgtgga tgtataaatg ccatacatgc gggcattata atttgtacca     34620
     tccgcaaaaa cgttacgagg caacttgttt gtttgcatga aatcaaacag atccatgcgg     34680
     aatgatttcc aaaccgcata tccacgaaat ccatcccatg tttgctgggc attcgtcaga     34740
     tctcgtgacg actgcatgga caaaggagca tcaagaaaaa cttgcctgcc ccctattgct     34800
     cccatttttg cgcccagcag gttgccttta acttccaaaa tgccttgttg aagatccaac     34860
     cgttcgcgct gaacaccagt ttgatagccg taataattgg aaccaccagc cacgccccaa     34920
     agaaattcgg catatgcacg aatatgttca ccaatatgca gatctgcacc atactggtta     34980
     cggagtagaa cacggtttgc attggttttg ccggcagtgc ccatcatggg ctggttttca     35040
     aaaatatagc gtaagcgttc ttctccgttg atcgatagcc agatatcacc attatctgtc     35100
     agcggaatgt atttcagacg gttaaaccag tctgcacgcc tttttgctgg ggacatggtt     35160
     gccaagtcac tccagtcttc cgcccaacgg ggctgcccag gcccccctat gatgccaaaa     35220
     ccggaggcta cacctttacc tgtattaaat actccccaat ctggactatg tggtgttgaa     35280
     ttggaataag gcgctttctg tttgagcgca ggcatgatgg tgcttttggc aagaacctgc     35340
     gcattcgttg tctgcttgtt tgcaggctga gcattatctg cccaagctgt ctggtgcagg     35400
     cacaatcctg ccagcatagc caccgatgcg gtagaaaaag aggccgaatg ggacgaaaag     35460
     aaaatacggg tcacagcagt attccggctc tggtaggaag ggaaggatta cagggcacca     35520
     ggagcatttg ctcccgtcgg aattccgttg cttttggcca tccagcgccg acggcaaaaa     35580
     ctgacacatg caagtgcagc cagcgcaata acagcaaagc acaaaaaccc tgggccataa     35640
     gagcccgtca tctgccgggc tgcgccaagg gatgacgcaa gatagaaccc accaacacca     35700
     ccgctcatac ccaccagacc ggtaagaatg cctacacgcg ttggaaaacg cgtaggcaca     35760
     agctggaaca cggcgccgtt tcccaaaccc agcacaagca tgccaagaaa aaaggccgga     35820
     aaagcaagcc agattgtagg aagcccgacc ccgatcacgg caaaaatgcc cgcagcaagc     35880
     gtatataaaa tgctcagcgc gcgttcaccg ccaatatggc ccctcccaag gggcgcacga     35940
     acgaaccaac aaacacaacc aaagctgtgc aagtacccgc aatagcggga gacagaccat     36000
     attgatcgtt aaaataaatt gtcagaaatg aagccagccc gacaaagcca ccgaacgtaa     36060
     caccgtagaa gaacataagc gcccaacaat cggcattgcg caaaacaggc agccacgttg     36120
     tcaatccgcc accaacccga cgttctggtg gttcactggc taaaaagcaa aagacaatca     36180
     acacagccat caatggcaga gttgccaacc ccagaacatt aacccagccg taaagtgcag     36240
     ccaggccggg agcaaacaag gaagcaagcg cagtgccaga attaccagct ccggcaatcc     36300
     ctagcgcagt tccctgatat tgtggtggat accaggcaga agcaagggga agagcaacag     36360
     caaatgatgc acctgccacg cctagcacca gcgctacacc aaacagcgct gcgtagctgt     36420
     gtggagctac aagccatgta acaaacagcc ccgcgataac aaatatctgt gcaccaattg     36480
     ccacacggcg cggcccaaaa tgatcaacca gcgcaccagc aaccacacgt aataaggcac     36540
     cagccaaaac aggcgtggcc accagcagtc ctttttggcc agcattcaga tgcagatcat     36600
     gtgcgatcga aatacccagc ggccccagaa gaacccacac catgaaggag acatcgaagt     36660
     aaagaaaggc cgcaagcaaa gtgcgcggat tacctgcttt aagaaatcct ttgtccacgt     36720
     catcgcatcc agtctccgtc attaacatga acggaaacgc ctttttcagg cacggagacc     36780
     gtcgttggcc gtccgggtat cgtcgtgacc gatgccgtca tttccctatc attcaccgcc     36840
     attggcaaac gaagtaatga gaaatgtgct tcctttcatt cgcacataca acgatacgat     36900
     gtcaaaacat tttaacagca tgctccatct ctttatgaag cctgcttttg aagcaacgtg     36960
     gcataatcac ttcttgatgc ggctgaagag atcgaaggtg agactttcga actcctgcca     37020
     tcttttaggc ggcaggaatg gacgggaaag aacgtcagtc ataccgatga ctttagacgt     37080
     tcgcggttca atcgcgctca ctatcatcta aaataaaatc caaggaactg agatatttat     37140
     gtccacttta caagatatat ttatcatcat gtcatctctg aacgggcaaa tgataattta     37200
     tttacgaacc accaaatatt ttcccaacaa aagttgttcc caccatagcg acaatacccc     37260
     aaaatatgac acgcaaggta ggccgcaaag gtgcagcacc acctgcacgg gctcccacaa     37320
     ctccaagtaa cgccaagctt ataagtgaga ctgcagacac agcccatgat acaatagatg     37380
     aagatgagag taatgcagcc aacaccggga gtattgcacc agacgaaaat gccccagccg     37440
     atgcacaggc cgcttgtatt ggtcgtgcag atgttgcatc ggaaataccc aattcatcac     37500
     gggcatgtgc ccccaatgcg tcatgctgca tgagctgctg tgcaactgtg cgggccagag     37560
     catcatccag cccacgctgg cgatatatat cagccagttc gccaacttcg gtatcccaac     37620
     tgctaccgag ctcctgcttt tcacgagcaa gatcagcttt ttctgaatct gcctgcgaac     37680
     tgacagaaac atactctcct gcagccatag acatggctcc ggccactagg cttgatattc     37740
     cagccagcaa aatattttcc cgaccagcat gtgcgctggc aacacctata ataagactgg     37800
     atgttgacag aataccatca ttcgcgccca acacagcagc ccgcaaccat cccaaacggg     37860
     atgttgcatg cgtttctttc tggctgttca agatattatt ttccatattt catcaagaac     37920
     acaatacacc accaacatga cgcaaacctg aacgcgttac tgtcaggttt cttcagacag     37980
     caatatgatt tctgggttag ggaaacacag tgaaacactt aatccccgcg cagaaccagt     38040
     aagaggtgat tgtaattgca agcgcgcatc catctgcctg gcaatattac tggcgattgc     38100
     taaaccaagg ccgctgccat tgctggaact gccaccacgc acaaatgggc ttgtcagttg     38160
     ggccaatgta tccggggcca aggcaggaca atcattaata acgtcaatac agccctcagg     38220
     ttttacctca acctttactg gcatatcgga agtgccatgc aagagggcat tttcaagcag     38280
     attgcgcaac agaataccgg ttgcgtccat atctccataa acaaaaatat gtccaatacc     38340
     cttggctttt aaattaatac tccggccatc acgtggtaga tgccccagat catcaaccag     38400
     cacatataat acggccagca gatcaaaacg atctcgccga aaagcaacgc cagaagatgc     38460
     acgtgaaaac tgtagaagtt tttcaaccgt tcgggccaat ctctgggtac gatctgctat     38520
     aatttccacc cgcttattag ccgaagatcc ttcaggcagc atacgcccca gcatctgcac     38580
     ctgcgcaaga agggccccaa gtgggttacg caattcatgc gctgcacttg ctgcaaaagc     38640
     gcgttcagta gaaagtgctg ttttcaggcg ggatagaagc gtgtttacgg catgctggat     38700
     ggaaaccagt tcgaccggca aatcaagtga tgaaataggg cttaaattgc cactgccacg     38760
     agattgcatt tcatcatgca aacggttcaa aggccgcaag gcacgacgta ctattaggcg     38820
     caccaacacc caaattacag gcaaaaaaat cagtatcggc aaaacggcca tagccgttgc     38880
     gcgccatgtg gcccctcgcc gatgcaacgt gggctcccca accagaacgc gataagccgt     38940
     ggccgtaggt gctgcaatat aaaccctaaa caaaggcgta ttagaaaaac ctgtatgaat     39000
     atcaggcaca aaaggatcaa ccggtgcatt ttgagaacgc agaacaacat ggccagattg     39060
     atcaacaacc tgatacgcga gtgttcgtgg ccccacatcg ggcacccatg ccacgttgtc     39120
     tgactgggct ttatgcggct gtatggtgat gatagcctgc aaacgttcgg atacttcctg     39180
     caaggaattg tccagacgtt ctgttatttc gtaacgcgta aaaccggcaa ctgcgatact     39240
     aagggcaaga aggctcagcg tgaccacgca cagaacacca ctgacaatcc gggtcgcaag     39300
     gctccagttt ttcatgcgtc tgctctatcg gccaggcaat agccccggcc acgcacggtt     39360
     tttataaccg tattgccaac ctttttacgc aggcggctaa taaaaacctc aaccgtatta     39420
     ctgccaacat cctgatccag cgcatacagg gctgtatcaa tctgctggcg ggaataaatg     39480
     cgtccgggcc tgcgagacag caattccatg attgcccatt cccgtgctgt taactcaagt     39540
     tccatctcgt tacgcgttac ggaacgattt tcccgatcaa taacaatctc acccatctgg     39600
     tagcaggcct gcctgcgtgg cgcgacatac cggcgcgcga ctgccgcaat ccgcgccaca     39660
     agttcattca ggtcataggg tttgacgatg taatcatccg ctccatcgga caaacctgcg     39720
     atcctgtcac tgatctgatc ttctgccgtt gtgatcagaa tggcggtatc aaaggacgtg     39780
     cggcggatct cgcgcagcag atcgcgccca ttgccatctg gcagcccaag atccagcagc     39840
     atgaagtcat aatccacggt ggctacagct gcgcgtgcat cttccagtgt catgaaccag     39900
     tccacagcat gtccatcctg ccgcacacgc tcctgcacgg ctgccccaag atcgtgctcg     39960
     tcttccacaa tgaggatacg catcagttct gaacctcctc tcgcatgaca cgagcataca     40020
     gggatggcag caccagcaga gtgagcagtg tggatgtcac cagcccgcca atcactacac     40080
     tggccaaagg ccgctccacc tctgcgcctg cactttcaga aaacgccatg ggaaaaaagc     40140
     caaggcttgc taccaatgct gttgccataa ccggcctgaa gcgggatttg gcacccgcaa     40200
     aagctgcctg tgccacggcc atgccacgcg cgcgcaatgc ggcaatttca ctcaccagca     40260
     caacgccatt caaaattgcc accccaaaca gggcaataaa cccaatacct gctgaaatgc     40320
     tgaagggcat tccacgtaat gtcagcatca taatgccgcc ggttgcagcc acaggcagat     40380
     tgataaaaac cagaagtgcg ggccggattg cgccaaaggt tacaaccagc aatgcaaata     40440
     tcagaccaag ggcaatcggc agaacaattt ccagacgttg aacggctgag tgcaggttac     40500
     ggaactgtcc atcccattgc atggtataac ccgatggcag atgcacatca tgcgccacac     40560
     gcatctgcgc ttcggccaca aaggaggaaa gatcccgccc acgcacattg gcctgcacca     40620
     ccatgcgccg gcgtacacca tcacgactga tacgtggtgt accgtcaact tcatgcacat     40680
     gcgccacttg tgaaagcatg acattcccct gcccatccat acgccggaca ggcaaggcag     40740
     caatagctgc tgctgaagcc acatggcggc cgttcaggcg tacctgcgtg ctgataatgg     40800
     cattgccaac gataacaggc cgcgcaccaa tatgcccgcc tatggcttct accgtatcca     40860
     gaatatcctg tactgccacg ttgcggctgg cagcctgtgc gcgatcaatg tccaccacaa     40920
     ccagcggcac acttccatca tctgccgcag ccacatctgc agcacctttt acacttgaga     40980
     tagcagctac aaccttgtcc cccagagtgg cgagtgttgc cagatcatca ccaaaaatcg     41040
     aaaccgcaat ctgtgttctt actccagaaa gcagatcatc catgcgcatc tgcaccggct     41100
     ggctccagga atacagcgca tctggcaatt ctcgccgcag tgtctcatcc attgcagcca     41160
     ccaacccagc ctgcgtgcgt gcggttttcc atgttgatgg cggattgaga agaatgaaac     41220
     tgtcagtctc attcacaccc atcggatctg tgggaatggc ggatgtgcct gtattgctga     41280
     caaccgtttt gacttcagga aaaccccgca gaatctgttc ctgtcttgtc accgatgcaa     41340
     gtacagtctc cagagatgct gagggcagac gtgtggtggt aacagccaaa gccccttcat     41400
     caagctgggg aatgaactcc ccacctagac gtgttgcaag acctgccgat aacaccagaa     41460
     cagccagcgt gcccccaaac agaagctgcg gatgtgcttc tccccactct gtcagatgta     41520
     catatggagc acgcaggcga gcaatcagcc atgtatctcc ttttggccgc acacgtgcca     41580
     aagccagagc cgcaattacg ggaatacaga tgaagcagta agccagcgaa gctagaagcg     41640
     ccatgataac cgtttgcgcc ataggccgga acatatgccc ttcaatgccc tgcagggtaa     41700
     gaataggcag atagaccata ataatgacca gtatggcgaa gcccacaggc cgcatgacct     41760
     gctgaacgga tgagacaacc agcggcataa acgcggcttc cggctcctcc tcccgccttg     41820
     aaagaatatg ctcaataact accaatgagc catcaacaat catgccaaaa tcaattgcgc     41880
     caaggctaag caaattggct gaaatgccaa aataccgcat gccggccatg gcgcagacaa     41940
     gagctactgg aataacggag gcaatcacca gagcggcctg ccagcttccc atcacaacca     42000
     caagcaccgc tatcaccagc acggcaccca tcagcaggtt atcgcgcacg gtcgcgattg     42060
     tttgcccggt taatgtggcg cgggtgtaat agggctccag cgtaacaccc gttggtaagg     42120
     attgccttat gcttggcaag gcacgattga tggcagccaa tgtggcgttg gaacttgcgc     42180
     cactttccat catcaccacg ccaattacaa tttcaccctg cccatcacgg gtaacagcgc     42240
     caaggcgtgt gcgtgcgcca gttgtaatgt gcccaagatc tcgcaaacgt atgatggagc     42300
     catcggcatt ggcgcgtacg gcaatgttgc caaaatccgc aaggctgctg atcaacccac     42360
     gcccgacaac actttgctgt tcggcatgat gggtgatcca cccaccgcct gatgccgcat     42420
     tgtttgcatc cactgcgcga taaacctcac tcactgaaag gttgctggca atcagccggg     42480
     caggatccag tgcaacctca taggtttctt ccgcgccacc attgacgttt acatccacaa     42540
     cacccggcac aagccgcatc tgcgggacta ccgtccaatt cataatccgg ttgagttcca     42600
     taagtgagcg ccctgctccc ttgatctgga actgcatgat ttcacccatg cccgttgcaa     42660
     gcggccccat gcttacggtg atacccggca cagatatgga accccgcgcc tgctggatgc     42720
     gctcattcac acgcgtgcgg tcaagattga tatccgtgtc atcagcaaac tgcacataaa     42780
     caaccgagac cccaccacgg gaaacagagc gcagatccgt cataccggga ataccggtca     42840
     tgctggcttc aaccggaaag gtgatcagtt tttccacttc ctcggtcgca aggccgggtg     42900
     ccacaacgga tacgagaacc tgctttggtg aaatatctgg tacagcctcc acaggcagtt     42960
     ccagcactgc catcatacct gccgccaata tcagagccag tccacccagc accaacatgc     43020
     gggcccgcag caaagcctcc aggtatttac gggccatcag tctgcgtcca ttccggccag     43080
     cccgatgatt gatttcaggg caaaactgcc gtggctgacc actgcctcac cctctttcaa     43140
     gcctgagctt acaaccgcat gcatgccatt atccaagacc acatccacca ccacaggccg     43200
     gtaatgcgtt ttatctatct gcacaaatac gacgttatgg acatcaattt tctgaatggc     43260
     atctgacggc acgaccattc ccgttacact gtcacgctcc gtcaggctgg catccagcac     43320
     catgcctgga accaacacac cagttgggtt ggaaacacgg ctgataacac gcaccaaccc     43380
     tgtttgcggg ttggccatgc catccactgt atcaatccgg gatgtgatgg caccatcgtt     43440
     ggtctctgtg gtctgtaatc caccgggctg aagacgtgct gcctgttccg gcgtaatgtc     43500
     cgaaacaatc cacacgtcag acagatctgc tacgctcgcc acgtttgtgg ttggcgttag     43560
     gtctgcggca acagatgtat ccagcgtttg caccatacca tcaaccggag agatcagggt     43620
     tgatacctca tcctgctgtt tccgactgct ttgttcagaa gatgaattga actcctcatt     43680
     aaaccgatga cccaatgtat ccacatctgc ctgtcgggca cgcatggttg catctgcctg     43740
     cgccagaata tcctgcctgc ggcgcagctc tgccaatgaa agagtttgac caaccagttg     43800
     ttttgcgcgc tgcactgcgg ctgcggcatt atttctactg gcaatggcag ctgttaacgc     43860
     ggcacgcatt tgaatggctt gaagccgtgc accatggaga gaatgatcct gatagcgcaa     43920
     caggacctgt cctttacgga ccgaagcacc tggctgcacc aaaacgtcca gcactttgcc     43980
     gcttccggct ggatgaatat acacaagccg cgtggtatcg ggcataaccc ggctgataac     44040
     tggcagaatg cgagaaacct taccggattt ggcaaaggtc actgtaatac cttcattttt     44100
     tatcgctgcc atatctagcg cgacaaccga agggagtatc tgatcttccg cattggcgag     44160
     aggtgacata caaaaacaca cagcgaaata cgcaaggatg cgtcctttca tggtgtaatc     44220
     cccatggcaa tcatcatacg cagcgttgcg acatgccact ccacctctgc tcgagcgttg     44280
     gcaaattgcg cattgcaggc agcctgttct gcctgcatga cagtttcgag cgttgcctct     44340
     cccacccgcc aggcatgctc ttctgccgct gcacgctttt gcatatttgc cgcggctata     44400
     cgggtggtct gccgggcagc tgtggcggcc atcagccgag cccgcacacg ggatatttcc     44460
     agatgtacca tgcgccgggc ctgtatttcc tgactattgg cagaagcaag cctgttgctg     44520
     gcctcagaca taatcggtgt attccgggcc tcgcttggta gtgggatgct gaagttgaca     44580
     ccaacccggt catcccatgg gctgccatac tgtttttcat gaatcacatc gatacccagt     44640
     tctggattgg gcataaaaga gcggcgggca agcttcatat tagcttgtgc agcttctaca     44700
     tttttgtgtg cggcttttac gcgcggatca ttgtcttcca tatcacgcgg ttccacaaac     44760
     cgcacatgtg ccatatctgc accatgagaa agatcaacct caactggctg ggcaaataaa     44820
     acttccagtt cagcctgaga attttccaga tattcttgcg ccaatgcctg ttcattacgg     44880
     gcattttcca tttctgactg tgctatctgg ctttccgaag atgaagattc acccacatgc     44940
     gcagaatggg caatcaaact gtttatcctg cttgcatact catacagttg atgtgccgcc     45000
     tttaaacgtt cctgcgcaat ctgtgctttg gctgccccat ccaataccct tatggaaagc     45060
     gacaggtatt caacatttag ctgctcatcc agagatgcgg cttcagcact tgcaacctga     45120
     cgtgtggcac ttccctgccc tggtaaccag agtggtacgg acacccctcc ctgataagta     45180
     gtgtaccctt cattactccc gattgcatgg tcatccatat attcaccgga cagagttggt     45240
     ccgccagcaa accatgatcc tgccgcactg ctgcgcgcct ttgcagaatg atggccaacc     45300
     tgcaattcag tgcgcacagg atcaaccgcc caagccatat taacggctct atgaaaatct     45360
     attttttctg gcatgttctg ggcatttgca gaaaatatgc cgaacgaaaa tgtcacaata     45420
     cttaacagca ggatttcacg catgaggtta cacgcagcct cctacggaat aatcggcttg     45480
     ttatgcgtaa ttcgggaggc gaggtcattc catagattga ccgttgccaa gttgatgtcg     45540
     ccttttatgg atgaaggtga ctgggtgcgt gaaaaagacg tcagagccat gcgttcacca     45600
     atcacaaaac gcccttgcga aaataatgtg acggaaagcg atcccaacct cccctgcccg     45660
     gccggacgct tgatagacac ccgcatatgt ggtggtggca cagcaatggc gtgaaatgcc     45720
     tgaagttctg tttctcctgt agggcaggca acgctttgca aaactgcatg ccgtaaaaca     45780
     gaatgtggat agcccgcata tgagccatct atatgcagaa gaataccttc ttccgttccc     45840
     ttacagatac tttctgtttc ggtataagag acacatccgc acaggctgag tgttatcaga     45900
     attgacaatc cgtaacgtat cacccgttgc ataacctgta ctggccttcc taatacgatc     45960
     acagcacgcc atcattgtgt tggcgtcttt gcccctataa cgcgcaaaga tgacgtgaac     46020
     ctgaatggcc accagacaac ggtttctacg gagaaagaaa atttctcatc acatcgctca     46080
     gcttcctatt ccgagtatcc aggctttggt cacggaaaca gtggccggca tccatcgagc     46140
     ttcaggaaaa ggaatgcctc gtcaggtcaa agtcctgatt tttgcaaaaa tcagaattta     46200
     ttataagaag gatctatatt ttccacgcgc aacccgcgat gcagtgcttt cactaatctc     46260
     atagaaagct gcaatagatt ttaaagtttc accttttaag cgtctatcaa taatttcctg     46320
     tctttggaca tctgtcatgc gacaaggacg tcccattttt tcccttgccg gatcgctcga     46380
     atgcgtcctt ctgatgtacg tgtacgaatt agatcgcgtt ccacatcggc aagtccaccc     46440
     aagactgcaa gcataagccg acctgtacta gtagtagtgt cagtccatgg ttctgctagc     46500
     actacagttg cattttgtgt cgtgagtgag cgcggatagc actggcctga tgcgttcgtc     46560
     gaaagacgga ccatctgagg atgtgagaga cgggtagtct gcgttgtgca agttttacga     46620
     cgaggcgcct gatctcctga atggaccagc ggacaaggac tgtcgtgttc tgagttgtgt     46680
     ttttttcggt ttcagtgagt ttgcctggta acggacactg gccatgacgg cataggccag     46740
     catgaccaga gagacatgcc gatgccaacc atgccaggag cgggtctcgt tatgatcaag     46800
     accaaattcg tttttggccg tctcgaaccc ttcttcgatc ctccagcgcg tcccttcaac     46860
     gttcaccagt tcctgcgtgg ttgtcccttt cgggctccag gtcgtaaaat aggcaaggtc     46920
     cccgtcagcg atgtttcggc ggatcaacag gccacgtgtc catggtccgg ctatagggca     46980
     gtcaaattct tcagcatcca gatcagcaag cggaagatac gcccagtcat aaagtcgctc     47040
     accttttgtg ccgtgccccg ctgacagacg acgccaggcc tggtctggca gtcctgctgc     47100
     aatatctttc gcctctccgg caatcagcgg ttccgttgcc catgatccga accagtgatt     47160
     gcccttgacc ccaagcacat atccaattcc tgcccggcga agcgtgcgtt ctacgtcgcc     47220
     cacgccatac acgctgtctg ctgcaaccca gcggaacggc acaccggcct caatacttcg     47280
     ctcaatcatc atcgaggcta acgccggttt ggttgcaaac accacgtcat cgggaacgtg     47340
     ggcccgcttc agacgctcag gctttgatgt ccagtctttc gggagataca gggcgcggtc     47400
     aataaaggca tgcccccgtt ccgaaacata agcgccaaac acaccaatct ggcagttcgt     47460
     gatcttgccg gcagatcccg tatactgccg ccccacaccg caggacgcct gacccttctt     47520
     cagaaaaccg gtctcatcaa tgaccagcac gccctcttca gtgcccagat gctcaatcac     47580
     ataatccctg acgacgtcac gaagggcatc ggcatcccag tgcccgcgtc ccagaagcgc     47640
     ctgctgccgc catggaccag gatctcctgc ggcttccgct cgcatccatc ccgtcttgcg     47700
     tggttcattg ccaatcaaaa catcaagaaa agcacaggcc gaatctacga cacgtttttg     47760
     cgtgaacagc ggcgccatcc gatccttggc ggaccgaagc gagcgcgccc ataattccag     47820
     cgtctcttca acagacgtac cgccactcat catatcctga atcatggtta cccatagatt     47880
     cagaactcaa cacaaaatgc aactgtagtg ctagaaatcg tggcttcatt ttgccgacaa     47940
     gtcgactgtg cagaacctgg tgattcatat ccatcaggtt ttcgtgcatg aaactgtaat     48000
     gacagttcac cacctgcccg aagcggcgcg tgcggtagcg actgtctctc gcccttggag     48060
     agtcaggcaa cgggatggtg tccgcaagag ccagcttccc catgaaaaca aaaatgagcc     48120
     catctttttc ccggcaggcc caggtcctga gacgcagaca ttgcgcctcg gaagaaacat     48180
     cggacgaaac acactgcccg tcgcggttat atttcaagcc gtgagcgatg cagcttatca     48240
     actcaccgtg tacatcccct ttgcccagag aacctgccgg tgagggcata ggccgtccaa     48300
     cgcgtatggt gcaccgccct ttggacgaac aataacgaca tgatgtccgg cgaactgaac     48360
     atcaagcgcc ttttcccgcc gtaactcgcg ggaccacgca acgggatacc agaagttggg     48420
     atcgattctg acgcgtctta aatcagtctg gtccgagcgc gcccgatgct ctgaagtttt     48480
     atgaagccag ttttccattg cctcggcatt tcatccagct cagcccaagg cgaaaggacg     48540
     taacgctccc gcacggagtg ccgtcccttc tctcacatct tggctgagca agcgtaaccg     48600
     ttatcaatac cggagaaagt gcgtgattgt ccggttcctg aacccgaatt gcttaacagc     48660
     cctaagcttt cagaagcatg agcatgtgtt gcgatatcgg tcagaaatga cagggcacca     48720
     gattgtgacg tgaaaagatc cagttgcccg attcatcggg aacaacggaa acaggtagcg     48780
     gacagacata tacttctctc ctaccttcgg tcgtcccgcc cgatggttgg tggctgaacg     48840
     atggcaggtc tcctggctga ctgattccaa ccttcccgtc cccagtggga acagtggtcc     48900
     acgttcgatg tgaacgaacc agcagcatac cgcctacagt tgcgggagca gccaccgact     48960
     ctgcatctgg acggtcatct gcccagagca tgacggtgtt ccctattaac ccgctcgcgc     49020
     gggaccatcg tagcgtttgc ctctgcatca tgcggccaaa cgcatgcagc gcgcaagctg     49080
     gaacatcaag ggaaagcaga aggcagatgt ctgtttttcg catgtagaac atccatctgg     49140
     ttcgctggcg cgccgaaata cagatgtcac gttgatcggt ctcgggcacc atgtcccgca     49200
     tgatttcatc ccaatcagtc catgaatggt atttatggtt ttatgaaatc aaatcatttc     49260
     tattcacctt tcctctcggg cataaggaac tcaacgcttt taactgcaca catgacgaag     49320
     gtttcaatga ttcaggaatc ctcatttaat ataaagcgca ttcacttcga tgagaattat     49380
     catccatccg acagaacgcg tctcacgacc aatttcgcca atctggcaag agggggaagc     49440
     cgtcaggaaa acctgcgcaa cgtgctcagg atgattgaca accgtttcaa tggcttggcg     49500
     cattgggaca atcccttggg ggatcgctac tccgtcgagc ttgaaatcgt ttccgttgag     49560
     atggaccttg cctttgccgc caagaacgac agttttcccc tgatcgaagt tctgtacaca     49620
     acgattgtcg ataaaaaata caacaagcgc atagaagggc tcgcagggaa cagtttttcc     49680
     tcgtatgtcc gggattatga cttcagtgtg ttgctgccga aatacaataa agacaaggta     49740
     gaattcagcg ttcctcacaa ttatggggat ttgcatggca atctcttcaa gagtgctgtg     49800
     aattcgactg cctacaagaa gaatttcagg aagcctccag tcatatgcct cagtgtttca     49860
     accaaccgaa cctatcaccg gacagaaaat cagcacccgg ttctgggcgt tgaataccag     49920
     cagcatgagt tttctctgac tgatcaatat tttgcaaaaa tgggcatgaa ggttcgttat     49980
     ttcatgccag ccaatagcat ggcgccactg gcgttctatt tttctggtga cctgctgtct     50040
     gattattcca ctcttgagct tgtcagcacc atcagcacga tggagtcttt ccagaaggtg     50100
     tatcgtcctg aaatctacaa cgccaactcc gcggccgccg gttgttatca gccaagcctg     50160
     aagcatcagg attattcaaa cacccggatt gtctacgatc gggaggaacg taatcaactg     50220
     gctgtcgcgc aagggaaata tacggaagaa agcttcatca agccgtatca cgatattctt     50280
     gaacagtggt ccgccagcta cgccgcctga tcaatcagaa acacaggatc aattcttatg     50340
     aaaacactgc tacccacctc aaccgctggt agtctgccca agccgtcctg gcttgcaaaa     50400
     cccgaggcac tctggtcgcc gtggaaattg cagggtgagg aactggttga aggcaagcag     50460
     gatgcgctgc gcctgactct ggacgatcag gaccgggcgg ggattgatat cgtcagtgac     50520
     ggcgaacaga cgcgtcagca tttcgtcacg acatttatcg agcacctcag cggtgtcgac     50580
     tttgaaaacc gtcagacggt taaaattcgc aaccggtacg atgcgagtgt gccatcagtt     50640
     gttggcactg tgacgcgcga gatgccggtc tttgttgagg atgcgaaatt tttacgcaca     50700
     ctgacgaaga aaccgatcaa atgggcgttg cctggtccca tgaccatgat cgacacgctt     50760
     tatgacattc actacaaaag ccgcgaaaaa ctggcgtggg aatttgccaa gatcctcaat     50820
     caggaagcga gagagctgga agcggctggc gtcgatatca tccagttcga tgagccggca     50880
     tttaatgttt tctttgatga ggtgaatgat tggggtatcg ccgcattgga aagagccatt     50940
     gaagggctga aatgcgaaac cgcagtccat atctgctacg gctatggcat caaagccaat     51000
     atcgactgga aaaatgctct tggggaagag tggcgtcaat atgaagagat ttttcccaag     51060
     ctgcaaaaat ctaatatcga tctgatttca ctggagtgtc agaattcccg cgtccccatg     51120
     gatctgatcg aactcattag tggaaaaaaa gtgatggttg gcgccattga tgtggccacc     51180
     aaaaccatcg agacgcccga aaaagtcgct gatattttgc gcaaggcact caagtttatc     51240
     gatgccgaca aactttatcc ctgcaccaat tgtgggatgg cgcctttgcc gcgtgacgtg     51300
     gcgcgaggca agctcaacgc tctgggtgct ggtgcggaaa tcttacgcaa ggaactctcg     51360
     gtttaggagg ctatcggatt agaaccgtgg cagttgaggg tatgacttta taaaatgaat     51420
     ggaaatagta tgtttgtacg attatatgtc gtttgcgcat ttattgaggc aaggcatggg     51480
     tgttcttgaa cgcagtcatc tgacgatcat tcaggaagtt gcccgcgaag gttcgctgac     51540
     cgctgccgcg gtcagactga atctcaccca gcctgcgctc agtcatgcca tccgcaagat     51600
     tgaaaacctg ttggaagtaa agatctggcg gcgtgagggg cggtctcttg tgctcaccca     51660
     agcgggtgag tggctattat cacttgccaa cagactgctc cctcaatttg aactggcgga     51720
     aaacaggctg caacagttcg ccaatggcga acgaggaaca ctccgcgtcg gcatggagtg     51780
     ccatccctgc tatcagtggc tcctgaaggt ggtttctccc tatttagaga gatggccgaa     51840
     agtcgatgtt gacgtgcggc agaaattcca attcggcggt attggggcgc tgttcagcaa     51900
     tgagattgat attctggtga cgcctgaccc gctttataaa ccaggtctga tattcacgcc     51960
     ggtttttgac tatgaactcg tactggttgt tggccccgaa catcctttgc gaggcgcgaa     52020
     gttcgtcgtg ccggaacagc ttgctggcga gacattgatt acgtaccccg ttccacccga     52080
     gcgacttgat atctatacgc aatttctgca accagcgggt ttcggcccac gacagcagaa     52140
     gcagatcgag acaacggata tcatgctggt gatggtggct catggtcggg gtattgcagc     52200
     tcttccacgt tggcttgtgg aagagtatcg ctcccggttt gaacttcacc cggtcaagct     52260
     tggtaaaaag ggtattgcaa aacagatatt tcttggccgt cgggaaactg acgaagagat     52320
     ccaatatctg cgggatttta tcgaatgcgc tggctcacct tcttcggcgt gtcgtcagtt     52380
     aagccctgag agtggcacgt gaaggttgta ctttgtgtct gcgtgtgctg actgttttcc     52440
     cattttttgg ggagacagac agatgcggcg ctatagttta cgcgatgacc agtgggagcg     52500
     gataaaggat cttcttcctg gtcgagaagg ctatgtcggc ggcactgcgg tgaacaaccg     52560
     tctgttcgtg gaggcggtgc tgtatcgcta tcgcgcgggt attccatggc gcgaccttcc     52620
     tgcccgtttc ggtgactgga aaaacgtgca ccggcgtctg cgccgctggt gtgaaagcgg     52680
     cgtcatcgaa cggatatttc gttatctggc cgctgattac gacaacgaat acatgatgat     52740
     cgacagcaca attgtccgag cgcatcagca tagtgccgga gctctcaaaa aaggggcacg     52800
     gatcaggcca tcggacgatc acgaggcggg ctaactacaa agatccatgc catctgcgac     52860
     gctctgggca atccagtgga actcggcatc acaccgggac aggatgccga tatcacccag     52920
     gcagaaccac ttctggaaaa catcgaaccg gatgctttcc ttgctgacaa ggcgtatgac     52980
     gcggacaggt tgatcgatcg gctgatacag cgcgggatta ccccggtcat cccgccaaaa     53040
     cgcaacagaa cgacacgacg gaaaaccgat ttttctctct atcgcgaacg gaaccttgtt     53100
     gagaggttct tcaataaact caagcagttt cgcgctatcg caacccgcta cgataaactg     53160
     aaatcgacct tcctcgcagc cgtgcagttc gcctcaatca tcatcctgct taactgacga     53220
     cacgccgttg aactatttga ggatattttt ttatcttctt cttttgccat gtccggcttg     53280
     tctattctct tcccgataac cgacattccg ttctcccccc aaagcagctg ctttaatcag     53340
     cggcaagtat accactttgt caacgagcgg cagggagcag ctcgctaacc aacgatggac     53400
     gtttatccaa cattgccaac aagacctgag ctggcccggt tggctgacga cgaccatgtt     53460
     cccagttcag aagggttccc ttggcgacac cgatgctctt ggcaaactgt gcctgggaca     53520
     gtcccgttcg ggttctgatg gccgcaacat tcacagacag cacacgtacc ttatgggtaa     53580
     cgctgttttg tacctgtgct tcagaatatg cgagagcctc atttaacccc tgcagaatgc     53640
     tatcataagt gctcatgatg gttctccata tttcgcaatt agtgtcttac tcaagtctac     53700
     cagagcagcc tgttcggatc gggaaagatt atctttttcg ttcttggcaa agacagtcag     53760
     tagaaacaaa ggcatatgtc tcccaccaaa gacataaaga gttctatacc ctcccctttt     53820
     tccgctacct tcgcgtgcaa aacgaatctt tcgcaggccg ccccctagtg acactccaga     53880
     gtctggcata gccgcgagcg tgttaatcag agccatacga tcgtcgtctg acatcagggc     53940
     ttttgcccgt tttatgaatt caggcagttc aacaacggtc tgcaactttg acattttcag     54000
     taagctatgt gtcaatggct tatatgtcaa ggacgcatga attagaaggt tgaagctaat     54060
     aatatttgct tacccagaca gcagtccagc aacttagtta tataccaaaa atcaggagtt     54120
     ttctgacgta aaatctacgt acgtttctac catttgtcgc aagtaggcgg gcgcacggaa     54180
     aagaaagggg tttttcggga accacaaggt agtaataaat tcccttgccg cacggaaacg     54240
     cccgcaacga tgccgacaga cccagacatt ccgctgtcgc cctcatgtcg gtcgtaaaga     54300
     gagtcgctca aggttttggt aagcggacac cctgtgccgg tgacgcaagc caggccgcca     54360
     gttgccggac catggatcgc gcaacgcggc ccgcccctag gagggttgcg gatgcggggc     54420
     cgcaccagga gccataaccc agcagccaga gacgtggctc cctgacggcc tgctgcccgt     54480
     taacgcggat cagcccgtcc ggctcgatca cgtcgagcgg cgcaaacata gagagcgcgg     54540
     gcctgaagcc cgtacaccag atgatcgcgt caatggcttc ttctcgcccg tcgggccaga     54600
     cgacgcccgt cgccgtcatg cgtacaaact ggcgcaccgc gtggagcacg ccccgctccc     54660
     gggcggctcg cacgggcggc accatgacga tgtcgccaaa accgccggtg ggcatggccg     54720
     acgggccgcc gagaacgcga gcggtcgccc gctcgaacag cacccgtccg tccacatcgt     54780
     caggtaagaa gacaggatcg tgctgcgtga cccatgttgc ctgggcgaca agggacagct     54840
     ccgccataat ctgcgcaccg gagttgcccc cacccaccac gagcagacgc tgaccggcaa     54900
     atggtagtgc gttgcagtaa tgggaggagt ggatttgcgt tctgacaaac aattcgcgac     54960
     ccggataatc ggggatgaag ggcgcagacc atgtgccggt tgcgccgatg accgcgcggc     55020
     ttacgaaatc acccacgctg gttctgacat tcaggaattt ctggtcagtg cgttccacac     55080
     gtccgaccat tacggggcgg tggatcggcg gcgcatagcg cgcctcgtag cggtgcagat     55140
     agtcaagcac ctcgtcgcgg gtcgggtagc tgccatcggg cgtgtcgggc atcggccagc     55200
     cgggcagcga actgtaggac gcgggcgaga acagatgcag ggaatcccag ccatgcaccc     55260
     atgcaccacc cgcctgcgtc ccgttgtcca gaatgacgta ggtcagcccg gtccggcgca     55320
     agaaatacga ggcggcgagc gctgcctgac cgccgcccac gatcacgaca tcgaactgtt     55380
     ccgccattgc ccggctcaca ggctttccgg gaggcggaat tccgccttcc gttcgctata     55440
     gcggtccacg aggtagtcgg cccggtcgcg taaaagccat gtgaacttca tcagttcctc     55500
     catgacatct accatccggt catagagggg ggacggcttc atgcggtcat cgtcaccgaa     55560
     ctgcgtatag gccattggca cgctggactg gttggggatg gtgaacatcc gcatccaccg     55620
     gcccagaacc cgcagggcat tgacggaatt gaagctttgc gatccgcctg agacctgcat     55680
     caccgccagc gtgcggccct gtgtcgggcg gaccgcccct tcggagagcg gcagccagtc     55740
     gatctggttc ttgaacacgg cggtaatgtt gccgtgccgt tcggggctgc accagacctg     55800
     gccttccgac cagatcgaga gatcccgcag ttcctgcact ttcgggtggg ttgcgggcac     55860
     ggaatccgct accggcaggc cggtcgggtc gaacacccgt gtctcggccc ccagcacctt     55920
     caggatgcgt tctgcctcaa gcaccagcaa ccggctgaaa gatcgggggc gtaaagagcc     55980
     gaagagcaga aggatacgcg gcggatggtc cacacgcggt tgcggttcca gccgcgcgag     56040
     atcgacccgt tcaagatatt cggggtggag ggccggcaag tcaggttcgg tcattgtgat     56100
     attggtccat tcgtgcatta cgagtggctg atccagggca accacaagga cagcgccgcg     56160
     agtgtgacca gcaggacggg cggggtgatc gccagtccaa ctttcatata ctgcccccat     56220
     gtgacccgat ggttcctgga tgccagcaca tgcagccaca gcagtgttgc gagactacca     56280
     atcggcgtga attttggtcc gaggtcgcag ccgatgacgt tggcatagat catcaggtcg     56340
     cgtgtcagcg gcgtgatgtc gtgagcctgc tggatcgcca gcgccccgac cagcacactc     56400
     ggcatattgt tcatgatgga cgacagaaca gccgccagaa agccggtgcc gatggtggcc     56460
     gtgaacgtcc cttgatgacc gagccagacc agtgcggtcg caagatagtc ggtcagcccg     56520
     gcattgcgca ggccatacac caccagatac atgcccagcg agaagatcac gatctgccac     56580
     ggggcgcccc gcagcacctt acgaacaggg atgacccgac catatccggc gacgagcaac     56640
     aggattccgg cggccaggca ggccacgaca cagaccggga tatgaaacgg cgctgtcagg     56700
     aaataggccg ccagaacgag gaccagcagc ggaaatgccg cccgaaatac atggtggtca     56760
     cgaattgccg cagcgggtgc tggcagttcg gcgacgggat aggtcgcagg cacctgccgc     56820
     cggtaccaca gccaaagcac agccagcgtc gcgcccagcg ccaccagatc gacggggacc     56880
     atgatcgcgg catagcgatc aaacgcaatg ccaaagaaat tggcgctgac gatgttcacc     56940
     aggttggaaa tgacaagcgg caggctggtg gtatccgcga cgaacccagt ggcgataata     57000
     aaggccagcg ccgcgccatg gctcaggcgc agttgcgtca ggatagcgat gacaatgggc     57060
     gtcagcagca gggccgcgcc gtcattggcg aaaaccgctg caatggccgc tcccagcacc     57120
     acgatcagcg ggaatagcgt ccggcctcgc cctttgcccc agcgcacgac gtgcagggcg     57180
     gcccaatgga agaacccggc ctcatccagc aacagcgaga tgacgatcag cgcgatgaag     57240
     gtaaaggttg cgtcccagac gatgtgccag acgacaggaa tgtcgtgcca gtggatcaca     57300
     ccagccgcca gggccacggc ggcacctgcc attgcgctcc agccgatacc cagcccccga     57360
     ggctgccaga tgacaaaaac cagcgtggca acgaaaatca gaagcgccag catcagatga     57420
     tccgcttgcc ggattcatcg acgatcttct ccccgtcctc tttgacgaaa gcgcctctct     57480
     gcgggttagg caggatgtcc agaaccgtct cggacggacg gcagagtgcc gcaccgaggg     57540
     gggtgacgac gatcggccgg ttaatcagga tcggatgcgc catcatggcg tcgatcagcg     57600
     catcatcgct cagggccgga ttatcgaggc cgagttcgtg aaagggcgtg cccttttccc     57660
     gcaggaccga gcgcaccgga acgcccatac gggcgatcag atcgaccagt tccgcacggc     57720
     cgggaggcgt tttcagatat tcgatggtcg tgggctcgat cccggcattg cggatcagtg     57780
     ccagcacgtt gcgcgacgtg ccgcaggccg ggttgtggta gatcatgatg gtcatgagca     57840
     ggattccggg gacggacagc aggaggacag gctcgcgacc aggggcgcgc agagttcggg     57900
     actgcccgcg cagcagtccg tgacgaggaa gagcatcagg tcgcgcaggc gcggaagaca     57960
     ggcgcgatag acgatcagcc ggctatggcg ttgcgaggtc agcagcccgg cgcgggtcag     58020
     ggtggcgaga tgggccgaga tcgtgttttg cgggacatcg agatgccgcg cgacgtctcc     58080
     ggcgggtagt ccgtccggtt cgtggcgcac cagcaggcgg aagatctcca gtcgcgtgga     58140
     ctgcgacagg gcgctcagag cagcgagggc agattctgta tccatatatc cttttttgtg     58200
     gatatgttgt tgtaagtcaa gctattttat gtgagaaaac agagatcaca accgtcggct     58260
     tcctcaattt ttccgctcag accagacctt ccgccctccc ccccatagcg gtcaaagcgc     58320
     actaattttg caacatcatt tctgccatcc catccaaccg taccttatgt cgttcccagt     58380
     ccggcatgac acgcgccaga agagcccaga aggcaggtcc atgattgtgc tccttcagat     58440
     ggcacagttc atgcaggatg acgtaatcaa tgcagtctcg tggagctttg accagatgcg     58500
     ggttcaacgt gatggtccca cccgctgagc agttgcccca ctgcgtctgc atcacctgaa     58560
     gcttcagggt agggggtgtg gtgacccaga gtgctgacgg cagcagcgcg tccagacgtg     58620
     tccgaaacac gtcctgcgcc cgcgcaaaat accagagttc cagaagcttc tgaatccgca     58680
     gggcgttgcg ttcctgcacg gacacttcca gccttccgcg caacatccgc accgtctctg     58740
     gcgcatcagg ctgatgctga actttcagca gatgccgccg ccccagatag aagtggcttt     58800
     ccccgctgac atacgcacgc ggcgtggcat gttcctgcac cgcccggaag tcacgtagtt     58860
     tctgccagat ccagcgggtt ttctgtttta atgccctgtc cagatccgtc tctattgtgt     58920
     cctcgggcac gaccacctgc acagtcaggt cgggatgcac cttgatgcgc aatgtcgtgc     58980
     cggggcgtgc gcgaggcagc agttccaccc ggatatgctc atccccatag gtcagaatgc     59040
     ggtggtcctt gtcgcccatg ctcagctacg tagagtatca gcaggaccag cccgcatgat     59100
     ctgaataacc tgctcgatga tctcctgcgc cttgtccacg ccaaagcccg ctttctggcc     59160
     cgtgctgaac aggagcggca gcagttcctt cctgactgct ttttccatat ccgggcggct     59220
     gagggagttc tcccgcacgg ccttgtccac gattgtgtcg atctggaacg ccagatcaat     59280
     ccagcgctgg ttctcctcat ccgtctgctt atggttgaag atggcagcga gtgttttgag     59340
     gaacacgcca taataggcct gcgcatgccg gtgcccgtca aaaacagtcg gaatgttctc     59400
     cagcttgcgg ttggccacct gttcctcaaa ctcctggaac agcatgaact gcttgagcgg     59460
     atgatcaaac aggctttccg cttctgcgat caccttgcgc agcagggcgg agaaggcttc     59520
     cttggcgtac ggatcatcct gcatctcgtg gtcgatcatc ttcgtcacac gggtgcggat     59580
     cagatcggtc tcgttacggg tcttttcttc gctccaggtc tctggctggt tgtcgtccgg     59640
     cttctggccc atcttgccga ctgcatagag cccttcggat tcatgcacct tcacgcctgc     59700
     cacatgccgg tccagcagct tttttacctg ctcggcatac tggtcaaaat cgactttttc     59760
     acccgtatcc tgcatcacca tctggcgcag gctggtcagc tgcttcagcg tttccttgta     59820
     ggtggcgcgg tccttttccg taaagctggt gtcctcaaag aacgccaccg attgcagcgc     59880
     caccttcagg cacgcggcaa actttgtcag cgcctcatag aaatcatccc ggcgcttgag     59940
     gttcacgtcc accatctggc cgtgctcttc caccatgcgc ggcatgagca cggcgcgaag     60000
     ctgctggatg tcacttttgt tcttcacgcc atcaaaaatg gcccacaggg ctttgtgcag     60060
     ggcagggagt tcacggtatt ccgtgctcat ctggctatac agcccggcaa tatccttcgg     60120
     gtcatacccg ccgacattct cggccgccag ttcatcatat ttggccagtg tggtgtccag     60180
     ctctgccaga atgccgcgat agtcaatcag caacccgtgc ttcttctggt catgcaggcg     60240
     gttcactcgg gcaatggcct ggagcagatt gtgctgcttg aggggcttgt cgatatacag     60300
     caccgcgttc ttcggctcgt caaagccggt cagcagcttg tcgaccacga tgatcagctt     60360
     gagattgggg tcgttctcaa agcggtcaat cacatctcgc gtgtagtctt cctcgctttg     60420
     gctgccgaca ttctccttcc accaggtctg gatttcgggc tgcttgcgct catccacttc     60480
     cgtatggcct tcgcgcgtat cgggcgggct catgacgatg gcgctctcga acagaccgac     60540
     ctcgtccaga taccgtttgt agcggatggc ggagagcttg ctgtcacagg ccagcatgcc     60600
     cttgaggccg ctgtcgatgt tgctgtcgaa atgcgttgcc agatccatgg cgatcagccg     60660
     gatgcggtca tccgccttgt aaacctgatt ggcgcgggcg aagcgcttct tgaggtccgt     60720
     gacctgctcc tcggtcagcc cctgtgtgat acgctcgaac cacgcatcaa tggcccggtc     60780
     attcacgtcc agatcgggct tgcgctcttc atagagcagg ggcgtcaccg tcccgtccgc     60840
     gacggcctgc tgcatggtgt aggagtggat gatcttgcca aaacggttgg tggtctcgct     60900
     gcccttgagc agcggtgtgc cagtaaaggc gatgaaggcg gcgttgggca gggcgtgctt     60960
     catgcgggca tggttctcac cgccctgact gcgatggcct tcatccacca gcacgatgat     61020
     gtccgcgctg tcattatggc attcgggata gccggtggca gtgtggaact tgttgatgag     61080
     cgagaagatg atccgttcct gcccgtgccc gatctgctgc gccagacggc ggcctgaggt     61140
     ggccagcgcc tcttccttgt ccttcttgtc cgccagttcg ccccccgtgg agaaggtgat     61200
     gctgagctgg cgttccagat ccttgcggtc tgtcacgaca atgatgcggc attgcttgag     61260
     gtcgtcatcc agaatgaggg cgcggctgag gaacaccatg gtgaaggact tgccagaccc     61320
     cgtggtatgc cagaccacac cgccttcacg cccgccatca ctgcggcggg acttgatgcg     61380
     ttccaaaaga cgcttgatgc caaagacctg ctgatagcgg gcgacgatct tgcccacctt     61440
     gcggtcgacc agcgtgaagt atcgtgtcat gtccagcagg cgctggggcg agagcaggcc     61500
     aatcagcagc cggtcctgat ccgagacatg cagcgggcgg gaggcccagt cctcaaacca     61560
     tatccgggca gggggttttc gatcagcaaa cagcacatct ttctgtgtac ccgaaagcgg     61620
     catgttcttg agtgcctcca tccggctttc gggaatgtcc tcttccttcc agctggccca     61680
     gaacttcttg ggcgtgccac aggtgccata gcgcccgtca tgcccgttga tggacagaag     61740
     aagctggctg taggcaaaaa gctgggggat ttcatccttg ttctggttgc gaatgctctg     61800
     ggaaatgcca gcctccaccg tcgggccttt gcccggctga ccatcggggc gcttggcctc     61860
     gatcacggcc agtggaatgc cgttgacgaa gcagacaatg tccggcctgc gggtctgggt     61920
     cagatccgtg cgcaggacgc tgaattcctc ggtgaaggta aagctgttgt tctccgggtt     61980
     ctgccagtcg atcagagcga tggtcgggtt ggccttgtgc ccgttgatga actcgggaat     62040
     ggcaatgccg aacagcagat gcgtggtcat cttgtcattg gcatcgcgca gaccggagac     62100
     gaagtccgga tgcgtgacgt gggagaccag tgtgttgatg gcctgatcgg acaggctgtg     62160
     ctcctggcct tcaaacgtga agcaccgttt tttcagttcc gcccgcagga gggtgtccag     62220
     caccacggcg ctctgcctgt cgccccgcaa ggcgagtgct tcggatgggg gcaggaaccg     62280
     ccagccgagt gtgctgagca gggccagtgc gggcagtttg gcgctgtatt cttcctgaaa     62340
     tttcggtgca gaaaccataa tgttcaaata tcctgtaagc tgaaatatct taatcgaccg     62400
     tcacgcggcg tttgcccgtg agaagctgct gcatcagggc tttcttctcc tgacgcaggc     62460
     gagaaaggtc ggattcaagg gctgcgagtt tttcgtctgc tgtggtcaga accgcagcga     62520
     tggcccgctg ttctgacagc ggcggtagtt ttaaaggcat cttttggaac ataggcagcc     62580
     gtaacgattt tacggttgag ccaaccgctt gggaaagaaa gtgggatcta tgataaccaa     62640
     ccgtgtaaaa aataaatttt ccatcacacg cttgaaaaca tgagatagcg taagttcttt     62700
     ggtgtagatc aaattttcct acaaaatatt tagggacaaa atcctgtccc tctcccggta     62760
     caatgacagc ttcacaatcg aacaaatatc tgttgcttgt tctaatatct tccgaacgat     62820
     caaaaaatgt atattcgcca tttgtgagtg aatcttggcg gttcgaactg ccggtctgaa     62880
     tgtcggcaat atctccgaga tatttggttt tccactcccc cgtgaacccc ggcaggcgtt     62940
     ttttgcctgt gaggagttgc tgcatgaggg cttttttctg ctgctggctg ttggccagaa     63000
     gcttctctgt ttcttcaatc gcacggtccc acgtcgagag gatcgccgcg atcttcttct     63060
     gttcggaaag gggagggagg aggatggaga tatcaactaa ttttttcggt gaggtatgtt     63120
     tgactttcgt gccaccggct tcattggaaa tgatcagcct atttttcgga tcattatata     63180
     gccaataaag aaaatctgat gatacagaat tgggatcagt tatttcgatc aatccaattc     63240
     tttgattgtg aagaaattta tcatcgttgg gtataaaagc agcgcttcct agaagcccgg     63300
     ctccctgttc ggtcattgct aggatgcaat cgcctttttt taggatgtat tcttttggaa     63360
     tttctccaga ataatatttt attttatcct tttgttcttt aaacccacca gtttcgaaga     63420
     aatttcccgg tgttaaaaca atatatttcc ctgaattgga aaaatattca cctttaaacg     63480
     catatccatg tttgacatga atatattttt ccagagtcgt ttccttccac ccctcaggaa     63540
     gcataaccta gctccttcag ataagcgtcc atctgtgctt ccagctttgc cagttctgcc     63600
     ttgatctctg cccgttcctt gcgcacggcg ttcaggtcga tttcttcttc ttcctcaaac     63660
     gtatcgacat aacgcggaat gttcaggttg tagtcgttct ccctgatctc atccggcgtg     63720
     gcgaggtggg cgtatttgtc cacgtccttg cgggtgcggt aggtgttcac aatctttgtg     63780
     atgttctcct cggtcagcac gttctggttc ttgcccgcct tgaactcgcg gctcgcatca     63840
     atgaacagca cgtcctttgt cttgcggtcc ttgcgaaaga ttaggatggc ggctggaatc     63900
     cccgtgccaa agaacagctt ttccggtagg ccgatcacgg catccagaag gttttcctca     63960
     atcagcttct ggcggatcct gccttccgaa ctgccccgga acagcacgcc atgtggcacg     64020
     accacaccca tgcggcccgt acgatccttc agcgtagaaa tcatgtgcag gatgaaggcg     64080
     taatcgccct tggtcttggg aggcacacca cgggcaaagc ggtggtgcac gtcttccgct     64140
     gcgtcttcat ggccccattt atcaaggctg aaaggtgggt tggcggtcac cacgtcaaag     64200
     cgcatcaggt ggttcttgtc atccagcagc ttggggctgc ggatggtatc gccccattca     64260
     atgcgatggt tgtcctcgcc atgcaggaac atgttcatct tggcaaaaga ccacgtggag     64320
     ccaatggctt cctgcccata cagggcgtag tccttgctgc cgttatggtt ctgcgtcacc     64380
     tgtttgccgc acttcatgag cagggaggcc gaaccacagg ccgggtcaca aatgctctca     64440
     cccggctgag ggcttagaat acgggccagc agttcactca cttccggcgg ggtgtagaac     64500
     tcgcccgcct tctggccacc gctggcagca aagttcttga tcaggaattc atagccattg     64560
     ccgatcacgt ccagattgcc cacgcgcgag gggcgcaggt tcaggtccgg tttggcaaaa     64620
     tcttcaagca gatgccgcag aacggtgttt ttctgctttt catcacctag tctatccgaa     64680
     ttgaagctga tgtcctggaa gacgctcttg cctgcgtctt tcagtttggt gccattggct     64740
     tcttcaatgg cgtgcagcgc cttgtcaatc cgctcgccat tgcctggggt gttgcgctct     64800
     ttatagagtg tgtagaaatc ggcacctttc ggcagaacaa agcgttcctg cgccatcatg     64860
     gcttcaatca gttcgggatt gtcgccatat tcctttttgt aagtgtcata atgatcctgc     64920
     cacacatcgg agatgtattt caggaacagc atggtcaaca cgtaatcgcg ataggtgtca     64980
     gggctgacag tgccacggaa tgtgtcacag gcgttccaca gcgccttgtt gatggtgtct     65040
     tgtgaaatct gctcggtcac gaactcaaat cctgtttcaa aacgtcaagg gagtgtcagc     65100
     ccgccagaag gtctctggca agcccagtca tgatctgctg gttggtctgg cgcaggcggt     65160
     gcagaagatc ttcctcgcgc tgcatggcat tggccagacc cacaatttgt tcctgtcggg     65220
     gcaggggagg tagtataacg ggcgtggcct ccagcactgg ccgggcgatg ttgcgcacaa     65280
     gggtggaact ctgggcgttc tgttccagat gccgctgggc tggctcctga ttgagccacc     65340
     atgccagata ggcgggcagc acattcggat gcattacgcg cagaaggaag aagtgcgggg     65400
     ccgcaacggc ctgaaggctg ccgatgctct cattaaccag aactgccagt gacacattgc     65460
     cacgggccgg aaagagaata tcacccggac gcagccagtc gggttcacgc cgaccggcta     65520
     cctcggtgcg cacgcaggac gtccagtcca ctcctgaaga ggaggtgtcc cgcatctgca     65580
     cgacagctgt ttcaactccc gcaacggggt caatccgtcc tctgaacggg tgccccgccg     65640
     agatgctggc gactgccact aaatccattt tctgtgcgcc atttggtttc atgtgattgt     65700
     ggtaggcgat cgggagggca ccgtcaacag gtttttgcca ttagctttcg tgcagagaaa     65760
     cgctcccgaa aattttgtct ttatggggta atgacgcgtc atgacggtgt cacttgggtg     65820
     tcatttctat cgcacctttg gtgctctctg agaggccgga atgacggcgt catgacgcca     65880
     ccttaaatgg taatcccccc atttttagtg gggcattgaa tgagaattca ggcagctgtt     65940
     tttagtttct gggcgggggt tagcccgctg ttccccatgt tgggtctgtc atggttatat     66000
     gtccagagcc attgtgttgc gacctcctgc acgtcctgaa tgctttcaaa caaatactgc     66060
     tccagccatt cctgccggac agttctgttg tagcgttcaa tagaggcgtt ctgctgcgaa     66120
     ttacccggtt gcgtatagat cagggtaatc ccctgttttt cggcccatgg aaccaacgta     66180
     tgactgacat attcagggcc attatccatt cggatggctt ctggcctgcc acgccactcc     66240
     ataacctgtt ccagacagcg gacaacccga caggctggca gggaaaaatc accctcgatc     66300
     gccagtcctt cacgattgaa gtcatccaga atgttcagga gccgaaaagc acgtccatcc     66360
     atcagcctgt ccgccataaa atccatggac cagaccctgt tgggaagggc cggaaccgac     66420
     agcttttcag gcttttcgcg aaccagacgc ctgcggggtt taatccgcag gttgagttcc     66480
     tgttcccgat agatccgata aacccgctta tgattccaga gctgtccctg cacattgcgc     66540
     agatacagga aacacagacc aaatccccat ctcctgtgag cctgggtcag tcccacaaga     66600
     agatcggcaa tcctgtcgtt ctccgctgcc agtcgcggac gatagcgaaa gcaggtctcg     66660
     gatatcccaa aaatccgaca ggccagcgca atgctgaccc catgatgcgc cacagcctgt     66720
     gcggccagtt cccggcgctg ggctggccgc ttcatttttt tccaagggct tccttcagga     66780
     tatccgtctg catgctcaaa tccgcataca tgcgcttcag ccgacggttc tcctcttcca     66840
     aagccttcat ctgactgatc atcgaagcat ccatgccgcc atatttcgcg cgccaccggt     66900
     aaaacgtggc gttgctaatc ccatgctccc ggcacaggtc aggaaccggg acaccgccct     66960
     cagcctggcg gatcacaccc atgatctggg cgtcactaaa gcgatcactc ttcatcagaa     67020
     tctcctcaat tcttacgctg agaaaattct cattcaaaag tcactctttt tatgggggaa     67080
     ttaccagagg actggatgga gacctctcac acgaggtcgc cgtcgccctt atgaaacatg     67140
     atgcgctcgg tgaactgggt ctgtccgagg ccacagcggc aagacccata caggcggcat     67200
     tcgcctcggc aaccgccttt tcgtccggag ccttactgcc cgtactggca gctgttctga     67260
     cccctgtcgc gtgggtatcc tggggcgtgt ccctgacctc ggtcgtggtt ctcgccgttt     67320
     tgggcgtcgt cggcgcgctt gtcggcggcg cggcgcctct gcggccagca ctgcgtgtga     67380
     cgttctgggg tattgttgcg atgatcgtca cgggcggaat cggccgcctg ttcggcgtgt     67440
     gacaccgtat tccaggtttt gaacgaggca tgtcctgggt agtgttgact tcatccatta     67500
     tatccgtgat cgtcgattta tggatacaga atctgccctc gctgctctga gcgccctgtc     67560
     gcagtccacg cgactggaga tcttccgcct gctggtgcgc cacgaaccgg acggactacc     67620
     cgccggagac gtcgcgcggc atctcgatgt cccgcaaaac acgatctcgg cccatctcgc     67680
     caccctgacc cgcgccgggc tgctgacctc gcaacgccat agccggctga tcgtctatcg     67740
     cgcctgtctt ccgcgcctgc gcgacctgat gctcttcctc gtcacggact gctgcgcggg     67800
     cagtcccgaa ctctgcgcgc ccctggtcgc gagcctgtcc tcctgctgtc cgtccccgga     67860
     atcctgctca tgaccatcat gatctaccac aacccggcct gcggcacgtc gcgcaacgtg     67920
     ctggcactga tccgcaatgc cgggatcgag cccacgacca tcgaatatct gaaaacgcct     67980
     cccggccgtg cggaactggt cgatctgatc gcccgtatgg gcgttccggt gcgctcggtc     68040
     ctgcgggaaa agggcacgcc ctttcacgaa ctcggcctcg ataatccggc cctgagcgat     68100
     gatgcgctga tcgacgccat gatggcgcat ccgatcctga ttaaccggcc gatcgtcgtc     68160
     acccccctcg gtgcggcact ctgccgtccg tccgagacgg ttctggacat cctgcctaac     68220
     ccgcagagag gcgctttcgt caaagaggac ggggagaaga tcgtcgatga atccggcaag     68280
     cggatcatct gatgctggcg cttctgattt tcgttgccac gctggttttt gtcatctggc     68340
     agcctcgggg gctgggtatc ggctggagcg caatggcagg tgccgccgtg gccctggcgg     68400
     ctggtgtgat ccactggcac gacattcctg tcgtctggca catcgtctgg gacgcaacct     68460
     ttaccttcat cgcgctgatc gtcatctcgc tgttgctgga tgaggccggg ttcttccatt     68520
     gggccgccct gcacgtcgtg cgctggggca aagggcgagg ccggacgcta ttcccgctga     68580
     tcgtggtgct gggagcggcc attgcagcgg ttttcgccaa tgacggcgcg gccctgctgc     68640
     tgacgcccat tgtcatcgct atcctgacgc aactgcgcct gagccatggc gcggcgctgg     68700
     cctttattat cgccactggg ttcgtcgcgg ataccaccag cctgccgctt gtcattttga     68760
     attgccccgg gttttgtgga gacagaaaga cccgtgaggt aagaagaatt catgagcaat     68820
     aaatcgaagc gttttccgcc tgagtttcgt gaccgtgcag cccgcatggt tctggaggaa     68880
     gagaagaacc atccttcgcg gtggtccgcg gtgatgatga tagcgccaaa gctggatatt     68940
     catcctgaca cgctgtcaaa atggacccgt ctgcatgaac gtgccaatgc gcctgcggtg     69000
     agtgagctgc ctgatcgaga gaagatcagg caactggagc gagagaaccg cgaattgcgg     69060
     caggccaatg acatcctgcg taaggcgtcg gcatattttg cccaggcgga gctcgaccgc     69120
     atcttcaagc catgacacgc ttcattgagg agcaccggca gacatatggt gtcgggtcaa     69180
     tctgcagggt tctgtcgatt gcaccatctg cctattatgc aactgttgcc agacagaaaa     69240
     atccgtgtgt gcgcagccag aaagacaaag aactgtgcga tgacatccgt agagtgtgga     69300
     ataataattt ctgcgtctat ggagcgcgca aggtctggca tcagctcaga cgtgaaggcc     69360
     tggatgtcgc ccgctgcacg gtagagcggc tgatgcgccg gatggggctg aaaggcgtca     69420
     ttcgtggcaa gggggtcaga accacacggc ctgatccgca acgtccgtgt ccgcaggatc     69480
     tggtgcagcg ccagtttcat gctcctgccc ccaacagact ctgggtttcg gattttactt     69540
     acgtttccac atggcagggc tttgtttatg tggccttcat cattgatgta ttcgcacggg     69600
     ttattgtggg ttggcgcgtc tcctcaacgg cccataccga cttcgtgctg gatgctctcg     69660
     agcaggctct gtgccagagg cgacctgagg gaaaagtgac ccaccattcc gaccgcggct     69720
     gtcaatatgt gtccattcgc tacacgcaaa gactggctga agcggggctc gttgcttctg     69780
     tcggcagtgt tggggattcc tatgataacg ccttggcaga gaccattaac ggactttaca     69840
     aaaccgaact catctatcgg caggggccat ggaaaaacag ggaagctgtt gaactggcaa     69900
     cacttaaatg ggtcgactgg ttcaataatc ggcggctcct gtcctccatt ggaaacatcc     69960
     cgccagcaga agctgaggca cgcttttatg cacaacagaa atcacatgca ttagccgctt     70020
     aaatcagata aaaaacgtct ccacaaaacc cggggcaatt caagagtgtc gaagatcaga     70080
     agacaggtcc taaagagccg cgctcaacgg tcctgtccga gacggacgaa gcgatgatcg     70140
     tggcctttcg ccggcatacg ttgctgccgc tggatgactg cctttatgcc ctgcaggcca     70200
     gcattcccta tctgacacgc tcggccctgc atcgctgcct tcagcgtcac gggatttcac     70260
     gactgccgga catagagagg gacaaagcca aacgccagcg cttcaaacgc tacccgatcg     70320
     ggttctttca tctcgacata gcggaagtcc agaccgctga aggcaagctg tacctcttcg     70380
     ttgccattga ccggacaagc aaattcgctg tcacacaact ggtcgagaaa gctgatcgga     70440
     agacggcctg ggaattcctc gaacatctcc tgagcatcat cccttaccgg atccacacca     70500
     tcctgaccga caatgggatc cagttcgctg accaaccccg taatcgcaat acggcctggt     70560
     cgcgtcccat gcgcttcgac atgatctgcg aagcccacgg gatcgaacat cgtctgacga     70620
     aacccaatca tccctggacc aatggtcagg ttgaacggat gaaccggaca atcaaagagg     70680
     caaccgtcaa acgcttccat tacgacagtc atgagcagtt gaggacacac ctcaacgact     70740
     tcatggcagc ttataatttc gggcgaaggc tcaagacgct gagtggcctc acgccttacg     70800
     aatacctctg caaaatatgg acttcagagc cagaaagatt catcatcaat ccaacccatc     70860
     aaaccccggg accaaacacc taacgcattg caataagctg agtaggcaga gatcgactct     70920
     tctggtcgga tttttttgct tttgctgatg gctctatcgt ttgcatagct atgcaataaa     70980
     cgtcaacgtg aaaaatgttg ctggacctca cgaaagaagg aacagagagg agctaataat     71040
     aaaaaagtat tataatgaat gttaattctg aaatttttgt gcgacccgga acagtgtttc     71100
     tcgtagccag cgatgaacgg gatcgttgtc ccgccggggg tgccatgctt gaaacgcctc     71160
     gacccgaggt agggggaaag gataatcgat agctgcaagg cctgtttctg ttagcagcac     71220
     gttattgaga gccatatccg gtaaggtcac aataaaatct gtgcctctta tactgtcgat     71280
     cattgcctta taattaggaa ccaccagaac gacccgcctc gtcaagccaa actggtctcg     71340
     tagaattgta tcaattggtc cgtgtgcccg cccccgtcgt gatacgctga tgtgctcaaa     71400
     acgggtgagg ctttctaccg taactccttc agagaggatt ggatgatctg ctctgaccag     71460
     agctttcatg acatgatgaa aaatggtctg tcgccgaatt tctggtttaa ggacatcggt     71520
     cgcgccaata tagagatcaa tggaatcatc acgcagtgcg agattggcgg cttcatcgaa     71580
     ctccggagca aagaccagtt cacagtttgg gcaatcctgt ctgagtgcct gcaaaagggg     71640
     aagggcaatg gctgcgataa tcacgtcatt ggctctgacc gtgaatttag gggccatgtt     71700
     tcgcagattg gccaatgcct gtgtttcaat gaggccgtca gctgcacgca gaactgcctg     71760
     taaacggtca cgaatattca gagcaaaagt tgaggcaatg aggcgtcgtc ctgaaggtac     71820
     caggattgga tcgccaaaca ctgtccgtag cttggaaagg tgacggctca tcgcgggttc     71880
     actgacgttc attcgccgag ccgcgttaga cacactctgc tcttcaatga gcacttgcag     71940
     gaagcgcaat aaatcaaggt cgtagccacg cattgcatta gattaccatt tcgcatcacg     72000
     gaagcaagag tgaaaatatt tccacaaact ggaagcctga cataatcgga atggaggttt     72060
     tcatgatttc tattctgcgg attattgtct catgaactcc agccatgacg gtacaccgga     72120
     cgatataaga gggctgggtg aacgcaccca ccagttgtct cctgccaggt cgttctcgcc     72180
     tgcagcgccg attatccatc cttccccgcc attgccttcc tatattccgc cttttgggag     72240
     gcggacgatt attggttgtc tgggcgtgtt gctggctgtg catatggcca gctttaatga     72300
     gcatgtgacg gaaattggcc tctccgatat tcggggggcc atgcatatcg ggcatgatga     72360
     gggaacgtgg ttcacgacga tctacgaggc gttcaatatc gcctccatgg cttttacgcc     72420
     atggttttac gcgacgttct cgatctatcg cttttccatt tttatgacgg ctatgatcgc     72480
     tctgttggcg atacctgctc ccttcatgcc cgatgtgacg tcactttgta tattacgtgg     72540
     ctttcaggga ctgacggctg gctgtctgcc tccagtgctg atgaccgtca tgctaaaata     72600
     tctaccagcg gaaattcgcg tttttggcat cggcgcctac gcaatgagtg cgacttttgg     72660
     tcccaatctg ggtgtgccgc ttgaagcgtt ctggtttgag tatgtcgggt ggcactggtt     72720
     gtactgggaa attattcctc tggcagtcct ctctattttc atgatcgcgt acggtctgcc     72780
     acgtgatccg ctgcaactcg aacggtttgg aaaattcaac tggcttgggt tgttgactgg     72840
     actgcctgct atctgctcct tggtgatcgt actctaccaa ggtgacaggc tcgattggtt     72900
     tcgctcacct gtcattacgg atctggcctt ctggggatgt gctgcgttta tagtctttct     72960
     ggtgaatgaa tcgtttcatc ccagcccgtt cttcaaaatc cactactggg gttcacggag     73020
     tattgcagcc tctctgttat ctctaatcgg tattctcgcg atttgtggtc ttctgtcagc     73080
     attgccgatg agctatctgg aagaaattcg gggttaccga ccacagcaga tctccccggt     73140
     ttctctggtc gttgctttgc cacagttgat tatgctcccg ttgattgcgg ctatttgtaa     73200
     tagtcgcaag gttgattgcc gctatgttct tgccgcggga atgctgtgtc tcgctgtggc     73260
     atcatggctg ggtacatggc tgacgcctga ctgggtgaga gacaatttct acgttatgca     73320
     ggcgttacag gctttcggtc agccgatgac agtcattcca accttgatgt tgtccgcact     73380
     ggccctgggg ccagctgacg gaccgtttat ttctggcatg gtcaacatgc ttaaagggtt     73440
     ggccaatgct gtggctttcg cactgtttgc agctttgact cgccgccgcg agcattacca     73500
     ttccgtcatg ctcctcgacc attacggtaa tcatggtctg gcccttcagg gtatggggga     73560
     tccaatcggg catcaacttg ccaacacctc acctgatgcc caacatgtgg tgcacaacgc     73620
     gctggaagtt tttcacacct tcgtgcatga gcaagcactg gtgctggggt tcgcggatat     73680
     ctattttatc ttaatctggg tctgtatttt tttcgccata ttgaacatca ttctgcctcg     73740
     tcgggtctat ccacctcgtg ccccctcgat actcaattct gcaaaatgaa ccatattgaa     73800
     tatgtaaatt gatttgtaga aaaagacttt ttcatgaaag gcatgtcttg ctgggttggt     73860
     acggaagaca cagattttag tttaacccga agttgtctga cggtgcgaga gagaggtggt     73920
     ccccattttt cagacagggc gataagctat catctggcct gaacgaggac gggttttatg     73980
     ggcaaggtta cgcggaaacg gtatgcggcg gagttcaaat cacgggttgc cctggaggcg     74040
     atccgtggcg aactgacgct ggcggagttg gcgtcgaaac atggcgtgca tcagacgatg     74100
     atcgcccaat ggaagcgcca ggcgatcgaa ggcatggcaa gccttttttc tggtaagtca     74160
     gtaacggaac cttcagtcag ccctgctgat gtagagaaac tgcatgccaa gatcggccag     74220
     ttgctggtgg aacgggattt tttacgcgat gcctctgctc ggttgggcgt gatcagaggc     74280
     ggcagatgat tgacccgaag agagcatgcc tgccgataat ccggcaatgc acgctactgc     74340
     aactcaaccg gtcgggcgtc tactatcggc ctgtgccaca gagcgaggcc aatctggagc     74400
     tgatgcggct gatcgacgcc cagttcctgg aaacgccgta ttatggctca cggcagatga     74460
     catggcatct gcgccgcttg ggacatgaag tgggccgcaa gcgggtccgg cggctcatgg     74520
     tgatcatggg cctgcgggcg atctaccaga agccgcgcac gaccgtgccc catccggagc     74580
     atcggaaata tccatatctt ctgcgggatc tggtcatcaa tcggcctgac caggtctggt     74640
     gttccgatat cacatatatt cccatgaaac ggggatttct ctatctcgtg gcgatcatgg     74700
     actggttcac gcgcaaggtc ctgtcctggc gtctgtcgaa cacgatggac gtggagttct     74760
     gtatcgaggc gctacaggat gccctcatgc gctatggcgc cccggacatt ttcaatactg     74820
     accaggggtc gcaatttacg acaccccgtt tcaccgggat actggaagag cgtcagatcc     74880
     gcatcagtat ggacgggcgt gggcgatggc gatggctgga taacgtgttc atcgagcgtc     74940
     tgtggcggtc gctgaaatat gaatgcgtct acctgcacgc gttcgagacc ggatcagagc     75000
     tgagggccgg gcttggcata tggatcgccc attataacga aaggcgtccg catacggcgc     75060
     tggctggacg tacgcccgat gaggcgtatc atgacgtgcc gacgccatct ggtccggggt     75120
     taaccccgga ccagatggcc aacagcaacg ccgtcagaag ggcggcataa caacaaccgg     75180
     gtatagctta tcaagcccac aaaactgtcc gaacggacgg gaccacatca tttaggaagt     75240
     tttggacccc atgggcggac cttatctgcg gcgcatccct tacaacgtat gttttcaaac     75300
     tctacgcttt ggaaatacgg tatttcccca gatttcagta ttcaggtgca tacgattgta     75360
     gattatggat ggaaacatgc agaaggtcat tctcatggcc ccaaaacagg ggatgtgcct     75420
     gttgatctga tctatcgtct ggtacgaccg aaccctaagc gttatattcc agcatttaat     75480
     ctgttcgtgg gcatggtttt cccgaccgga gattatacaa agctcggtga taagcaggat     75540
     ggggtaggaa gtggtgccta cgttttccgc acggctttga cagagcaatc aacttacact     75600
     ttgccgggca accatgaatt gcgtctgcgg gtatggaact ggtttcgccg tgctgtgaca     75660
     tcagccaaac ttgttgatac caccagctat ggaacagcct atggctttcg tggtcgcggc     75720
     cagccgggga tgagtggcca gacgggtttc tctctggaat atggtttaag ccagaaatgg     75780
     gttctggcca tggatattgc gcacgactgg tcgaatggct ctaccttgcg tggtcatgat     75840
     aagaacggca cgtacattca caagaccgga gcagccggaa cagactggca gatcgcacct     75900
     gcatttgaat ataactggaa tgcaaattgg ggagtgatcg taggatcagc attctatttt     75960
     gcaggacata acaaaagcat tcaggtgtca ccgcaatttg ctgttaatgc gatgttctga     76020
     gcccggtttg ctgtgagagg tatgaagtcg gtgttcattc ctcaagaatt tcggaaattc     76080
     cgcacagtaa gcccccgaac ttgagaaaag gcgtgatcac tggtcactag catcagatgt     76140
     tccgtcaggg catgcgctgc gatcatgagg tctaaagacc caagaatttg accgcgccgt     76200
     tcttgctctg ctcgtaattt cccataatgc tccgccacgt cattattcca gggcagtatg     76260
     gtcagccgat ccatcacagt gcgtgtcaga cgctgtaagc gggtcgccga tgggcgtttg     76320
     gccagcccat aagcaacttc tccggcggtt acggccgaga cacaacactg gtctggatca     76380
     agggcctcga cgtgtaagag cactctctcg tcagcgcgta taatgtcact tattgtattg     76440
     gtatcgaaca tataagcaat cacggcaggc actcagaaaa tggatcccgg tcctgttggt     76500
     cctggctacg accttcaggg aaaagatcag cccctttggc cttacgaatg gcagagagtg     76560
     tctcgctcca tccctcgggt cgaggcgaga gaatgacatc gccggtacgg gggtctctgc     76620
     ggatggtgac ctctgatgtg tcaaagcggt aagcggcggg gagccgaaca gcctggctgc     76680
     gaccggtcat aaaaattttg gctgtatcgg acatattcgc ctctctttag tagataccaa     76740
     tgatatatac cattctgtac caaactgcgc aatatggaat cccagcgagg aagttggagt     76800
     tacctcattt cgtagttagt ttcaaactac gtctttttcc aaaaaacaac ctccttctcc     76860
     cgacctacgt gcgataattc cacttatcgc aactaggttg gcacacggaa aaagaaaggt     76920
     ttgtcgaagt tccttaatta ggagaattcc tgtcgcgttt ccctagatga tgacaaagat     76980
     cacattgacg ctgcttcggg ccgttttttg aagcctaatt gactgcaaaa tgttccctca     77040
     ttcctgacaa aaaataccct ggttgattgc acttgaatct atacgaacga ccgttggcac     77100
     gcgcaggtgg cttggccacc tttgcaaacg atcgtttacg aatgtcttct tgaattgtaa     77160
     aaatggactc agaaggagct tcgtcgccgt ggtgccaccc aaacctggaa aaacacccgt     77220
     tggcggccgt ctaattggct acgctcgcgt ctccacagac gatcagggca ccgacgcaca     77280
     gttgaatgag ctacgcgacg ctggctgcac gatgattttc gagaaacatg cctccggtgc     77340
     tgaccggaac cgccctgtgc ttatacgcct gctaagggat atgaacgctg gtgacacctt     77400
     ggtcgtggtc cggctcgatc gtctggcccg ctcggtcagc cacctactcg ccgttatcga     77460
     gcaactggat tacgctggcg cgcatttccg tagtttggac gaccccatcg acactacgac     77520
     cccgcagggt atgttctcgc tgcaggtgct cggcgccgta gctcagctcg agcgagcgct     77580
     catttccgaa cgcaccaaag ccggtctgtg tgcagcccga agctgtgggc gcgtcggcgg     77640
     caatccgggc ctgcggactc gcgatgcaaa tgccatccgc aaaatccggc aaagtcgcaa     77700
     cgccgcgtat ctcgacgctg ttcttgcacg cctcgacact tggctaccga tcgtgcggcg     77760
     aatgcgccca agtcaccctt ggggtgatgt cgtacgtgtc ctgaatcgtg gacaccctag     77820
     gtgtttggtc ccggggtttg atgggttgga ttgatgatga atctttctgg ctctgaagtc     77880
     catattttgc agaggtattc gtaaggcgtg aggccactca gcgtcttgag ccttcgcccg     77940
     aaattataag ctgccatgaa gtcgttgagg tgtgtcctca actgctcatg actgtcgtaa     78000
     tggaagcgtt tgacggttgc ctctttgatt gtccggttca tccgttcaac ctgaccattg     78060
     gtccagggat gattgggttt cgtcagacga tgttcgatcc cgtgggcttc gcagatcatg     78120
     tcgaagcgca tgggacgcga ctaggccgta ttgcgattac ggggttggtc agcgaactgg     78180
     atcccattgt cggtcaggat ggtgtggatc cggtaaggga tgatgctcag gagatgttcg     78240
     aggaattccc aggccgtctt ccgatcagct ttctcgacca gttgtgtgac agcgaatttg     78300
     cttgtccggt caatggcaac gaagaggtac agcttgcctt cagcggtctg gacttccgct     78360
     atgtcgagat gaaagaaccc gatcgggtag cgtttgaagc gctggcgttt ggctttgtcc     78420
     ctctctatgt ccggcagtcg tgaaatcccg tgacgctgaa ggcagcgatg cagggccgag     78480
     cgtgtcagat agggaatgct ggcctgcagg gcataaaggc agtcatccag cggcagcaac     78540
     gtatgccggc gaaaggccac gatcatcgct tcgtccgtct cggacaggac cgttgagcgc     78600
     ggctctttag gacctgtctt ctgatcttcg acactctgtc gcttccgcca tttagccact     78660
     gtcttcgggt tgatcccgaa ctcctcgctc agcgccgcga gcgaagcctg cgatcgctgt     78720
     attgctgctc gcacggcgtg cgtggtcgtg gcgctcccat gacgtatctg tcccataatg     78780
     cttccttcca ctctcgtgaa aatatcacac catcaaaccc cgggattaaa cacctaactc     78840
     aatacacgtc ttcaaagact gattttgacg gcaccactta tcccaagccc tatacaggtg     78900
     gaaagtggaa aatcctgatg gtaatccccc cataaaaaga gtgacttttg aatgagaatt     78960
     ttctcagcgt aagaattgag gagattctga tgaagagtga tcgctttact gacgcccaga     79020
     tcatgggtgt gatccgccag gctgagggcg gtgtcccggt tcctgacctg tgccgggagc     79080
     atgggatcag caacgccacg ttttaccggt ggcgcgcgaa atatggcggc atggatgctt     79140
     cgatgatcag tcagatgaag gctttggaag aggagaaccg tcggctgaag cgcatgtatg     79200
     cggatttgag catgcagacg gatatcctga aggaagccct tggaaaaaaa tgaagcggcc     79260
     agcccagcgc cgggaactgg ccgcacaagc tgtggcgcat catggggtca gcattgcgct     79320
     ggcctgtcgg atttttggga tatccgagac ctgctttcgc tatcgtccgc gactggcagc     79380
     ggagaacgac aggattgccg ctcttctggt gggactgacc caggctcaca ggagatgggg     79440
     atttggtctg tgtttcctgt atctgcgcaa tgtgcaggga cagctctgga atcataagcg     79500
     ggtttatcgg atctatcggg aacaggaact caacctgcgg attaaacccc gcaggcgtct     79560
     ggttcgcgaa aagcctgaaa agctgtcggt tccggccctt cccaacacgg tctggtccat     79620
     ggatttcatg gcggacaggc ttttggatgg acgcgctttt cggctcctga acatcctgga     79680
     tgagttcaat cgtgaaggac tggcgatcga ggttgatttt tccctgccgg cctgtcgggt     79740
     tgtccgctgt ctggaacagg ttatggagtg gcgcggcagg ccagaagcca tccgaatgga     79800
     taatggccct gaatatgtca gtcatacgtt ggtttcatgg gccgaaaaac aggggattac     79860
     cctgatctat acgcaaccgg gtaatccgca gcagaacgcc tatattgaac gctacaacag     79920
     aactgtccgg caggaatggc tggagcagta tctgtttgaa agcattcagg acgtgcagga     79980
     ggtcgcaaca caatggctct ggacatataa ccatgacaga cccaacatgg ggaacagcgg     80040
     gctaaccccc gcccagaaac taaaaacagc tgcctgaatt ctcattcaat gccccactaa     80100
     aaatgggggg attacccttc aacgacctgc gcaacacagg gcagttcacc ttcggcgcgg     80160
     acgcagtgct cggcttttga ggacaggcaa ttgttaacgc agcaactcac atctcgaaag     80220
     agtgtgcgga acacgcggtt tgaccaatca acattacagg agatgagata gtgtctttaa     80280
     cagcaccggc ctccgttcag gtcggaaagg gggcagcggg acatgatgct cgtccagccg     80340
     gctttgccgc aatattaggc gcgctcgggg tcgtgtttgg cgacatcggc accagcccga     80400
     tttatgcgtt gcgcacgact gcacaggtcg tatcggatca tggaaccatc gccgcgagcg     80460
     aggtgttggg ggtcgaaagc ctcctattct ggacgctgat gctgattgtg acggtaaaat     80520
     atgtcattct tgttatgcgc gccgactata atggcgaggg cggcattatc gccctgatgt     80580
     ctctggcgca gcagaccgcg aagcgtagat ccgtcaagct tcttcttggc atgaccggtg     80640
     tcataggagc ctgcctgttc tttggcgatg gtatcatcac accagcagtc tcggtcatct     80700
     cggcaatcga gggcattgag gtttcctttc cagccgcgag ccatcttgtg gttccgttat     80760
     cgattgtcgt tttgatcgga ctgttctcga tccagtttca tggcacgggc aggattggca     80820
     tcatctttgg tccggtgatg gtggtctggt ttctgatgat cgggattttg ggtgttcttg     80880
     cgatcattca tcatcccggc attctgctcg cactttctcc catctatgca atcatgttca     80940
     tcgcccaaca tggttatctg tcgttcctgg cccttggttc cgtagtcctg gccgtgaccg     81000
     gtgccgaagc cctttatgcc gatatgagcc attttgggcg caggccaatt cgtgaagcat     81060
     ggttattttt tgtccttccc tgtctggcac tcaattattt cggtcagggg gcattgctga     81120
     tctctgatcc ggcaacgatc tccaatccgt tctttctgct gggaccgcaa tggctccagg     81180
     tccccatgat catcatatcg acaattgcaa ctgtcatcgc cagccaggcg tgcatatccg     81240
     gcgggttctc cttgtgccgg caattgatcc aactcggtta tgtgccacgc atgcgaatca     81300
     tgcatacaaa ccccacggaa gagagccaga tatacctgcc cggtctcaac cattcgctca     81360
     tggtgggcgc gttgcttctg gtcatcgcgt tccgtagttc cgaagctctg gcgtctgcct     81420
     atggcatcgc cgtgaccggc acattccttt gcacctgcat tctggcggca gttgtttatc     81480
     gggatcggta caaatggtct ccctgggcga ccatcgccgt gtttggcggt ttttttatca     81540
     tagacggaat tttcttcgcc tcgaacacat tgaaaatcat tgagggcgga tgggtaccag     81600
     tcctgcttgc agcggtgctt atcctgatga tgttcacgtg gaaaaaagga cgaagtctcg     81660
     ttcttgcgcg gcaacagcat gacgctatgt ccgtagcggc attcatggca cgcctccctc     81720
     attcccgaag catcatccgc gtgccaggga caggcgtgtt catgaccgca aatcctgaat     81780
     ttattcctac atctcttctt cataatctca agcacaacaa ggtactgcat gagcatgtgg     81840
     taatcccccc atttttagtg gggcattgaa tgagaattca ggcagctgtt tttagtttct     81900
     gggcgggggt tagcccgctg ttccccatgt tgggtctgtc atggttatat gtccagagcc     81960
     attgtgttgc gacctcctgc acgtcctgaa tgctttcaaa cagatactgc tccagccatt     82020
     cctgccggac agttctgttg tagcgttcaa tataggcgtt ctgctgcgga ttacccggtt     82080
     gcgtatagat cagggtaatc ccctgttttt cggcccatga aaccaacgta tgactgacat     82140
     attcagggcc attatccatt cggatggctt ctggcctgcc gcgccactcc ataacctgtt     82200
     ccagacagcg gacaacccga caggccggca gggaaaaatc aacctcgatc gccagtcctt     82260
     cacgattgaa ctcatccagg atgttcagga gccgaaaagc acgtccatcc aaaagcctgt     82320
     ccgccatgaa gtccatggac cagaccgtgt tgggaagggc cggaaccgac agcttttcag     82380
     gcttttcgcg aacaagacgc ctgcggggtt taatccgcag gttgagttcc agttcccgat     82440
     agatccgata aacccgctta tgattccaga catgtccctg cacattgcgc agatacagga     82500
     aacacagacc aaatccccat ctcctgtgag cctgggtcag tcccacaaga agatcggcaa     82560
     tcctgtcatt ctccgctgcc agtcgcggac gatagcgaaa gcaggtctcg gatatcccaa     82620
     aaatccgaca ggccagcgca atgctgaccc catgatgcgc cacagcctgt gcggccagtt     82680
     cccggcgctg ggctggccgc ttcatttttt tccaagggct tccttcagga tatccgtctg     82740
     catgctcaaa tccgcataca tgcgcttcag ccgacggttc tcctcttcca aagccttcat     82800
     ctgactgatc atcgaagcat ccatgccgcc atatttcgcg cgccaccggt aaaacgtggc     82860
     gttgctgatc ccatgctccc ggcacaggtc aggaaccggg acaccgccct cagcctggcg     82920
     gatcacaccc atgatctggg cgtcactaaa gcgatcactc ttcatcagaa tctcctcaat     82980
     tcttacgctg agaaaattct cattcaaaag tcactctttt tatgggggga ttaccatgtc     83040
     attcttctga cggtaaaaaa tctcgatctt ccgcaggtga tgactgatca gcgcgcggaa     83100
     gtcgcggagg tcgcgccgaa tatttatcgc gtcactcttc gttacggctt catggaaatg     83160
     cccaacctgc cgcccgcgct ggcgcaacta caatttgaga gtaccggttt cgacgtttcg     83220
     caggcttcct acttcgtctc tcgcgaattg cttgttcgtt cgcggccgtc ccatatctcg     83280
     cgttggcgca tggcgctctt tcttcttatg acaaaaaacg caacgcctat taccgacttc     83340
     ctgcgcattc cactcgatcg agttgtcgaa cttggcgtcc gtatcgggat ctgatgacca     83400
     tcgcgccgta cgaagcggcg tggtataccg acaaaaataa ggtgcatgaa aaaatagtat     83460
     aaaattaaag cgaagtttga cctgtctcaa tctgaataaa gccaggtatt cctgtcaaaa     83520
     accagaggaa tttcttacaa tatgttcaaa gaacgtattt ttgacctgtt cgaacaatgt     83580
     gtgatgacga tgttgatttt cactgagaac tgacccgggt ttttcatcag gaattgaccc     83640
     agccagatgc tatttcaggc acagtcgggc gggcggtcaa gaagaggatc tgtcctttct     83700
     gttttttgac gcggcggtgc tggcgcggaa cctgtagctg tcatttcctg tctcgaggat     83760
     atgacagtga tgggtcagcc gatcgaggag cgtcgttgtc atcttcgggt caccaaagac     83820
     gtctccccat tcactgaagc tcagattggt tgtgatgatg acactggtgc gctcgtagag     83880
     gcggctgagc agatggaaca gcagggcgcc cccagacgca ctgaagggga gataaccgag     83940
     ttcatcaagg atcacgagat ccaggcggag cagcctgtcg gcaatctgcc cggcccggtt     84000
     ggcggtcttt tcctgttcga gcgcattgac caggtcgacc gttgaccaga agcgcgcctt     84060
     cttgcggtga tgggtgatcg cctggatggc cagcgcggtc gccaggtggg ttttcccggt     84120
     tcccggaccg ccgatcagca cgacattttc agcacgctcg atgaagtccc cgctatggag     84180
     ctggcggatc atgggctcgt tgacctgcgt atcggcaaag gagaacccgg acaggtcctt     84240
     gtaggcgggg aaccgggcgg tctttgtctg gtaggcgatg gagcgcactt cgcgttcggc     84300
     cagttccgcc ttcaggagtt gtgagaggat ggggatggcc gcctcgaagg caggtgcccc     84360
     cctgctcgat gaggtcggcc gtggcctggg acatgccata catccgcaat ccacggagca     84420
     tgaccacaag tgaagcagcc gcaggatcat gacgcatggc ggctgtccct tcgcaggatg     84480
     tcataccgcc ctgtatcggc gcacggttcg tgttcgagca ccagggcctg tggggcatcg     84540
     agccggggaa ccacggttct cttggcatcg atcaggcgat gaagcgtatt gagaacatgg     84600
     gtcttggtcg ccacgccgtc ttcaagtgcc agttcaaccg cgcagaggac agcctgctca     84660
     tcatgctgca gcacaagggc caggatttca gccatttccc ggtcgcctcc aggccgcctg     84720
     agcagttgat cctgcagggt ccggaaggcg gctggcaatt cggtaaacgg cgcgccattg     84780
     cgtagggcgc ccggtttgcg ctggatgacc gccagataat gccgccagtc atacaccgtg     84840
     cggcctggca caccatgcga acgcgtgatg atccggtcat gcacgcacag aacctgccct     84900
     tcggcgataa tgcgcagcct gtcgggataa acccgcaggc tgaccggacg attggcaaag     84960
     gaggccggca cgctgtagcg gttgccatcg aactggatca ggcaggttgg tgagacgcgc     85020
     ttggtctgtt cgacaaaccc gtcaaaggga cgccccggca ccatgaggtg aggacgctcg     85080
     ctagcatgga cctcggcgat gctccgggcc agttcgatat gctgcagccg ttcccagcag     85140
     tccaggcagc gggcttccag ccaggcattc agcgccccca gatcaggaaa ggcaggcaga     85200
     tcctgccaga tctggcgccg ggcatcctgc acggtcttct cgatctgccc tttctcccat     85260
     ccggctgccg gattgcagaa ggtcgtctcg aacaggtaat ggctggccag ggccatgaag     85320
     cgcagattga cctgacgtgc cttgccagag ccaatccggt ccacagcggt cttcatgtta     85380
     tcaaaaatac cccgccgtgg cacgccaccg agcacgcgga aggcctcggt cagcgcatca     85440
     aaaagcatct cgtgggtctg caggggatag gccctgagta tgaaggcccg gctgaaggac     85500
     agtttggtgt gggcaacctg cagcttgacg cgacggccgg caatgaccgc ccagtcctcg     85560
     ccccagtcga actggaacgc ttccccgggc tggaagcaca ggggcacaaa aacaccccga     85620
     cccgttgtct ggcgtgcctg gtgctgttcg tgtttccact gccggatgaa agcggccacc     85680
     cgtccgtagg atccatcata acccagtgcc acaaggtctt catgcagtcg tcgcgccgtg     85740
     cgccggttct tgcgggggcg agcggcttcc aggaccagcc atcccctcag cctgtcagca     85800
     aacgggtcca gtcggctggg acgttcgggg acctggaacc gcggttcaat actctgtgcc     85860
     cggagatatt tccggatcgt attgcgtgac agtcccgtcc ggcgttcgac gcggaaatct     85920
     cacagaaggg ttgtacatcg ggttagatta tgaaaaagtc tgttttgtag aaaagaaatt     85980
     tccataatca tcaagaaaac ccgatgcaga cagagtgtag cgcaggcgcg tatgagtttc     86040
     cagcctcctg tggacggcgt gttgtggccc gttttgacgg gggtcgcatg agttcggatg     86100
     ggggcgtcat tgtggtgaag caggctgatg acattctggg tctcagccgc cgctttgctg     86160
     cctgttttcg cgataagcgg catcccggct ttgtggaata ccgggttgaa gaccttgtcc     86220
     gtcagcggat catgggcctg gcactgggct atgaagatct caatgatcac gatgccctgc     86280
     ggcatgacct gatctttggt ctggcctcgg gccgtctgtc aggaggccga gcaaactgcg     86340
     cagcattggc tggcaaatct acactgaacc ggttggagcg cagtgggcac aaggcagatc     86400
     gttactgccg catcattgct gatcatgagg ccctggcgac cctgttcgtc acgctcttcc     86460
     ttgaccagca tgagcacgca cccgcccgga tcgttctgga tgtggatgcc accgatgacc     86520
     gtatccatgg ccatcaggaa ggccgcgcct ttcatggata ttacggccat aactgctatc     86580
     ttcccctgta tgtcttctgc ggggaccatc tcctcagcgc taccctgcgc acggcagaca     86640
     gggacccggg gaaggaagca ctggcagaca tccgccggat cgtggagcag atcaggagcc     86700
     gttggccccg ggtgcgtatc ctggtgcgtg gggacagcgg tttcgcccgg gacagtctga     86760
     tgacatggtg cgaagacaac cacgttgact tcctgttcgg gcttgcaggc aacacccgcc     86820
     tgtatgaccg gattgcctct ttgtccgctg aggttcgtga cgaagccgcc acgacaggca     86880
     gagctgcgcg cggtttcgcc tcctttgact ggatcacaaa ggacagctgg acgcgccgca     86940
     ggcgggtcgt ggccaaggcc gaatggcgcc acggcaaccg ctatcatcgc ttcattgtca     87000
     ccaccctacc gcagggaatg tccgaccccc gccatctcta cgaacagatt tactgcgcac     87060
     gcggggatat ggaaaaccgc atcaaggaat gccagatgga tctgttctca gacaggacct     87120
     cgtcccacac catccgggcc aaccagctcc ggctgtggtt ctcggccgca gcctatgtcc     87180
     tgctgaccgc tctgcaaaga ctggcccttg gccagaccag cctggagacg gcgacctgtg     87240
     gcaccatacg cgcacggctg ctcaaaatcg cgacacgtgt aacgctcagc gtccgtcgga     87300
     ttgtcctgtc catgccggac atgttcccct gtcagcatga attcgccctc gctcatgcac     87360
     gattgcgaag gctccggcag gccatctgaa gaaacagaca gtgcacagac cacatagctt     87420
     ccaccaacac tgccttctca ggccgtgaca ccctcactgc gttcagaacc cgccgccaga     87480
     agcacaatat cgtcaatatt ccagatcggg ctcctgtggg atgactgaat tctacaaaat     87540
     gacccgaaat tgcctcaagt gtgagaaatc cgcgtcgagg cgttagaccc cgagagcaat     87600
     cagacctacc tgattgatat gccgaccggt ggtgatcctc atgctcattt tcataacacg     87660
     atgttcaata tggttgtcac agatgacggt catgttggat ccttggatac aaaacagctc     87720
     cgatctcgtg tccacgagtt tggtgcttac ttccaggcta ttcttgccca ggaattgcgt     87780
     aaaattggta ttgcccagac gtatgacgcc aatgaacagg caaccgtcgt ctcagcggtg     87840
     ccacaggaaa tttccgattt tttcagcaaa ggtcgccgca acgtcctgaa agccgctcag     87900
     tcctatgcct ctgaacaggg gctggaatgg gataaactgt ccatcgagcg gaagcagaaa     87960
     atgctttcca tggcaggatt agccgcccga ttgggtaagg atctggacgc tgacgaccac     88020
     gatatttgga agcggcaggc gaaggagctt ggttgggttg agcaaagcct gatgggtcca     88080
     gagattgatc cgggcttaga ttgaattgcc ccgggttttg tggagacgtt ttttatctga     88140
     tttaagcggc taatgcatgt gatttctgtt gtgcataaaa gcgtgcctca gcttctgctg     88200
     gcgggatgtt tccaatggag gacaggagcc gccgattatt gaaccagtcg acccatttaa     88260
     gtgttgccag ttcaacagct tccctgtttt tccatggccc ctgccgatag atgagttcgg     88320
     ttttgtaaag tccgttaatg gtctctgcca aggcgttatc ataggaatcc ccaacactgc     88380
     cgacagaagc aacgagcccc gcttcagcca gtctttgcgt gtagcgaatg gacacatatt     88440
     gacagccgcg gtcggaatgg tggggcactt ttccctcagg ctgcctctgg cacagagcct     88500
     gctcaagggc atccagtacg aagtcggtat gagccgttga ggagacacgc caacccacaa     88560
     taacccgtgc aaagacgtca atgatgaagg ccacataaac aaagccctgc caagtggaaa     88620
     catacgtgaa atccgaaacc cacagtctgt tgggggcagg agcatgaaac tggcgctgca     88680
     ccagatcctg cggacacgga cgttgcggat caggccgtgt ggttctgacc cccttgccac     88740
     gaatgacgcc tttcagcccc atccggcgca tcagccgctc tacgcggatt tctcacactt     88800
     gaggcaattt cgggtcattt tgtagaattc agtcatccca caggagcccg atctggaata     88860
     ttgacgatat tgtgcttctg gcggcgggtt ctgaacgcag tgagggtgtc acggcctgag     88920
     aaggcagtgt tggtggaagc tatgtggtct gtgcactgtc tgtttcttca gatggcctgc     88980
     cggagccttc gcaatcgtgc atgagcgagg gcgaattcat gctgacaggg gaacatgtcc     89040
     ggcatggaca ggacaatccg acggacgctg agcgttacac gtgtcgcgat tttgagcagc     89100
     cgtgcgcgta tggtgccaca ggtcgccgtc tccaggctgg tctggccaag ggccagtctt     89160
     tgcagagcgg tcagcaggac ataggctgcg gccgagaacc acagccggag ctggttggcc     89220
     cggatggtgt gggacgaggt cctgtctgag aacagatcca tctggcattc cttgatgcgg     89280
     ttttccatat ccccgcgtgc gcagtaaatc tgttcgtaga gatggcgggg gtcggacatt     89340
     ccctgcggta gggtggtgac aatgaagcga tgatagcggt tgccgtggcg ccattcggcc     89400
     ttggccacca cccgcctgcg gcgcgtccag ctgtcctttg tgatccagtc aaaggaggcg     89460
     aaaccgcgcg ccgctctgcc tgtcgtggcg gcttcgtcac gaacctcagc ggacaaagag     89520
     gcaatccggt catacaggcg ggtgttgcct gcaagcccga acaggaagtc aacgtggttg     89580
     tcttcgcacc atgtcatcag actgtcccgg gcgaaaccgc tgtccccacg caccaggata     89640
     cgcacccggg gccaacggct cctgatctgc tccacgatcc ggcggatgtc tgccagtgct     89700
     tccttccccg ggtccctgtc tgccgtgcgc agggtagcgc tgaggagatg gtccccgcag     89760
     aagacataca ggggaagata gcagttatgg ccgtaatatc catgaaaggc gcggccttcc     89820
     tgatggccat ggatacggtc atcggtggca tccacatcca gaacgatccg ggcgggtgcg     89880
     cgctcatgct ggtccatgaa gagcgtcacg aacagggtag ccagggcctc atgatcagca     89940
     atgatgcggc agtaacgatc tgccttgtgg ccactgcgct ccagccggtt cagcgtggat     90000
     tttcctgcca gtgctgcgca gtttgcccgg cctcctgaca gacggcccga ggccagacca     90060
     aagatcaggt catgccgcag ggcatcgtga tcattgagat cttcatagcc cagtgccagg     90120
     cccatgatcc gctgacggac aaggtcttca acccggtatt ccacaaagcc gggatgccgc     90180
     ttatcgcgaa aacaggcagc aaagcggcgg ctgagaccca gaatgtcatc agcctgcttc     90240
     accacaatga cgcccccatc cgaactcatg cgacccccgt caaaacgggc cacaacacgc     90300
     cgtccacagg aggctggaaa ctcatacgcg cctgcgctac actctgtctg catcgggttt     90360
     tcttgatgat tatggaaatt tcttttctac aaaacagact ttttcataat ctaacccgat     90420
     gtacaaccct tctgtgagat ttccgcgtcg acggagagac cgacagtcgc ctgcgcaatg     90480
     atcggaaatc tccttccaat agctgcgggt gtgttgcctg ccgatttgac ctctgcaacc     90540
     agacgctcaa aggcaggttc cgttactggc gcatggagct ccgaacgata actgccgttt     90600
     tcgatggttt ccagcacagc tcgggtttca tcgtccggtg cactgccatc cagcaccagc     90660
     ggagcggaca acataacagg ttgcgctgta cggatgacgc ctgttcgtcc gttgacggcc     90720
     gcgaagaatg tcttggaatg gacgaccttg ccaccaaaca tggtgatcgc ctcgccttca     90780
     ataagggatt gtagatctgc ccatggaatt cgtgcgactt cgcggatttc tgcaccgcga     90840
     ccttcgcgat aactgcctgc cgaattgccc tcatagtgag tggcttgtgt gacttccaca     90900
     cggtctgcct gcttttcgat ccactcgcgc gtcctcatgg cgtcctgcag acgcatggca     90960
     tgggtcagat tggcatttcc caaaagcgta aatgccttat ctccaatccg gctggtcagg     91020
     cccggcagat cctgaaatcc caaccagaac atgcagttca ggccgcgtcc catagcgagc     91080
     atccggtcca tgccatctgt ggcgtaggca ctcagttcgt cgaagaaaaa ctggtaaggc     91140
     gcatcccctg atccggcctt gagtttgaag atctcggaag caggaccatt gaggcgggca     91200
     ccaaggagtt gagccataac agcccgcact gatgctacga tgatcttccc cagtcctgcc     91260
     agcgtgtcag aagagttctc cagtgacggc aggatcacga ccagaacacg acggttgagc     91320
     accacatcac gcatgtcgat atcgccgttt tcacatttga aaatatgccc aagcgaaaca     91380
     gcgaactggg tgaagatttt ggagaaatac atggtcgcaa agccatgttg ctcagaagga     91440
     cggctttctt tctgctgatt ccattccagc ccgatatcgt agccgggaag ctcacccaga     91500
     taggcctgaa aaggatagag tacatcatca ggaatgtctg gaaccgggat cttgatgggc     91560
     tgtggctgac cggggctgcg gacaaggaag atcttgtgtc gggccaaggt tgccagccaa     91620
     cgcaattccg ttgcgaaacg gatggtttca atgttgatgg agataccatg ccgatcgcgc     91680
     atccagacca atgcaggcgt cagtgttccg atcagattga cggcacggtc gcggaagacg     91740
     ccgttggcat cgttggaaac aggttcaccc aactgactga ccagcatttc gcggatggcg     91800
     tcagcattgc ctgtcgcaaa cggattaaac gtatttgatt cccggatgga gctggcggtc     91860
     agaagattga gggtcaggag ttgatcatcc agcccgaagc gtctgaggag tgctgcgaca     91920
     tcaccataga ccgtattgtc gcctttccca tctatcagca gaaacccaga cccatgagag     91980
     aggggattgg ccatcaggga gagcgccgag gttgttttgc cggcccctgt tgttccaggc     92040
     atggcggcat gctggcggcc ggcatcagag gagaaccaga gttgctggcc tgtatgcgca     92100
     tcagtgccca gatagatgat cccgcccgct ttcttgggtt tgcgtgtgct gggatcgaga     92160
     tcatgtgcat caggaagttc tgaatatcgc ggcagatgaa aaggaagcaa cggcttgcgg     92220
     gtaacaaccc aacacgtcag gagaagagct agaggaaggg tgagaccgac cagggcgggg     92280
     ataaaccaac tcagcccggc cacaatcagg agcacaaagc ctgacgagga tgtccgcatt     92340
     tccgctgtaa aacgctcgaa cagcgggcgg gtatcacggt aggtcgcacc ccgcttgatt     92400
     tgttgatggc caagtggacc accaatctga cgtttcacca tcgatcaggg ctccagaccg     92460
     aacggagagt tgcttttgga actggtgtca gatgagccgg gttggggcag acccacgact     92520
     ggcgcgcctt ttatggtcgg tgcaacgcca gctgttgggg cacccccttg attcagcccg     92580
     gctccagttg ggcctgttcc atcaggtctt tgttggggaa gccctatacg gtctgatgct     92640
     attgcccgtt gcgtatctct gacggtttcg ttaacgcttc gcggtccttc ttgaccgtct     92700
     ggaccgtacc cgcctgaggg agatgaggcc ccgatcggcc caccggagag cggcggtagc     92760
     atgggttgct ggggtatcgt atttccggga tcctgcatca tgggcgtagg tatctgtgct     92820
     ggtcgggaac cgatgatcac aatggcagca atgaccccga gcgcgacacc tggcgcatag     92880
     tttctgaggc agtttttcca tccagatggt gacgcagcag ttggggacgt ggacggtaag     92940
     gcatgggctg gcggagaaag aggatggggc tgagggtgtg tcagataatc ctttttgctg     93000
     acagtcatgg tgttggagtg tccaacggtg atgacgatag ggggctgacc ttcggtttca     93060
     atggtgatcg tggtcatctt ggttgtcctt cagctctgat ctgaattttt ctggagtgtt     93120
     gcgacagcaa ccgaaacggt tggcgtgtag atcgggcgac gtgccttgcg ttcggcttcc     93180
     cagtgggcac gtgcaccggc tgcttcaaca cggggattgg ggtggacgtc ttcctcaggc     93240
     cgctcgtgag ggaaatccag tgaatgcaga gcgtaccaga gagatcgatc tatcagcttg     93300
     acgattgcaa aggctggtgg cgccagaacg cctgccttgc gccgtgcttc ggtcagaagg     93360
     gtcataagcg cagtcgtggt ccatccattg cgagcgcaaa tcgtatcgat tttcgcactt     93420
     acaccgggaa cactcagctt ttcgtcggca atggagataa tttcgctggg aacagaaagg     93480
     gctgatttgg gaccctctgg tccatccagt ccggccttgc gcagactttc ggatagccga     93540
     ccaagcagat ccatcgcctc agcccgttcc tggctatgat gagcgatgaa ggcagcgaac     93600
     agaacgcgtt caacgggcgt ggccgcgtca agtccggtcc agtgcctgcc aagttgcgcc     93660
     gtaaacgccg aaatggcgcc tgcctcgctg aaatgaccgt tccgatctgt agcgaaccga     93720
     gcccgccatt catgggcgtg aagcgcagga tccgcagggc ggggcattcc ttgggctgga     93780
     gccaccaatt tggtcaggcg ccgctcggcg aaaccacgca gtgtcggaaa catacgggcc     93840
     tggacttcaa tcagtccctc aaggtcaagg gctttagcga agcgaccagg cgttgctctg     93900
     aagatgcatg tgatccccag cgcagcaatg atgatggcaa caggccagcg caatgcgctg     93960
     cccagtatca tcaaaccgta ccagagttga atggcccgca catgctctgg cgaccacgag     94020
     gctgttacga gctgctggcg taactgaacg agcggctgtg aatgcaggtg caggaagtca     94080
     atctgccaga cgagtgctcg gatatacagc agggagatct cggcgtgcca gttggaccac     94140
     accatgtagg aaagtccggc tccgccaaca ataatggcaa tgatggagaa cagggcatag     94200
     tcatcgctgg atgaccaggg agtgctactg ctgctcatga cgcacgtcct ttgcgggcac     94260
     gtaccatcat atccgttgcg atgtggtaga aacgtctgag atacgcttct ccgtaacgtg     94320
     gggtatgtga gtggtaatag gcgacagcct gccagagatc tccatgcgtc tcggacagag     94380
     cctgtcccag gatccagctt ccagcctcga tattggcgca aacattgtct cgtaatgccg     94440
     tgtaggtacg gagcggcgtg ctgtgccaat gcgctgcgac cttgcgaacc caggtcgaat     94500
     tgacctgcat gggccccaga tccaccgtgc cattggaatt ggtgctcacc atccctggac     94560
     gcccgttttc gacataaagc agaacgagga gaacgccagc aggcacgcgc gcattggatg     94620
     ctgcagccgt gagacaggcc tgtacacgtt gtccctgcac aaaggcatcg tcctgtgctg     94680
     tctgggcgtg cgagatgcgc gtaagtccga gtgccagaaa tgtggcggta agaagcgaga     94740
     ggcttttcat cagcttgcct cctgaagtgg tacgggaaca gtctgtagac gggatcgggc     94800
     gttgccccag agctcgacta gatcgttcag acgcagcgtc tcttcgttca gggcaagtgt     94860
     ttcgaaaagg tctatgatgc acagcatcag tacagaccat gatccggccc gtatgccgtg     94920
     gagagagtag cccagtgtgg cctcagcatt ttcgcgcaca tccagcgcaa aaccggtgcc     94980
     tgtcaggtca aaccagagcg cttcggctgc cacgacgatg acaggaagat aaccatcggc     95040
     acgggcgatt tcctcgtgac tgaccgaggc ctcttgtccg gtagcacgat cgaccacaat     95100
     ggctggacgt tcaatttctg acagaagggt aaggacacca tgtgcgacat catcaacccg     95160
     cacgatggaa gcagatatgt tcatgagtat ctccgtcgct tccatgtcgg gactgccgtg     95220
     cgtctcctgc caatgagcca gcggcgcgcc gtccgcaggg cagcaggcaa ggtgagccca     95280
     aaaaacgaaa tggtgccaaa aaaggctgtg cccagcactc cgatgatcaa tgttgtccaa     95340
     ctccagtgaa caactgccag caaaatgggc agacagcttc tggcgtccag aataagaaac     95400
     tttacgggta agcctgttcc gcgccacatc aatcatctct cctttttgcc atgagtgcgg     95460
     tttcttcggt gatcaggccc tgttcgaggc gggcatcgat ggcacgcgca tagctttggc     95520
     catccgtttt caagacatca ttgatgaact cgggccagca ttgtggatcg gtgcgcatca     95580
     gcctgaagcg caggtcgcgg tcaaaggtca ggaattcgcg gatcgccaca cgacctcctc     95640
     ctttgcgtgg gagaagacgc tggttcagac agaagcgcat tgattgggcc agagcggaga     95700
     caagattgtc acgttcttca cgggcacaga gtgagacagc ccgttgcatc atgagaccca     95760
     cattgtctgc atggattgtt gtgcccaaaa tgcttccggt gatcgcgcag ttgatcgcgg     95820
     catccatggt ctcgtgatcg cggcactcac cgacaatcag ttctgtcatc tcccgacggg     95880
     tcgttccgcg cacgaatttc gcaaacgtca tgtggggcgg ccggatctcg gtctgggtga     95940
     tttttgatcc cgtgggagac cggatatagt ccatcaggaa ttcgactgga gattctccgg     96000
     ttgcaatgtt gcagtttgca tcaggccgca tgactttttc ttcggccaaa gcaaaggtga     96060
     gagatgattt tccttgcccg gttgcgccac cgatgagttt catgcccgac ggaatgtcgt     96120
     tgctggccaa aacttcaggt tcgacattct gagacgccag actgggcggt cgggaaggaa     96180
     tagggcgcat gacgatgttc acaccctgtc cacgcatgac ttcgcacggg gtgaagttca     96240
     ctcgaaaacg cagggtttct cgccggttga gtgaaacgga atatgcgcta tccagatcat     96300
     ggtagatggc gagcatggac atcccgtcct gcgcatacat atggctgaca acgtcggcaa     96360
     ttgcgaagtc atctgtcgcg ccacgtgtcg cacagcgaac tttcccatgc accagaatgg     96420
     tgacgggatg gcctgtcttg aaatcgatac gggaggcgcc cagccggtag gcccatttca     96480
     gaaggtcatc cagtcctggc gcatatttgc ggcgttcaac cacccatgtg tagccggaac     96540
     gcccttcgtt ttcccaggtt tcgcgttctt ccgggggagt aatgatgacg ttcatcggca     96600
     gcgctccggg taaagagggg cagagaagcc atatccacga tcacgacgta gcccgcgaag     96660
     accaggttgg ctggtgatgc gcacaacacg atccccaaca tgcagggtgt cgccgccacc     96720
     gaccgatgcc ttctgttcaa acaccacatg gggttcttca actctgccgt tggccagaag     96780
     aacccgatag cgggccatgc ctacgatatc gcgctgaagg cgggacaggt cggagagaaa     96840
     aatctccgtg gcctgctttt ctccggcagc ccagccttcc gcaacccagt cgttccagta     96900
     tcccacttcc tttctgttca tgggaagagc ggctgcggca ggatgttgtg gcttgcgcca     96960
     tgatctgacc agataggttc gccagttggg cggagctgat gtcagctgtg cttctcgggt     97020
     aatttcaaaa acacattgag tttcatgcgc gacctgacca gtgccgttga gggcgaatgc     97080
     catctgggcc tcggtgacga ttgggggctg cataagcgtc tgaccgctcc cgatgggcag     97140
     gacaagggag cgaaaatcaa atgtcgcatc cagtgtatct tcatagcggc gcagcatttc     97200
     attgatggcg aaacttcgtg ctgcaagccc accctgagcg ccatagatgt gagccgcttc     97260
     ctgcaacgcc tccttgcgtc cgggttttaa gccgtcagat ccttcatcat tggggcgcgt     97320
     gttttgcagg gcttcaagag acagtggccg atcacctcca acaatcttgt cgagttcctg     97380
     agcaccagta atcggcttgt tggtcggatt agccaatgcc ggctcagcct gttcaatgtc     97440
     gtcggccgct ggttctgggg gctgaggcat tggaacaaga gtgccattgg gagctgtagg     97500
     tggtgcgctt gtcttgaaag gaataaggcg tccgtcgata tgcggtgcct cctcagcaag     97560
     accgggccga acgaaggttg ccagcatcgt gcaggccata agcgtgtagt ggatagtctt     97620
     acgcatgata gaccaccgca atctgatgat ggaaaggatc aacctgaact gtggccgcat     97680
     caccggcctg atcaccgaat gatcggagaa tatcgagaac ggcagctaca ctgtttgttt     97740
     ggacaggaat atcatggctt ttgccaaata cggttacagt gtaaccgatt tccttgccga     97800
     gcttacggac accagcattc agtggacctt tccagacaaa ccatatccga cgattgatat     97860
     catcaggagt gctggactgg tctgcgacgg ggacagatgg tgcggcatga atcgtaccca     97920
     gttcacgcag atccgcagtg gtactcgaaa tggagcgttg cagcgccaat tccggattgg     97980
     gcatgccggt cgtttcaata gggccgggtt ttatgtgccc tgaacaggct gtaagcccga     98040
     tagtgagggt tgcgaataga aaggaggtct ttttcatggt caactccgtt tatgaaaaca     98100
     gagtgagcct tcatgatgcg accagtttaa aaaaaatggg ttccagagga tttaatcccg     98160
     caaaaaaaag gcgttagagc ctgttagcac ttaaaattct ttctatcttt tatagatgga     98220
     agaaggagac ggaacagtca cttttacaga caagacatgg tcgttctgtg aacctctaat     98280
     tgaggctgtt cggccgaggg gtaagacact gccacgggat ctgcggcgca cgatagcagc     98340
     gattttctgg catcatgaga acggtgcgaa atagcggatt atccctactg aactgggtcc     98400
     gtggtggcgg gcggcacaac tttttatccg ctggctccag atatgctcga tatccttccc     98460
     gccgttcctt agtgggtggg ggcggacaag gcacatttaa ggggagagag cgttgtcttc     98520
     tctcccattt tctatgagcc tgaaataaga gctttacaaa aggtagattt tagctatatt     98580
     ttgaacgatg aaacagataa ggagaccaga tttcccatcc ctctaacgcc tgccacataa     98640
     ggctgtgaac agcctgcaag acatccattt aaagatggac cccagatcaa aagcaaatcc     98700
     tatgtgatta gctaaaaaca atcatataat cgaattgttt tctgtagtgg atacaggagg     98760
     caaggaaaca tcatgacatc ttcaaatgca atctctcagg tcaacctgaa agttaatacc     98820
     caactaaagg aaaacgccta tgcgacatta aaagaactgg gaacaacacc aagcgatttc     98880
     ttcagagata ttctcgaata cgttgtgagg gaaaaaaaat tgccgataaa acggctgacg     98940
     gtatccgacg aggatgccga gttttacgcg cttgtccgtg aacgattgaa gaatccgggc     99000
     aagattcata ggaacgttga tcttgagtcc ctactccgtt gatatgttgg atgcggccaa     99060
     aaaagaactg gccgcacttc ctaagacaga aaacaatcag attattaaac gtctcattaa     99120
     gctacaagat aaccctcata tcccggcttt agccctgagc ggcaatttag ctggatgcta     99180
     tgaaatcaag ctgagaaccg ctggaatacg cgccgtttac agtgttgatg atggaaagat     99240
     gactttgttg gtcatagcca ttggtaaacg agagcggaaa caggtttata agacagcatc     99300
     agatcgattt aacgaatgac ataacagaaa agccggtagg aaatcctacc ggcttttctg     99360
     cgaaaaaaaa catgagttca cacgtctatt tagtacataa taccggagac gcatttaccg     99420
     gatacagctg aataggacct agatttctgg acgcttatac acatcgctgc agcgagaaat     99480
     tggatcaagt gctaacaggc cctaaggaaa agatataatc atccccgtag agccagtgtt     99540
     tttattcggc agcaataggt atatcgttat catgatccat tgaacgaact ctatcgtgaa     99600
     cgccaacggc aatcccgcgg ccttcaagaa tttccttggc gagatcatca atcacgccta     99660
     actctgcttc ttctgccgac agacctgttt cgttaatgcg agcatgccgt cgtcgcgtga     99720
     tttcgcctat cgcggatcca tcgggaaata ctacagcgag ataccgcaat gccatttggg     99780
     agcctatggc gttgaacaat cgtgatctaa gtgctgtatc tccaggggtg gaactaaaac     99840
     tccacaactc aatagggccg agaacgttga ttagctgaac ttcatacatc ccttcagcgg     99900
     cattgagctg caaaaagaag ggagcgccat tccgacccgg gccagggagc gcatttctga     99960
     cgatccatgc actggccgtg gttaattccc atcgtgatat cagttgctca gcgtctttcc    100020
     catcgccctt tttaagcacc caacgccccg tactctgtcc cataagatca tcagaaaaat    100080
     ctcgtggacg ttgcgaaata aacccaagct ggacgccgtg ttttcggcct tcacgtgcgt    100140
     ctcttactgc ctgtgcatta acttgtggtg ccgattcagc acgatgccat tcgtcgtaat    100200
     caaggcgttt gaccgcctcc ttcatttccg tgaaacgcgc gaggtgataa tctcgcattt    100260
     tggagggcat cacgggttca tcggcatatt ctggatgaag gaaaaagttt cgcgcaatga    100320
     gatgtcgggc aagcatatac atcaaagccg tctgacgatc ggctgccgct gagcctttag    100380
     gagcaacttc tgctagatca atcatgatca cacgggcatc gcccagatcg agttgggttg    100440
     gggccgctaa tgtcggaaag ttcttgatga cattcatgat ataacgatca aaaacatcaa    100500
     ttaggctttc ccctgtttca atcctgattt tttcgtaacg cttggaaatt tcgggtgttc    100560
     tggcggctcg cagcagatcc tgcaggactg gcacggcatg acgttgagca atcccggcca    100620
     ttctgtagtc gccaacgtca atcaaggcgt caacgacatc tcgccaccag gttggatcct    100680
     cttctccacc gtgatgtggc aatgtcaggt tatgatgctg gatggcagca tcaaccatag    100740
     gctcagttcc gggtcggtag agtttgggtt cacctcccga aacgtccgtg cacagacggt    100800
     atgcctcatc aatcacgtcc tgtacaagat gatccatccc ttcaaagggg ggcttgccca    100860
     gcggcgttgc aagcagggaa ataaagtttt caaggaacac gcgctccaat gggagcgggt    100920
     attcaagtcc caattgaagg tcaaagacgt tgacttcata accttgggtt ttctgcattt    100980
     tcaggtaagc cacttcatga gcgcgttctt gtcccagcgc agcttgcagc agtgagacaa    101040
     aaccctgacc gccggggcca atatccactt tcccgatgaa cggcagtttg gcaccgtttc    101100
     ccgaaagagc tgctgaactt aacacaagac caagattgat tgtgttgctc atcacggtct    101160
     ttcccccacc gggcggcgca acaatgatat caacaattgc ctctcgcagt cctcccccag    101220
     tcggatcgaa agaccagatt gacccatcgg gcctgcggaa aagaatactc ccccgttgcc    101280
     atggcgatgc gcttcgcacc catggcatca tggtaaaagc ctcgcctaaa ggtgcgagtg    101340
     agggattggc ggtactgccc agagaaagtg ttggcaccga gcccatcgct gcctccaagg    101400
     ggtcgccact aacccgtgtt gtcttacagt tgccccatcc ttcaatcgcc tgtgataaag    101460
     ctgaggcctg acggcgcaat ttggcatcct cacctatggg agcccatgtt gcggccgtca    101520
     tgcgtaggcg aacggaattg tggtttttct tttcccgcat tgtcctcaac gcggcaaatg    101580
     aacggcggat atcttcgttt cccggtaaca ttgccagaaa acctgcgccg acctccttca    101640
     gggcgaaggc ggctccacca ccgctttcca aaatcatcgc actgcgccac gggatacgct    101700
     tgcgtccaag ggtcgctgac aattccgaaa atggacgcgg atcttcaggt ccgagttcca    101760
     tatcgaccgg cgcgtagcaa taatctccga tgttgaccag ttgaccgcct atggtatcgg    101820
     catccgcatt gaatatctgg tcacggatgg caggccagag ttccccctca agcagaggac    101880
     cttccgcatc aggggcatca ggcagacgtg gcataacacg gtcgcctatc aggcagggat    101940
     tccactttga agctgctgtt tcgcgataaa caatttcacg cgtgatgcgc agagcttcat    102000
     gcgggttgat gagagtgcag gatatatcca gaccattcaa agcgccttca atgcgatgca    102060
     cagctgcggt gtgccgtgcc agcatgattt cgctgcgcag ggcaaagcgt tgggtgtctc    102120
     caatattggg aaacgctttt gctgttgcgg cctgttcttc ggaaacctgt ttgcgttctt    102180
     cacggctcaa tacacccttg cgtgtccaga gcacataagg taatcccccc ataaaaagag    102240
     tgacttttga atgagaattt tctcagcgta agaattgagg agattctgat gaagagtgat    102300
     cgctttactg acgcccagat catgggtgtg atccgccagg ctgagggcgg tgtcccggtt    102360
     cctgacctgt gtcgggagca tgggatcagc aacgccacgt tttaccggtg gcgcgcgaaa    102420
     tatggcggca tggatgcttc gatgatcagt cagatgaagg ctttggaaga ggagaaccgt    102480
     cggctgaagc gcatgtatgc ggatttgagc atgcagacgg atatcctgaa ggaagccctt    102540
     ggaaaaaaat gaagcggcca gcccagcgcc gggaactggc cgcacaagct gtggcgcatc    102600
     atggggtcag cattgcgctg gcctgtcgga tttttgggat atccgagacc tgctttcgct    102660
     atcgtccgcg actggcagcg gagaacgaca ggattgccgc tcttctggtg ggactgaccc    102720
     aggctcacag gagatgggga tttggtctgt gtttcctgta tctgcgcaat gtgcagggac    102780
     agctctggaa tcataagcgg gtttatcgga tctatcggga acaggaactc aacctgcgga    102840
     ttaaaccccg caggcgtctg gttcgcgaaa agcctgaaaa gctgtcggtt ccggcccttc    102900
     ccaacagggt ctggtccatg gattttatgg cggacaggct gatggatgga cgtgcttttc    102960
     ggctcctgaa cattctggat gatttcaatc gtgaaggact ggcgattgag gttgattttt    103020
     ccctgccagc ctgtcgggtt gttcgctgtc tggaacaggt tatggagtgg cgtggcaggc    103080
     cagaggctat ccgaatggac aatggccctg aatatgtcag tcatacgttg gtttcatggg    103140
     ccgaaaagca ggggattacc ctgatctata cacaaccggg caatccgcag cagaacgcct    103200
     atattgaacg ctacaacaga actgtccggc aggaatggct agagcagtat ttgtttgaaa    103260
     gcattcagga cgtacaggag gtcgcaacac aatggctctg gacatataac aatgacagac    103320
     ccaacatggg gaacagcggg ctaacccccg cccagaaact aaaaacagct gcctgaattc    103380
     tcattcaatg ccccactaaa aatgggggga ttaccctatg gccctttgtc tgggactgtt    103440
     ggctacccct gcgtttgctc aacagaccga gcagggaagt gtcggatgcg ccgagttaac    103500
     tcaggcggcc gcaaatgcaa tcaaccagcg tgtacaggcc aatgatgctt acgaaaaaca    103560
     gccagatagc attggtcctc tctcttgcct tgatggtttc cttcacgggc agggtttgaa    103620
     cgtcatcaca agcggcctgg acccaatgtc cctgatccag aaccttgaaa gccagttggg    103680
     ttcccagatc tgtcaggcag ctcagagtgc gtgggggaat gccatgggag gcacacaatg    103740
     cagcctgagc ctgtcaggta tcaatctggg gcttgggttc ggaaatgtcg ggagcggcac    103800
     catgtgcccg tctctgaatt ttggcggcgg cggaccgcct ttagcctctg gcgggtttgg    103860
     gactactgga ggatctggcg gtctttatgt ggaaagcaac ccgcttcttc catcgggata    103920
     cagcgcagat agcgctatgg atggggtgtt ctgatgtcga agcaaaacag gcgaattacg    103980
     cacactgcac tgcttgctgc aggggtttgc ctcttgactg tcagcatcca gcctcaacgc    104040
     gcttatggat tcatgggtga ggctgctgtt gtcggggcca ttcatgctct gcagtctttt    104100
     atgggcaagc agatggataa agtcggggaa aacatcacca atagcctcaa cgacatgacg    104160
     aacccaaact cggtgtcatc aatgattcgc gatgccgcca cccaggaagc aaattacgcc    104220
     aagggacagg ttgcggcaca aagtcggata gcggatgcac aaaatacagc tatggcagcc    104280
     tttctgcgtc gtcagcagga aaccggtatt cgcgacgagc acatgatgtc tccagagttt    104340
     tgcggtggac tggacagtca gcagactacg atggcggctg cgagagcttc gcgatctgca    104400
     ttgggagcaa ttaccacaat cgttgaacca cgaggggaag ccgccaaagg aacgccctca    104460
     tactacgggc gggctcaggg ggttgatgca aacaccaact tccatttgag acggtattgt    104520
     tcccaagaag atgttgacgc agggctatgt agcgctgtct cccgtctgcc caacgctgac    104580
     cagcgtgcca gcacattatt catcgcggat accctctccg gtgatggtgc tgtggatgca    104640
     gccaatgatt attcaacgac actgatccag cctgttgctc cggcagctat ccggggtgag    104700
     caggcaagca gcaccatggg acgcgagcag atgctccagc gccgagcata caatgcgcgc    104760
     atgtctctgg cgaggtttgt gatggcgttc atcacgtcac tggaaacgcc ttctgtgtcc    104820
     ctgactaccg aacaaaaaag ggaaatgcag gctgaaggcc tgcaacctct tgatcgtgca    104880
     tcgtggttgc aggccatgag ccttgaggtc aatcgccgcg tttcaagcgt cagttggaat    104940
     gcagcccttc aggcaatgcc aacggccagc atcctgcgcg agattgcgac ggaactggct    105000
     cagtcaaact atctcgccat gcagaattat cgccttggac tttaccaggc atccataggg    105060
     gcgacaggta tcgcccagaa cgaggaagca cgtttgcagc atgcctcgaa caagatgccg    105120
     tctccaacca tcaatccttg aaccaagagg tcactatgtc tgaaaccctt acccagattg    105180
     ccgatctggc aaatgtcatg gattatcttg atcgcacgaa agatgtggtg cgagaacatg    105240
     ctccggatgt tgttcagcgc tttgagcgcc taaaggaacg ggtatcgacg cggatttctc    105300
     acacttgagg caatttcggg tcattttgta gaattcagtc atcccacagg agcccgatct    105360
     ggaatattga cgatattgtg cttctggcgg cgggttctga acgcagtgag ggtgtcacgg    105420
     cctgagaagg cagtgttggt ggaagctatg tggtctgtgc actgtctgtt tcttcagatg    105480
     gcctgccgga gccttcgcaa tcgtgcatga gcgagggcga attcatgctg acaggggaac    105540
     atgtccggca tggacaggac aatccgacgg acgctgagcg ttacacgtgt cgcgattttg    105600
     agcagccgtg cgcgtatggt gccacaggtc gccgtctcca ggctggtctg gccaagggcc    105660
     agtctttgca gagcggtcag caggacatag gctgcggccg agaaccacag ccggagctgg    105720
     ttggcccgga tggtgtggga cgaggtcctg tctgagaaca gatccatctg gcattccttg    105780
     atgcggtttt ccatatcccc gcgtgcgcag taaatctgtt cgtagagatg gcgggggtcg    105840
     gacattccct gcggtagggt ggtgacaatg aagcgatgat agcggttgcc gtggcgccat    105900
     tcggccttgg ccacgacccg cctgcggcgc gtccagctgt cctttgtgat ccagtcaaag    105960
     gaggcgaaac cgcgcgcagc tctgcctgtc gtggcggctt cgtcacgaac ctcagcggac    106020
     aaagaggcaa tccggtcata caggcgggtg ttgcctgcaa gcccgaacag gaagtcaacg    106080
     tggttgtctt cgcaccatgt catcagactg tcccgggcga aaccgctgtc cccacgcacc    106140
     aggatacgca cccggggcca acggctcctg atctgctcca cgatccggcg gatgtctgcc    106200
     agtgcttcct tccccgggtc ccggtctgcc gtgcgcaggg tagcgctgag gagatggtcc    106260
     ccgcagaaga catacagggg aagatagcag ttatggccgt aatatccatg aaaggcgcgg    106320
     ccttcctgat ggccatggat acggtcatcg gtggcatcca catccagaac gatccgggcg    106380
     ggtgcgtgct catgctggtc aaggaagagc gtgacgaaca gggtagccag ggcctcatga    106440
     tcagcaatga tgcggcagta acgatctgcc tgctgcccac tgcgctccaa ccggttcagt    106500
     gtagatttgc cagccaatgc tgcgcagttt gcccggcctc ctgacagacg acccgaggcc    106560
     agaccaaaga tcaggtcatg ccgcagggca tcgtgatcat tgagatcttc atagcccagt    106620
     gccaggccca tgatccgctg acggacaagg tcttcaaccc ggtattccac aaagccggga    106680
     tgccgcttat cgcgaaaaca ggcagcaaag cggcggctga gccccagaat gtcatcagcc    106740
     tgcttcacca gaatgacgcc cccatccgaa ctcatgcgac ccccgtcaaa acgggccaca    106800
     acacgccgtc cacaggaggc tggaaactca tacgcgcctg cgctacactc tgtctgcatc    106860
     gggttttctt atagcttacg aaaatttctt ttgtgcaaaa cagacttttt cataatctaa    106920
     cccgatgtac aacccttctg tgagatttcc gcgtcgattg acgtgacacg gaccttttca    106980
     cccacctcgt ggcgcaagcc ctcgctgatc gcgctgacgg cgaacttggt gccggagtag    107040
     accgtgccac ctggtgcgaa gaccttgatg cccgcaaccg agctcaggtt gatgatgtgg    107100
     ccgctgccct gctcgagaaa gccgggaagg gccgccgcga tgccgtagag cgtacccttc    107160
     agattgacgt cgatcatctg gtcccactcg tcggtgttga cctcggccat cggacggatc    107220
     ggcatctgaa ttgccccggg ttttgtggag acggaacgac ccgagaggta agaaggattc    107280
     atgagcaaca aatcgaagcg ttttccacct gagtttcgtg aacgtgcagc ccgcatggtt    107340
     ctggaggaag agaagaacca tccatcacgc tggtctgcgg tgatgctgat cgcgccaaag    107400
     ctggatattc atcctgacac gctgtcaaaa tggacccgtc tgcatgaacg tgccaatgcg    107460
     cctgcggtga gtgacctgcc tgatcgagag aagatcaggc aactggagcg agagaaccgc    107520
     gaattgcggc aggccaatga aatcctgcgt aaggcgtcgg catattttgc ggaaggagag    107580
     ctcgaccgca tcttcaagcc atgacacgct tcattgagga gcaccggcag acatatggtg    107640
     tcgggtcaat ctgcagggtt ctgtcgattg caccatctgc ctattatgca actgttgcca    107700
     gacagaaaaa tccgtgtgtg cgcagccaga aagacaaaga actgtgcgat gacatccgta    107760
     gagtgtggaa tgataatttc tgcgtctatg gagcgcgcaa ggtctggcat cagctcaaac    107820
     gtgaaggcct ggatgtcgcc cgctgcacgg tagagcggct gatgcgccgg atggggctga    107880
     aaggcgtcat tcgtggcaag ggggtcagaa ccacacggcc tgatccgcaa cgtccgtgtc    107940
     cgcaggatct ggtgcagcgc cagtttcatg ctcctgcccc caacagactg tgggtttcgg    108000
     attttactta cgtttccaca tgacagggct ttgtttatgt ggccttcatc attgatgtat    108060
     tcgcacgggt tattgtgggc tggcgcgtct cctcaacggc ccataccgac ttcgtgctgg    108120
     atgctctcga gcaggctctg tgccagaggc gacctgaggg aaaagtgacc caccattccg    108180
     accgcggctg tcaatatgtg tccattcgct acacgcaaag actggctgaa gcggggctcg    108240
     ttgcttctgt cggcagtgtt ggggattcct atgataacgc cttggcagag accattaacg    108300
     gactttacaa aaccgaactc atctatcggc aggggccatg gaaaaacagg gaagctgttg    108360
     aactggcaac acttaaatgg gtcgactggt tcaataatcg gcggctcctg tcctccattg    108420
     gaaacatccc gccagcagaa gctgaggcac gcttttatgc acaacagaaa tcacatgcat    108480
     tagccgctta aatcagataa aaaacgtctc cacaaagccc ggggcaattc aacgccgtca    108540
     gaagggcggc ataacaacaa ccgggtatag cttatcaagc ccgcaaaact gtccgaacgg    108600
     acgggaccac ctcatattag aaggcttaaa aacatggcag atgacgtaac aaccatttcc    108660
     tccaacacaa gctggctcaa ttataacggc ggcggcactc aagattctca cactccgcca    108720
     gataatgcca catctggttt aggcacaggc ccaactttga acgttaccaa tggggctttg    108780
     ctagaaattt ccggctacct gaacctaaat gcagccaccc ttaatattac agatggcgcc    108840
     accgtttccg tcgttcccaa tggtctttta ggtggggacc taactaacgc tgcaggcggc    108900
     accgttaaca ttgatggcgg caccctgacg ctcagcaatg aattcaatgg caaccagtct    108960
     gtttataata tcaccaatgg cacattatcc gttggcaatg atttcaacgg caatcaggct    109020
     gtttacaata tttataaagg tggcgtgcta gatgccggca ccaattattc caacatcaat    109080
     gccgggcgct ataatattga aggcggcacg gttatattct ccggcattgc caatattgat    109140
     gctggcaaca agattgattt ccacaacatc cccggtgggc aacttgttat tggcagcaca    109200
     tctttaagcg atctttcagg ggattccctg aatgtcgaaa actttgtgta tggagaccag    109260
     atcaagattg cctccagcac atcttatagt gatgacacgt tgtccactgc tatcagtggg    109320
     gatgatctgc ttatccagtc caccgttgat ggtaaaacca ctacggttgt gaccattaaa    109380
     ggctatgcaa catcttccgc cgccaatgta gagcccgccc ccaccgtaac ctacagcgat    109440
     ggctacattc tgtttggtga acaaagcgat actggcgcat gttttctggc tggcagcatg    109500
     gtgcgcaccc cgcagggttc tgttgctgta gaaaacattc aggcaggtac agatattttt    109560
     gtatatgact ggaaaagcaa cacagaaacc acacagcagg ttacgtgggc cgggcaagct    109620
     tttacggttg taaattccag cctgccggat gatgaagccg gataccccgt acgcattcta    109680
     aaagatgctt tggcagacgg cacgccttac aaggatatgc tggtaacggc agaacattgc    109740
     ctgttcttta acgggcggtt tgtgcctgca cgtatgctgg taaatggtgc ttccattttt    109800
     tacgataagt ccatcacctc ttatccatat taccatgtgg aaacagcaga acatgccgtt    109860
     atctctgttg atggtgtgct gacagaaagc tatctggata caggcaaccg ccgcagcttc    109920
     cgccagaaca gcaaggttgt gcagttgcac agcaaaacac gcacatggga agaagatgcc    109980
     gctgccccat tgggtgtgga tgttgatttt gtaaaaccgc tttttgataa cttcaaaaac    110040
     cgtgcacgcc atgtggctgg cagccagaca cccgccgcac ctggcacgct aacaacagac    110100
     cccaacctgc acttggttac gcaaacaggt gcggttattc ggcctgtgcg ctgcgccaac    110160
     cagcattaca gctttatgct gccatctggc acacggtctg ttcagattgt ttcacgcgca    110220
     agccgcccgg cagatgtcat tgggcctttt gtggatgatc gccgccagtt gggtgttgct    110280
     gtagccgata ttcagcttgt aacagcccgc cagcatgcaa cccctattac ggcgcatctt    110340
     cagcctaaca aaccggctgg ctggcataat acgggttggg ccgaatgtgc atggacaaac    110400
     ggcaacgcca ccctgccgct agatgcacaa acagagcata acgacattgc catgctttcc    110460
     atcacccttc aggcaacggg ttcctatccg cttgcagcag aagtgcagga aaacgtacag    110520
     agacattctg cctgataggt tcttaaacct ttcagataca aaaagaggcc ctgtttataa    110580
     aagcagggac tcttttattt tgtcatcttt ctagaactgc acagtaaaaa tagctttttt    110640
     cctgcggccc taaaagttac tcgcctttgc tgttcagccc tttttcctgc cggtagcggt    110700
     caaattgcga tatcgccaca ctgaagcaaa tctgccggtt gtccatttgt tacggggcca    110760
     tagatgttgt atggcattcg agtaaattta atgccgaagt cacttgttgc gcttcctagc    110820
     actacagttg cattttgtgt cgtgagtgag cacggatagc gctggcctga tgtgttcgtc    110880
     gaaagacgga ccatctgagg atgtgagcga cgggcagtct gcgttgtgag agttttacga    110940
     caagacgcct gatttcctga atggaccaac ggacgacgat tatcgtgttc tgcggtgtgt    111000
     ttttttcggt ttcaatgagt ttgcctgata ccggacactt gccatgacgg cataggctag    111060
     catgaccaga gagacatgcc gatgccaacc atgccaggag cgggtctcgt tatgatcaag    111120
     accaaattcg tttttggccg tctcgaaccc ttcttcgatc ctccagcgcg tcccttcaac    111180
     gttcaccagt tcctgcgtgg ttgtcccttt cgggctccag gtcgtaaaat aggcaaggtc    111240
     cccgtcagcg atgtttcggc ggatcaacag gccacgtgtc catggtccgg ctatagggca    111300
     gtcaaattct tcagcatcca gatcagcaag cggaagatac gcccagtcat aaagtcgctc    111360
     accttttgtg ccgtgtcccg cagacagacg gcgccagtcc tgctctgaca gatccgaggc    111420
     aatatctctg gcttctcctg caatcaacgg gtttgttgcc catgacccga accagtgatt    111480
     gcctttgacg ccaaggacat atccaattcc agcccggcga agcgtgcgtt ccacatcacc    111540
     gacgccatac acgctgtctg ctgcaaccca gcgaaagggc acaccggcct caatactccg    111600
     ctcaatcatc atcgaggcta acgccggttt ggttgcaaac accacgtcat cgggaacgtg    111660
     ggcctgcttc aggcgctcag gctttgatgt ccagtctttc gggagataca gggcgcggtc    111720
     cacaaaggca tggccccgcg tcgatacata ggtggcaaat acaccaatct ggcagttcgt    111780
     gatcttgcct gcagatcccg tatactgccg ccccacaccg caggacgcct gacccttctt    111840
     cagaaaaccg gtctcgtcga tgaccagcac gccctcttca gtgcccagat gctcgattac    111900
     ataatccctg acgacatcac gaagagcatc ggcatcccag tgcccgcgcc ccagaagcgc    111960
     ctgctgccgc catggaccag gatctcctgc ggcttccgct cgcatccatc ccgtcttgcg    112020
     tggttcattg ccaatcaaaa catcaagaaa agcacaggct gaatctacga cacgtttctg    112080
     cgtaaacagc ggcgccatcc gctccttggc ggaccgaagc ccggacgccc acaaagccag    112140
     cgtctcctca acagacgcac cgccactcat catatcctga atcatggtta cccatagagt    112200
     cagaactcaa cacaaaatgc aactgtagtg ctaggttgac acaagagtct gaaaaaaaat    112260
     gaactcgtga acctggatct ctccaaacaa tatttagggt catcttgttt ccattcaata    112320
     tcttgccgac ctgaaataca cacaatcttg tgtaatttaa atgtacattt tctggtgaca    112380
     ctttgggaag ttagctttcc catgctgaat tacaggctat tctccagtta aataccagac    112440
     aaaatcgacg cggatttctc acacttgagg caatttcggg tcattttgta gaattcagtc    112500
     atcccacagg agcccgatct ggaatattga cgatattctg cttctggcgg cgggttctga    112560
     acgcagtgag ggtgtcacgg cctgagaagg cagtgttggt ggaagctatg tggtctgtgc    112620
     actgtctgtt tcttcagatg gcctgccgga gccttcgcaa tcgtgcatga gcgagggcga    112680
     attcatgctg acaggggaac atgtccggca tggacaggac aatccgacgg acgctgagcg    112740
     ttacacgtgt cgcgattttg agcagccgtg cgcgtatggt gccacaggtc gccgtctcca    112800
     ggctggtctg gccaagggcc agtctttgca gagcggtcag caggacatag gctgcggccg    112860
     agaaccacag ccggagctgg ttggcccgga tggtgtggga cgaggtcctg tctgagaaca    112920
     gatccatctg gcattccttg atgcggtttt ccatatcccc gcgtgcgcag taaatctgtt    112980
     cgtagagatg gcgggggtcg gacattccct gcggtagggt ggtgacaatg aagcgatgat    113040
     agcggttgcc gtggcgccat tcggccttgg ccacgacccg cctgcggcgc gtccagctgt    113100
     cctttgtgat ccagtcaaag gaggcgaaac cgcgcgcagc tctgcctgtc gtggcggctt    113160
     cgtcacgaac ctcagcggac aaagaggcaa tccggtcata caggcgggtg ttgcctgcaa    113220
     gcccgaacag gaagtcaacg tggttgtctt cgcaccatgt catcagactg tcccgggcga    113280
     aaccgctgtc cccacgcacc aggatacgca cccggggcca acggctcctg atctgctcca    113340
     cgatccggcg gatgtctgcc agtgcttcct tccccgggtc cctgtctgcc gtgcgcaggg    113400
     tagcgctgag gagatggtcc ccgcagaaga catacagggg aagatagcag ttatggccgt    113460
     aatatccatg aaaggcgcgg ccttcctgat ggccatggat acggtcatcg gtggcatcca    113520
     catccagaac gatccgggcg ggtgcgtgct catgctggtc aaggaagagc gtgacgaaca    113580
     gggtagccag ggcctcatga tcagcaatga tgcggcagta acgatctgcc ttgtgcccac    113640
     tgcgctccaa ccggttcagt gtagatttgc cagccaatgc tgcgcagttt gctcggcctc    113700
     ctgacagacg acccgaggcc agaccaaaga tcaggtcatg ccgcagggca tcgtgatcat    113760
     tgagatcttc atagcccagt gccaggccca tgatccgctg acggacaagg tcttcaaccc    113820
     ggtattccac aaagccggga tgccgcttat cgcgaaaaca ggcagcaaag cggcagctga    113880
     gacccagaat gtcatcagcc tgcttcacca gaattacgcc cccatccgaa ctcatgcgac    113940
     ccccgtcaaa acgggccaca acacgccgtc cacaggaggc tggaaactca tacgcgcctg    114000
     cgctacactc tgtctgcatc gggttttctt gatgattatg gaaatttctt ttgtgcaaaa    114060
     cagacttttt cataatctaa cccgatgtac aacccttctg tgagatttcc gcgtcgacaa    114120
     gagagcctta atttggtcat ttccgctatg cgaaaaggca ttgaaataac tgtatgtcca    114180
     acttgaaggg cgactaccac cagggaaaaa ctggtgggtg acatgataag ataacatttc    114240
     atcaagtaat tggaaatgaa tatgaactga atattactat taatttgatc aaaaagtgag    114300
     gcgattagtg caagtcaggg acctgatgaa acccgatgga cgggtatttt taaaaagcgt    114360
     ctttggccaa atcagtgacg aatggccatg tatttcgttc tctcgttctt ccgtagggaa    114420
     tatgctgagg caggagtttg tccctggccg tgatattctg atctatgtcg gaacacttaa    114480
     tggtaatctg accgaagatc ccgaacatcg cggcaggctg attgctgctg tcgtgatcga    114540
     accgagtcag gtgcttgaaa cgcgccgaat catatcgaaa aatttctggt cgaacttagg    114600
     cgaacagtgg ccccatgcca tggcggttct caaggcggct gtgatggaag gaccgcctta    114660
     tccgaaggct catgacgtca ttccaaatgc atatcgtcag ttcgcgctaa tggaaaaccg    114720
     agggggtatt gccgaagcta tcggcgaaga gcgtgcagcg gttatggcgt tgccaattac    114780
     tccgttggac ctacatctat cgcctgaggt acaagcttat atcaacgtcc gagccagtgt    114840
     ttccgaaaca cccaaaagta tccgtgaaga ggcaacgcgg atggccgacc tcattatcaa    114900
     tcgcgtgcgt aatggtggca cccaacgcat tgtcaccaat gccaatcgca cggctccaaa    114960
     catatccgat ctttacccaa tgctgactcg aaaatggcag gtcgatcaat gcggactatg    115020
     cgctctgtgc ggcggtctcc tgctgccggg aacaaggaat aaaatgcttc agccctctgc    115080
     tgaccgaata gatagtagta atgaagcata tgatgaagag aatgttcaca taactcatct    115140
     ggcctgtaat ctggccaaaa acaaatatgg aactgacgat tttgaagaat ggctcatagc    115200
     tctgcgtggt aatgacccac gcaacgaatg aaagaacgat aaaaatgagc gcaattgtcc    115260
     atataagcta cgcatgtccg ctatacggaa tgtaaccaag agcactgcaa gtctcgaatg    115320
     aggcgtaagc cgcctaacca ttctccctag caatatagtt gcagttcggt ttccgtcctg    115380
     aaaggtgaag agtttagggt ctttcgcgac gtaaatcgcc tgaaattcga gccttcctga    115440
     aaacattgga tctgtgaacg attagagaac aaaatgaact gcaaccttag tgataagtcg    115500
     atttgtgaaa gaagttttca aaaaaataac gcacgctggt actatccgac acaccctaac    115560
     cattcttggt ttgaaggttt ctcgcgcaat tttttgagcc cggatgttcg aatttgggcg    115620
     gattacaatg acagcgttac tgaatggtac ggatgggaat ctcggcatct caatgacgta    115680
     aaagctcctc aagattttgt tgatcgttca gcagcgctca aagcggtgtt tgacggtgct    115740
     atgttcctat atttaggaaa gatatatcag ccgatcatat tcggagctgc tgaagcccat    115800
     gcagttgctg accaaccatt cattagacat ttgcccgaat ctgctgatgt gcgcgtggat    115860
     ccgttctctc aaattgagat taacaagacg gttgttagca ctgagtatcc ttttgataat    115920
     ccagtttcga ccatgctatt tgctgccaga tacgactatg tagtgcgcga tatcctgaaa    115980
     tatatcggcg ttcaaaatct tacttatgta acactatatg ctctccacga ctggatgacg    116040
     atgaaggaat gcgggtggac gacgaacgaa ttggcatccc acgctggttg gacaaaggcg    116100
     gaactgaaag atttcactca aacggctaat aatcctgctt atctcggacc gttctgtcgc    116160
     catggcggtg tcgacactcc gccaaaacgg cctatgccgc tagacaaagc aatagatcca    116220
     atcttaacgg ccacgacagc ttttattgaa aaacgcattc aatccataga tttacaggat    116280
     aaatgggata cactgatcgc gccttgaagc taaattaaag tctcgtggcc tatgaaaatg    116340
     aatcctctgg gctatgtccg cttaacgaaa atagttcaag atttcgtatg tccgacatga    116400
     ggcgtgttct gacgacagtt tctgcttcac gaacagcgta ttcgcttgat ggggtaatga    116460
     tccatttgtc cgtcttccga aagaaatgtg gcgtgttcag cttgcgcctg cgccatcagg    116520
     agatggtcaa acggatcacg atgatgcaaa ggcaaagaca taagaatctg caggtgttcg    116580
     ggctgtattt gcagcagaga gaaaccttcc gcaggaatgg ctgctagaat atcgttcata    116640
     tccgcatcaa gctttccgat acggattttg atcgcaatct cccataatga tacgatactc    116700
     acggtaatcc ccccattttt agtggggcat tgaatgagaa ttcaggcagc tgtttttagt    116760
     ttctgggcgg gggttagccc gctgttcccc atgttgggtc tgtcatggtt atatgtccag    116820
     agccattgtg ttgcgacctc ctgcacgtcc tgaatgcttt caaacagata ctgctccagc    116880
     cattcctgcc ggacagttct gttgtagcgt tcaatatagg cgttctgctg cggattaccc    116940
     ggttgcgtat agatcagggt aatcccctgt ttttcggccc atgaaaccaa cgtatgactg    117000
     acatattcag ggccattatc cattcggatg gcttctggcc tgccgcgcca ctccataacc    117060
     tgttccaggc agcggacaac ccgacaggcc ggcagggaaa aatcaacctc gattgccagt    117120
     ccttcacgat tgaagtcatc cagaatgttc aggagccgaa aagcgcgtcc atccatcagc    117180
     ctgtccgcca tgaagtccat ggaccagacc gtgttgggaa gggccggaac cgacagcttt    117240
     tcaggctttt cgcgaacaag acgcctgcgg ggtttaatcc gcaggttgag ttccagttcc    117300
     cgatagatcc gataaacccg cttatgattc cagacatgtc cctgcacatt gcgcagatac    117360
     aggaaacaca gaccaaatcc ccatctcctg tgagcctggg tcagtcccac aagaagatcg    117420
     gcaatcctgt cattctccgc tgccagtcgc ggacgatagc gaaagcaggt ctcggatatc    117480
     ccaaaaatcc gacaggccag cgcaatgctg accccatgat gcgccacagc ttgtgcggcc    117540
     agttcccggc gctgggctgg ccgcttcatt tttttccaag ggcttccttc aggatatccg    117600
     tctgcatgct caaatccgca tacatgcgct tcagccgacg gttctcctct tccaaagcct    117660
     tcatctgact gatcatcgaa gcatccatgc cgccatattt cgcgcgccac cggtaaaacg    117720
     tggcgttgct gatcccatgc tcccggcaca ggtcaggaac cgggacaccg ccctcagcct    117780
     ggcggatcac acccatgatc tgggcgtcag taaagcgatc actcttcatc agaatctcct    117840
     caattcttac gctgagaaaa ttctcattca aaagtcactc tttttatggg gggattacct    117900
     caccagaata tcgtggacgg gatctgcgat aatttctcgt gcagtctcac ccagccggtc    117960
     ggagcccgaa agccaccaca gcaacgcatg cgtatcaagc agaaccttca caggtcgcgt    118020
     tccatgcttt caagaaggtc cggcggtgtc tcatcaaaat cttcgctcat tctgatccgc    118080
     ccacgaagag ctcctggctg acgacgggga cgataggaag gagctggcgg acgcagttca    118140
     gcgacaacct gatcgtgaga cgtcacgagg atcgtactgc cctgtctgac ctgacgcaga    118200
     tacgctgtca ggtttccccg gaactcccga acaccgattt tctgtggtaa tggtgcgtta    118260
     tctgaaagat gctggctcat ggtctcctcc ccatgtgtca tcataacatg tacacatagg    118320
     gaggaggtag agaattcctg aggcatgttt gtttcagaga tcagtggctt ccgacagtgc    118380
     cagagcgtcc tcgacatcca ccccaaggta tcgaaccgta ctatccagtt ttgaatgacc    118440
     cagcaggatc tgcacggctc ggatattacc ggttcgtttg taaatcatgg caaccttagt    118500
     ccggcggagc gaatgagttc catattcccc ggcgattagt cccaccgctt gaacccattg    118560
     atccaaaagc cgggcgtatt gccttgtgct caggtgagct ttggcgctta ggcgacttgg    118620
     aaaaacatac tcattcaagc caccaccgcg atgttccagc cacgcccgca cgctttctcg    118680
     cgttgtttct gtaatttcga attgcacagg tcgccgggtt ttctgctgga cgaccatggc    118740
     tcggtggcgc acctgaccac tggtaacgat gtcgccgata cgaaggctga caagatcgca    118800
     gcctctgagt ttgctatcga gagcaagatc aaacaaagct ctatctctga cacgctgttc    118860
     gctccccagc cagaaccgaa tagcccagac gtgcttttct ttgagcgccc gcttggcgcc    118920
     aaccattttt cctgcattcc aaggcacgga cgccttcagc gtaggcgatg gaaaacgcgt    118980
     tttcttttcc atgatacttt ctcctgatca gctgcacatg cagcaatcag aagtctggag    119040
     gaggacatcg gcggataacg agaattattg ccgaccgtcc gctttacaga aactggaacg    119100
     gctcttctta tgaccgagat gagagcgtga gcagcctgtc cgcttgccgt gtgcaaagcg    119160
     gacttacagc ttacgcctac atgtcggaca taaaagtggg ttggctcgcc tttcgcataa    119220
     cggacatagt ccgcgcagtc ccccgctatc acttggagcc gagagtgggg tgagcgttat    119280
     gggaaataac cagcaagaat acaggcgctt aggttggccg tagcaagaca cgcccgaagc    119340
     cactgggcag ggagtataaa tcatttggat cgggcaacga tgctttcggt tttcggcctt    119400
     gacacgatga tgttcggtgc gggcggcaat ccagattttc tggacagcgt caagattcat    119460
     gaaggcaatt ccgaacccaa ccagaaggtc gagccagacc gaatggtggc cgagcgtgat    119520
     acggaagcag ttttcattct gggttctatt ggcatatcgg acataatctt caagtagttc    119580
     tgtgcagcag tggcccatac ctgtcacttg aacaaggttt ccggaactcc cgtttcgttt    119640
     tcagaaaaac taccaaattt gacagcaaga ataggcaaaa caaacaggtt aagtatcatt    119700
     gatgtcatga gccctccaag aatgacagct gccataggtc cttcgatttc ccgcccaggc    119760
     gcattcatat caacagccag aggcgccagt ccaagcgccg taacgagcga tgtcatgagt    119820
     acggggacga cgcggtctct ggccccccgg agcgctgttg ttactcccca tgtgagatgt    119880
     tcccgctcga ccaaagtctc aaaatgcgaa atcatcatca ccgaattccg aagcgtaatc    119940
     ccgaatagag taacgaagcc gactgttgcc ccaagagtta gcgttgtgcc ggaaacaatg    120000
     attgccagaa tgccgccgac aaatgcgaag ggaagattga cgagtatcag agcgagattg    120060
     cgccatcctt gtgtgattat tgagagcaga atcatgaccg ctatggcagc gagcccggaa    120120
     tttataaaca gttccttgcg tgattgtgat tcagcttccg ctgcggatgt aaactgaacg    120180
     taggttccaa gaggcagttt gatatttttt gctatagccg tgcgtgcgtc ctgaacgaaa    120240
     gattgagctg atcgtcctgt aacatttgcg gtgacagtct gtgttctctg tgctcccaga    120300
     tgtgacacct gatagcgacc gttcgtctca tatatgtctg cgacagcgcg gagtggtacg    120360
     tagtttccgt gaacagtatg cagtggcagg aagccgacag acgcaacatc attacgactt    120420
     gcgtcatcaa gacgaaccat aacattaaaa gccgcagaac gctcgtatat ctgccccacg    120480
     gtttcaccct gccaggctgt atggatggat cggagtacat ccgccgaccg aagcccccag    120540
     cgctccagat cagtagggcg tagccgaata gcaagttccg gaacaccagg gggtgcttct    120600
     atccggacat ctgttgcgcc atgtatctga tgcaacatgc ggacaatatt atttgcctgg    120660
     atatccaata catccagatc atcgccaata atattgattg ccacagccga agacgaacca    120720
     gaaagggttt cgtttacgcg catcgtcaaa aaactactga cagaaaaact ggccccaacg    120780
     aacccgtcaa gcgctttgcg aacgcgggca tcaatctgtc gggaagcctt cccatccacc    120840
     tgattcaaat caacctcaaa ctcgctggta tgtggtccag acgtgtcctc atccagcgag    120900
     gcgcgtccga ctctctgagc aaccgaacgg atttcgggaa gctgacgaag tttttctgta    120960
     acctgtctac ctaatttcag agactgttcc agggaagtcc ccggagcagc cgtcatatga    121020
     atgataaggt gaccttcctt gaaatcagga atgaaatcgc tttcaaggaa tggaagggcc    121080
     gcaaacccta tcaaggtggt caggatcatc ccgcctataa caaatcgggg atggcgcatt    121140
     aatctggcca gaagacgttc ataagctctg gcggtccatc ctgccagggg gggctctctc    121200
     cgggtttctc caggcgtcgc caagagccat gcgcagagtg caggtacaac ggttacagca    121260
     gcggcaagag aagccatgac cgcaagaaca taagctgttg ccagtggagc aaacagtcgt    121320
     cccgaaagtc cgggaagggc gatgacaggc aagaaaacga taatgacagc aaaggtcgcg    121380
     taaaccactg cactgcggac ttcaacgcat gcatcgagta cgacgcgcgc tgtagatgcg    121440
     ggctggacca gaagccggtt ttcacgcaat cggcgtgtaa cattttcgac cccgatcacg    121500
     gcgtcatcca cgacctcgcc gatggcgata gcaagccccc ccagggtcat ggcattcaaa    121560
     gtaaccccga gtgtctccag caacgacagg gctatcagaa tagccaaagg tatggtggcg    121620
     caacagattg cagcggttcg caggtcaaaa aggaaaagaa agattacgac aaccaccaga    121680
     aaaccgccca gaagcaatgc ttgtgtggca ttccccaatg cggtcgtaat gaaattggcg    121740
     ggtcggaaca ggtcagcatg caatgtaatc ccctgtccct gcaattgcgg gcggaaatcg    121800
     gtaagtgccg cctcgatttc ccgggtcaca gccatcgtat tggcaccgta ctgttcccat    121860
     atattaacca caatgcctgt ctttccctcg atactggccg cgccgaaggc gggaataggg    121920
     gcttcagtta cagtggcaat actgcccagt gtgacagcac cattatcaga gcggacaatc    121980
     acagtgcggg ccagactttc tggcgtcagg gcctgaccgt cagactgaag aacgactctt    122040
     tggttcgggg tatcaataaa gccggccccc tgtatgccag ttgcttcctg ggcagccgca    122100
     aggacgtcat caagtccgat atgatgcaag atgagttggt ctggatgtac ctgtatctgg    122160
     agtgaccgac gctccccgcc aaacacactg actccagcca caccaggcaa cgccagcaga    122220
     cgcggcctta atgaccagtc agtaagcgtg cgcaactgca tgagggactg ttgttccgac    122280
     gtcagaccaa tcaccagtac cagaccggcg gatgaggtca gtggcgtcat agtcggagca    122340
     tgaacaccgg ctggcaattg ctgtgcaaca acattcattt gttccccgac cagttgccgg    122400
     gcgcgataaa tatcggtcga tgtcgcaaac aggacgttga cgactgacag tccctgaatc    122460
     gaagtcgatt gcacgcgctg aatacccggg aggccgctca gggcaatttc cattgggcga    122520
     ctaaccaatg tttcgacctg ttccggcgta aaaccagcgg cttcggtctg gatcgtgacc    122580
     cgtggcggaa tgaattccgg aaacacatca tagctggcat gtctcaagcc atacaggcca    122640
     tagaagaaca acagacatgc ggttgcgata accacgcccc ggaagcggat cgaaaacccg    122700
     ataatagctg cctgaaggct gaaagaacgt cccgtcatca gtcgtcatcg cctcctgatt    122760
     caagctgagc tcggaattct tcagacagaa gtaattgcgt accccctacg acgatttgcg    122820
     tttcgtgtgt gatttgtcct ggagtatctt ggatcaggta gccaccttct cggtccggca    122880
     cgtcggtcgt aaggggtagg cgtgtaaatt ttccgtgtcc gttatcacgg tatatccacg    122940
     acttaccttg cagccagata atagctgatg caggtatccg gataccggga cgttcctctt    123000
     cggtaggcag gagaacggaa acattcatgc ccgcgacaag ctgactttca gccgacgcaa    123060
     aatagaaaaa gctacgcccc tgaatagcag gatcggtcat ggttacagga gacaaatagt    123120
     ggagcattgt cccgtgtcca cccgtgtttc cataatcggt cacatccgcc tgacttggtg    123180
     gggttggtag atccgtatct ggtggaaggg tcaccttgac caagaccact tgttgttgaa    123240
     gtaactgtgt aatgaaaatt gtattttttt cggtagcgtc agatatgacc gaaccaaatt    123300
     gctgtctgat aatattaagt gcgttattca cccggacctg ttctgctttt accatagctg    123360
     agttggactg aaatctggct gttgtctcct ggaattgttc ctgagagata ttctgccggt    123420
     cgcgatacag tcctttgtca cgatcgagtt tcgcacgggc aagcgtctgc tgtgcctgca    123480
     tgctctccag ccgcgctttc atgtcagcat aatcactaac aagagtgata agttgtgttg    123540
     cgttcagaac gtaaccatag gcgggaacca actttctcca aggcacgatg ctgggtcgtg    123600
     cagaagcgat gccactcttc gtaactgctt ccggggagac cgtcacggtc gcctctgcgc    123660
     caagaaccga aactggtgga tcatcatcat ctgcaatagc aatgtccgcc acgtttagaa    123720
     ctaggaagac agaaagacct acaagaggca gccagaaggc cctcgctttc atggtgagtt    123780
     cctttggtta ttttcaagca ggccggaaac ctgcgcggca ctggtgtgat caaaaatggg    123840
     ctgctgcatg ccatcttcga tctgacctat ggcttgccgt tgctgaattt ctgcttcaag    123900
     aagagcggtc tctgcttgaa tctgctctat atgagtcata accatcgttg gtcggtcgat    123960
     tgcgcctgac tgaaggcggt gctgcatctg gttcagcctt acccgtacgg ttttggcaag    124020
     ttcatccgcc tgtagcagaa ttgatgtcgt gccgcggtaa ttggccgtag cctgcgagat    124080
     ggacttaaac accgtgttct ctgcacgccg gagacgagcc gccgcctcat gctcctgccc    124140
     aacagcttca gctatggggc cttcgttctg attgaaaatc ggaatttgca gagagggatt    124200
     tacctcaaag cgatttgaaa aatcccagtt ataggaggga ctgatggtga catcgggata    124260
     gcgtcgggaa acttcgaccc gtagagcctg tcgggcggcg tcataagacg caagaagttc    124320
     ccgcagatcc gcgcgttgca ttacggcttg gtatctcatg tcctgtgaat cgcggtattc    124380
     catgaggtcg ggacagacat caaatgcttt tgtatcaaga gcaatggaat caagtgcttc    124440
     ggcaggaacc ccgattgctc ctgccagagc tgccttacgg acggcatact cgcgccgcag    124500
     atcactgaca gacaactcgg catggatcat ttccgtccgt acctgcgata tttcgagagc    124560
     ggatgctcgc ccctgatcaa aacgtgcctg ttccagggta aagagttcgc gtttagctgc    124620
     cgcagtctct tccacaagct tgaggcgccc ggatacagcc cagacgccga gaagagcaga    124680
     ccgcgtgtcg ctgcgtagtt tccatgcagt attgatgact tcccattgcg cgacggcagc    124740
     ccgatatctg gcttctttga tacggtgata acgcctgccg aaaaattcga tcagtattga    124800
     cgcgccgtag ccgacgtaat gagccgatgg gccacccagc accgtgaaac tgggattggg    124860
     cagttgaccg gctgtcttga ttccagcgcg agccgtttcc agttcagctt tagctacaag    124920
     gatatcggga tgaaaataca aggtagcaag cgtcaggcga gtgatgcccc atgcgttttc    124980
     ctgactcgat acgtttggtc cgagaacttt tgtaatgaat tcttgcaatc cggcatccgt    125040
     aaattgacgg ctggaaaatt tctggacatc tgattccggc gaaatatttg agtgatcact    125100
     atttgtacag ccacagagca ggggaaaaat caggagaatg aatgccgcat tatagcgtgt    125160
     gcgtctcctt acctgcttaa tatattctag agtattatat gatttataca ttgatatgtc    125220
     gtgatatatc tgatttgtta tctgttagtt ctactctcga ttgtcgcata atctgcacac    125280
     ctccactaat accaagcatc gcaaggatgg cagctaccgc aatatccggc cacgcagaac    125340
     gagtgccaaa cacgcccaga gctgccagca caacggcaac atttccgatc gcatcattac    125400
     gagagcagat ccatacagaa cggcggttgg catcaccttt ccggtgtgtc cataatatga    125460
     gggcacaggc cagattgacc gcgagggcaa gcagaccaat gccgcccatt gcgtctgggt    125520
     gaggcggatg gttgctgttc attactatcc acccagcatt ggccattacc catagcccag    125580
     ccatgaacag ggtcaggcct ttcagaaagg ccgcgccagc tcgccatcgc aatgccattc    125640
     cggcaacact gaggcttatt gcgtagttgg cgctgtcgcc aaggaaatca atcgcgtccg    125700
     cctgtacgga tgcagatcca accgacacgc cagccccagc ttcaacggca aacatgctgg    125760
     cattgagaaa aagcgcgatc aggagcgctc tccgccatga tttattgatt ggtagcggcg    125820
     tatctgtgca tccaccacag catcctcctg ccatccagcg cctccctgac gaatcatctg    125880
     ttttaatgta tgctccctgt agcaactaca gggtcaagag gcagggaatg cgatcgattg    125940
     gtgccttggg gaaggcgacg aataccaaag tcgagacgat ccgctattac gaacggatcg    126000
     gtcttctggc tccgccacag cggaccgatg gcaattatcg cacttatgat gatgaggcac    126060
     tcgcgagact gtcttttatt cgtcgatctc gggatctggg tttttcatta gaccaggtaa    126120
     gagctctatt atccctaacg gatcagggaa cccaggattg taagacagtt gatagaattg    126180
     ctcgtgacca tatggcagaa attgagcgca aaattgcgga tctcatcgca ttgcgccatg    126240
     aactttctac gatgatagaa tcatgcgggg gaggtaatat ttcagaatgc cgaattattg    126300
     aagcactttc tccgtttgat aattagttct cctgactttt ttcgcagcca gtcgattctg    126360
     catttgacgg aagattaccc gaaatagtta tacggcctca tcctcacgtg tcagaatctg    126420
     aaaaatcctc atggaaaatt caaggactat acgtgctccc atggtggcag tttatgatca    126480
     ggccagttct gaagcagaca ttcggcttcc ccccccgatc tgcctgtctg ctcagcgata    126540
     caggagcaga caggcagcag tcgcctacat gtcagacata gaaaagagcc aaacaatgct    126600
     ccgaaagcgg acgttatctc tagaattaaa atgctgagat ctccgagtta actcgttatt    126660
     ttattattgc cacgaacgag ccaatagacg atccccaagg ccaggattgc cgccgagagt    126720
     gccagaacct ccatgacgtc gaggccgctg agatccagga caataaattt gcgaacggtc    126780
     gccatcatac cgatgagaag gacggaccgc attctgacca tgctgtgcga gggtgtgtcg    126840
     ggcgagacaa gaatagagtg tttgaattcc agtgcaatca ggactgtaaa aaacagacca    126900
     aaaaggctct gtagaaccac aggattggtc ggggaaaggg ttgctgttcg gagcatttca    126960
     aaaacggcgt atagcacatg tatgagacca agggccgcga cgaccatgat gcagagcgta    127020
     agaaccagca tagcgatctc ttcaaaaaga tcgaaaatag aagaaatctt ctcaaatcct    127080
     ggtatgtttt taatcatagc ctttgccgtc ctttttagcc tatgtctgcg tagttagaaa    127140
     cctaataccg catcagctcc gaaagtgaac tgaccaacat ttctaaggtc attaaatggc    127200
     ctcgttccgt tcagtgagcg atcaaaccgg acttcaggac ggatctcgaa caacttgacg    127260
     gaatgaccga gcacgggacg ccaggtagca cccagtgtca gggcaccgta cgtcgtcggc    127320
     ggtgctgatt gcgtgacggt gggtttaccg agcgtcgctt gcatgtaggc attatttgcg    127380
     atgaaggatg ttacaaacag accggtatca tcacgataga tctcgccgcg gtaatttaga    127440
     agaagtgtgg gagttaattg ataggaaagg tagcttacga agctgtaggt gttggcatga    127500
     agcccttcat cgtgcaggaa gttcagctca ccggtgaagg tcagtcggtc tgaaatcttg    127560
     taacttccgc taagatcatt ccagtaacgt tgagccgagt ttgcacgctg tccgagggac    127620
     cgagtagagt tttcaggacc gacgcgaccg aggtatgtca gagacagttt gccatttgcc    127680
     agactggacg ctgtcagacc gaaatatccc gcagcagtat gattgttgtc acctcccccg    127740
     aacgagacct gattgcccgt gtccactccg aataatgcgt cgatatggtc ggtcaggtgc    127800
     cattgaaaca ttgcgcccac atgctcgaac ggcgtggaat actcagtcgt ataggacagg    127860
     gtatagaaag gacggagtga ggggtcgagg gattccacgc ccatagggga ggccagtatg    127920
     ccagcctgca tgtccagacc atggcgggtt aaccaaggca ggtgaacgtc gagatgggcc    127980
     tgaggcacaa tgaactggta acgactggtc attaaccggt ctgtgatgcc tgcaatatta    128040
     aagtaccgcc cgtcggcacc gtagagcccc cggaccatga agcccacgtc gtaagacgat    128100
     gctgtcgtat cgactgcacg cgcagccgtc agcgtcagct ggtcgagttg cgcctgattg    128160
     gccctgtcac cgaagaactg tccgaaatta atcccatttg cagggcgaga aacgtttgcg    128220
     tttattcctc cctcgatctg ccctgcaagg gtgatgtcat cgagccactc cgtggcaggc    128280
     ttcgcgatcg catcgttcat gtccagaaga accatcgtaa tggctgctgt caggaaaaaa    128340
     cctacatttc cagatcgggg cgtccatttc aggaatgcag atttgtccag ataaactctt    128400
     gtcatcattg tcgtgctctc gccggaaaga aacgccgcat aaaacggatc tgacatcaga    128460
     agtccggtcg agcgacattt cggagctagt ctccgaagac agggcgcgac aagtcgggaa    128520
     agggatagaa ccagcgtttt agggcaaatt cctatgactt tcctataaag atcgtagact    128580
     tcttatctgt cattcctatg cggtccagct ggatatttag agatgcacac aaggagcatt    128640
     ctcgcatgct ggatattctg tatctcacac ttggggtgtt cggcttcggc gtctgcgtcg    128700
     cctacatctc catttgcacg agggtctgat catgaccttt gaactcatca tggccagcgt    128760
     cgtcacgctc ggcctcctag gctacatgac ggcggttctc ctgcgtccgg agaaattctg    128820
     acaatgtcat tttatggctg ggtcgccatc atggccttcc tcatctgcgt tattgcgatg    128880
     acgagaccgc ttggtggttt cctcaaacgt gttctcgaag gagaacagca tgttctcggg    128940
     cggatcttcg gtccggtcga gcgcggcatc tatcgcattg cgggcattca caaggatcgg    129000
     gaacaatcct ggtcgcaata tgcgatcgcg gtcatcgtct tcaaggttat ttgctttatt    129060
     gcagtttaca cgcttttgcg tgttcagggc gtcttgccgc tcaatccaaa tggcatgggc    129120
     ggcgttgcgc ccgatcttgc ctataatacc gccataagtt tcctgacaaa tacaaactgg    129180
     cagagctatg gcggcgaaac gaccatgagt catctcaccc agatgcttgg gttgacggtc    129240
     cagaatttcg tctcggcggc ggcgggtatt gcgatcgccg cagcggtcat tcgtggattt    129300
     gcgcgtcgta gtgcaacgtc aattggcaat ttctgggctg atctcgtacg gacgacgctc    129360
     tatgtcctgc taccgatttg tgtcgtctta gcgttgtttt tcgtgcttga aggcgtgcct    129420
     cagactcttc tgggttctgt cactgtctcc acattggaag gtgcgcgtca aacgatagcc    129480
     tttggtcctg tagcatctca ggaagcaatc aaaatgctcg ggactaatgg gggcggtttc    129540
     ttcaacgtaa actctgccca tccgtttgaa aatccgaatg cattaaccaa tttcgtgcaa    129600
     atgctcgcca ttttcgcttt gggtgccgga ctgaccaata tgttcgggcg catggtcggc    129660
     agagagcggc aaggatgggc gatcttctcc gctatggcct tgctttttct tattggtaca    129720
     ggagttgcct actggtcgga agcccacgcc aatcctttga tcactgcgct cggcgccgat    129780
     ccatctgcgg gaaatatgga gggcaaggaa acgcgctttg ggattattgg ctccgcattg    129840
     tttgcgactg tcacgacaga cgcatcttgc ggtgctgtca actcaatgca tgaaagtttc    129900
     ttgcccttag gcggtatggt gccgttactc aacataatgc ttggggaaat tatattcggc    129960
     ggcgtcggat cgggtcttta tggcttcctg ctgtttgcca tcattgccgt tttcatggcg    130020
     ggcttgatgg tcggacgcac accggaatat ctcggaaaaa aaattgaggc gcgtgagatt    130080
     aaaatgacga tgttggcagt tctttgcctg ccgctcgtta tgctgggttt caccgcgctt    130140
     gctgttgtcg tgtcacccgg gttatcggct ttatctgcga gcgggcctca tggttttact    130200
     gaagcacttt atgcatatac ttctgcggca gggaacaatg gtagcgcttt tggtgggctg    130260
     accgcgaaca cgttctggaa cgtgacgctc ggtattggca tgatggcagg ccgtttcttc    130320
     gtcatcattc cggtactggc catcgcaggg gcgatggcag ctaagaaaac agccactccc    130380
     acgcctggca cattccctac cgatacgggt ctcttcatcg ccctcgtgac aggcgtgatc    130440
     cttatcgtgg gtggactcac cttccttcct gcactcgctc tcgggccgat cgtcgagcat    130500
     cttgcgatgc tgggcggcac cctgttttaa gaggcgcatc gttcatggca ctccatttac    130560
     ctcattccga agcccctcat ggagggcggc attcggaaca tcgcagtcag agcagtctga    130620
     tgcaggcgtc gcttttgctg cctgcgatca gggagagctt ccgcaagctc gatccgcgca    130680
     tcatgtggcg caacccggtc atgtttgtcg tggaggtcgt gaccattctg acgaccgtcc    130740
     tgctcatacg cgacatagtc gccgggggaa cacatcttgg ctttgcgatc cagatcaatc    130800
     tctggctctg gtttacactc cttttcgcca atttcgctga agccgtcgcg gaaggacgtg    130860
     gcaaggcgca ggccgacagt ctgcgtcgca cccggactga aacacttggc aagcgtctct    130920
     tgatgaatga cgagggcggc tattcgcatc tcgggttgta tgaggaagtg ccagctcccg    130980
     aactcgtagt gggggacgtc gtgctggttc aagctggcga cttcattcca agcgacggcg    131040
     aagtcgtcga cggcattgcg tcggttgatg aatctgccat caccggtgaa tccgctccag    131100
     taatccgcga aagcggtggt gatcgctccg cagtgacagg cggcacgcgc gtcctgtcag    131160
     actgggtcat tgtgaggatt acagcagccc agggttccac cttccttgat cggatgattt    131220
     cgcttgtcga aggcgcacaa cgccagaaaa cgcctaacga gattgcactg acgatcctgc    131280
     tggcgggcat gacgctgatc tttatcttcg cggtcgcgac gatcccgagc ttcgtgcatt    131340
     acgcgggcgg ccatatttcg gttctgatcc tcgtcgcgct gttcgtgacg ctgatcccga    131400
     cgaccatcgg tgctctgctt tcggcaatcg gtatcgcggg tatggatcgg ctgatccgct    131460
     tcaatgttct cgccatgtcg ggtcgcgcgg tagaagcagc aggggatgtc gatacgctgc    131520
     tactcgacaa gactggtacg attactattg gagacaggca ggctacagcg tttgttcctg    131580
     tttctggcgt aacggaacac gaacttgcgg atgccgcaca acttgcatct ttggctgatg    131640
     aaacgccgga agggcgttcg atcgtggtgc tggccaagga gaaatttggt atccgggggc    131700
     gtgatatgcg tgacctcggt gcgcattttg tcccatttac ggcgcaaacc cgcataagcg    131760
     gggtagacgt tggggacagg cagatccgta agggtgcggt ggatagtgta atcgcaagcc    131820
     tcggggaaac cctgccatct gtcgaacaga tccgtcagat tgccgacgac atcgctcgtc    131880
     agggtggcac gccgctggca gtcgcggata atacgcgcct gcttggcgta gtacatctga    131940
     aagacgttgt aaaaggagga attcgcgaac gctttgcgga actacgccgg atggggatcc    132000
     ggaccgtcat gatcaccggg gataatccca tgacggccgc agccatcgca gcggagagcg    132060
     gcgtggacga tttcctggct caggcaacgc cagaagcgaa gcttgcactg atccgttcgg    132120
     aacaggcatc aggcaaattg gtggcaatgt gcggagatgg taccaacgat gctccagcgc    132180
     tagcccaggc cgatgttggc gtggccatga atactgggac tgttgccgcg cgtgaggccg    132240
     gcaacatggt tgatctggac agtgatccga cgaaactcat tgagatcgtg gggattggta    132300
     agcagctgct catgacgcgt ggtgccctga cgacgttttc gatcgccaac gacgtcgcca    132360
     aatatttcgc catcattccc gccatgtttg ttggcttcta tccagcactt tccgcgttga    132420
     acatcatgca tcttgctaca ccagaaagtg cggtgctctc ggcgatcatc tttaacgccc    132480
     tgattatcat cgcgctcatt cctctggcgc tgaagggggt tcgttatcgt ccggtcggcg    132540
     cggcatcgct tctgcggcgt aatcttctgg tttacggtat tggcggcctt atcgtcccgt    132600
     ttatcggaat caaactcatc gacatgctcg tgacgagcat cggtctggcc tgaggacact    132660
     ggcatgactc ttatccgtca acttcgtccc gcgctggtga ttttcgggtt tctttccgtt    132720
     ctcaccggtc tgctctatcc cctcggcatc actgccattt cgcatctctt actgccagaa    132780
     aaagcgggcg gcagtttggt ccatgaaaat gcccaaacgg ttggttccgc gctgatcggt    132840
     cagaatttta cgcaaccgcg ctattttcat ggccgtccct cggcaacgac aggtgctgac    132900
     ccgaatgatc cgacgaaaac cgtcccgaca ccctataacg ccgcggcttc gatggggtcc    132960
     aacgccagcc cgacgtccag ggcgctcatc gaacgtgtca ggattgctgt ggcgcaattg    133020
     aagacagaga atccggacgc cattgcggcg ggctggtcga ttcccatgga tcttgtgacc    133080
     acgtccgcca gtgggctgga tcctgatatt tcgccgcagg ccgctctttt tcaagtcaag    133140
     cgtgttgcac atgcacgtaa ccttcccgag cagacggtca ggcaactggt ggaacacatg    133200
     attgcacatc ccctaatggg gtggcttggc gaaccgcatg ttaatgtgct ggaactcaac    133260
     atggctctgg acgccctgca caggtaatgg aggcacatct cattcgcccg gatcctgacg    133320
     cccttcttcg gcagactgtg ttggacggtg aaagccgcaa acgaggtcgt ctcaaggtat    133380
     ttcttggggc ggctcccggt gtaggtaaga cattcgaaat gctgactgtt gcgcatcagt    133440
     tgcagcgcga tggtgtggac gtcgtgattg gggtggtcga aacgcatggc cgtgctgaga    133500
     cagctgcgct ggtgaatggg ctggaactgg tgccactacg taccatgact taccgggacc    133560
     ggatggcgca agagatggat cttgacgcgg tgctcaggcg agctccgtgc gtcgcggccg    133620
     tcgatgaact ggcgcatacg aacgtgccag gttcacgcca tccgaaacgc tggatggatg    133680
     tcgaagagct gctcgctgcc ggaattgacg ttctgacgac cgtcaatatc cagcatcttg    133740
     aaagcctcaa cgatattgtt gcgtctatta cgcggatccg cgtgcgggaa acagttcccg    133800
     accacgtgat cggagatgca gatgaggtcg aacttatcga cctcactccg aacgatttgc    133860
     tacagcggat gcgagacggc aaaatctatg ccgagcatac tgccggacgg gcgatgctcc    133920
     attatttttc accaggcaat ctgacggcgc tgcgtgagct ggcgctgcgc caaaccgcgc    133980
     agcaggtgga cgcacagctc gttgaccaca tgaaggccaa tgcgattgtt ggcccatggg    134040
     cggcaggtga acgaataatg gtctgcctga ctcttcagga cggggatgcc agtctcttac    134100
     gttatggtaa gcgtctggca gatcatcttc acgctccctg gatcgtgctg catgtcgaga    134160
     cgaaccgtga tctgagcgat gccgctcgcg caacaatggc ctcacagatg catctggcgc    134220
     aatcgctcgg cgcggagctt gtcacgatac caggacagga cgtggcactt gatgctgtcg    134280
     cctatgcgcg gacgcaaaat gtgacgcaga tcgtagccgc gcatccggtt gggcggggct    134340
     ggagcgcccg agttcggcaa tggctcggca ggtcgacgac ggaacgcctg atacagtttg    134400
     cgcagggctt tcctgtccac gttgtaccgc gctctccagg cgagaatgcc ccaaccgaac    134460
     aactacttaa tatcgctcct ttcacggcac gcccttatgt cgtcgggacc ctgattgtgc    134520
     tcggtgcatt agtcgtggca cttctcctgc gtcagagctt cgaggtcagc aacgtgtcgc    134580
     tggcctttct gaccgcgatc ctcggtgtgg cggtcgccta tggtctttgg ccctcgctat    134640
     gggcttctct gatggcgatg ctctgcttca actttttttt tctccctcct ttttatacgc    134700
     tgacaattgc ggctccagac aatgtggtgg ccctattttt tttcttggta acggcactca    134760
     ttgctagcaa tttaggtgcg cgtgttcgca atcaggccgt cgtggcacgg catcgggcgg    134820
     acatcacaca gtcattgtat catttcagcc gtacgatcac cgggatcctc caactcgaag    134880
     atttgctgtg gtcggcaagc catcaaattg cgacaatgct tgactgtgat gtggccatgt    134940
     tgctccctga cggtgagatt ctgaaagtca aggcatccta caatggcgga aaagccgttg    135000
     gggctgccga tctggcggcg gcaacatggg cctggaagaa caataaagta gctggccgag    135060
     gatcggataa tctgccgggt gggcgatggc ttttcattcc tctgcggacc ggacgtggac    135120
     cagtcgccgt gatcggtctt catgcagaaa gaacaggacc cattctcgac cttgaacaac    135180
     aggggctgct ggatgcattg gccgatcaga ccgcctccgc cattgagagt atccttctgg    135240
     ccggcgaact ggatcaggca cgccttgatg tcgaaaccga taaattacgg ggggcattac    135300
     tgacgtcgat ttcccacgat ttgagaacgc ctctggcctc tattctgggc gcaacgtcca    135360
     gcctcgaaag ttatggcgag gagctcgacg aaaatgcgcg caaggaactg ctctcgacca    135420
     ttcatgacga agccgaccgg ctcaatcggt ttgtcgccaa tctgctcgac atgacccgtc    135480
     ttgaagccgg ggcgctccag cctcgtaagg aacgtgtgga tattggcgaa gtgatcgcca    135540
     gtgctctttg ccgtgcagct cgtttgctct ctgatcacga gacagaaatg gtcatcgagc    135600
     ctgatctgcc gatgctactt ctggatgatg tccttctaga acaggcactc ttcaatatcc    135660
     tcgacaacgc tgggaaatat acgcctgttg ggacgaaaat agttgtcacg gcgtccgtcg    135720
     ctgctgatac tctgcttatt cgtgtgacag atgagggcga gggatttgcg gctcacgatc    135780
     ccgaaaccgc tttcagtaag ttcaaacgtt ttaaatctgc tgatcggtct cgtcctggaa    135840
     ctggtttagg gcttgctatc tctcggggtt tcattgaagc cctgggagga aagattgtgt    135900
     cacgcaatcg aaaggactgc tctggagcag agttggttat gacgtttcct ttggacgaga    135960
     aaaatacaaa atgagcaatc catcggtctt ggtcgtggac gacgagcctg ccattcggcg    136020
     cctcctcaga acagccctcg gcagtcaggc atggcgtgtg atcgaagccc ggacggggga    136080
     aatggccctg aacatggcca tggaggttgt gccggatatt gttgtgcttg atctggggct    136140
     tcctgacatg gatggcgtgg acgttcttcg acgcctgaga agcgctcatc caactttgcc    136200
     tgtcgtgatc ctctcggttc gagatgacga acggggcaag gtcgcggcac ttgaagccgg    136260
     tgctgatgac tatgtgacca aaccattcag catggctgaa cttgtcgcgc gcatgcgcaa    136320
     cgcagtgcga cacgcactcc agcaggaagg taccattccg ctcttcgtgt caggcgattt    136380
     gagtattgat ctcgtgcgcc gccagatatc tcgtggcgaa agtgaaatcc gactttcacc    136440
     gcgtgaatgg gatattctgc gcatgctggt tcgttatgcg gggcgtgtcc tgacccatca    136500
     gaccatcatg agtcagttgt ggggtgcaac aggagatgta cagcaacttc gtgtctatat    136560
     caggcagata cgtcagaaga tcgaaatcga tccggagagg ccacgtcata tcatcactga    136620
     aacgggagtt ggataccgga tggttcaatt gtaaaaattt tctgaccatc tcttcatata    136680
     tcaacatgat ttttatgaat tgaaataaat taggtttgct tcaggcgaat cttagtcgaa    136740
     aactggaccc acgcttttcc cctgatgcgc ctgtccgctc aatgatgcag gagcagacag    136800
     gcggcagtcg ccctcatttg agacaaacag gggccgaatt gacgtatctt gaagcagaca    136860
     tggactccgg atccctttac cgctcttgcc atttttcttg actacggcct gcttgcccta    136920
     tagacgagtg actaatcact cataagaacg tatcgagatg gccagaccct taagcgaaga    136980
     aaaacgtgcc gccattctgc gcgccgcaac cgaattggtg gcaaccatag gtataagtgc    137040
     tgctacatcc cagatcgcaa agcgcgcagg catcgctgac gggaccttgt tcacttactt    137100
     tccaacgaaa gacgatttgc tcaaccaact ctatttgagc atcaaatctg ctctggccga    137160
     agcgatcatg gcagattacc catcacgggc cggggttttc gagcgtactc gacactgctg    137220
     ggacaggctg gtgaactggg gagcagagca ccccgcgcag cacaaggcga tgcggcagct    137280
     ttctgtgtca gacagaatat cagaaaacac tcgtgatgcg gttaatctcg cattccaaga    137340
     catcaacaga atgattcgag ataaccttaa ccgtggcgct gctggcgatg aatctgcagc    137400
     ctttgtcggt gcgctcatta tagcgatgtc ggatgtaacg ctcgactgta tcgcagccca    137460
     tcccgagaag atcgacctgt atcgggagag cggctttcag gtcttttgga acggcataag    137520
     gtcgtaagtg taattgtctt tattaaatga gtgagtaatc aatcgaaagg atcggaaaat    137580
     gtctaaaatc tggtttgtaa ctggcagttc acgcgggctg gggcgtgata ttgtagaagc    137640
     ggctctggcg gcaggtgaca gcgtcgttgc aacagcgcgt aaaccggctg atctggatgc    137700
     cgtggttgcg caatacggcg accgcgtatt ccctcttgcc cttgacgtta ccgatgccag    137760
     agccgcgcag gccgctgccc tgcgggcgaa agagcacttc ggacgtattg atgttgtggt    137820
     gaataatgca ggctacgcca atattgcctc agtcgaagac atcacgattg aagacttcac    137880
     gcagcaggtc cagacaaact tcttcggagt ggcctatgtc agcaaggccg ttcttccaat    137940
     cctgcgtgaa cagggacatg gacatatctt tcagatcgcc tccattggcg cgcgtatcgc    138000
     aactcccggc ctgagcgcct atcaggcggc aaaattcgca gtacgtggct tctctcttgc    138060
     gttagcgcag gaaatggcac cgcttggtgt caaggtcaca acgattgagc cgggcggaat    138120
     cagaaccgac tgggctggtt catccatgaa aatcccgcca atcagtgcac cctacgaaca    138180
     gacagtcggg acatttgtca agatgatacg tgagagttcg ggtcatcaga gttcggatcc    138240
     agccaagatc gcaagtctga ttgtcgatct agcgaaccgt gcggatgctc caacggaact    138300
     gctcgtcggt gtggacgctg ttgaatatgc gaagcaggct gctgaagccg taacagaaaa    138360
     tgaccgtaag tggcggagcc tctcaatcac gactgcggca gactgacaca gtatgacagg    138420
     acagcaaatg aaacgcgcac atatcctcgt ttacacctca tctgcgacca agatccctct    138480
     tgtaggagga ggaacgcatg atgtcggcat ttttcttggt gaactggtag agccgattga    138540
     acctttgatt cgggccggac atctcgtgga gtttgtcagc cctgatggaa agggctgcgt    138600
     gattgatccg gcatcttaca gaataacaaa ttggggactg tccagaagca ggatggagca    138660
     tgccagaaat ttctttgaga caactctcca ggaactggga gttggaaacc cggtgaaact    138720
     gtctgacatc cttgccgaca aaaccagact gaatagctac gacgtcgttt ttatccctgg    138780
     gggacatgct cctatgacag atgttctgca taaggactgg ctggtgagtg atgaatacaa    138840
     cgaccagacc ggtgagttgt tattgcattt tcataagaac aataaaatta cgtccgccat    138900
     ctgtcatgga tctgctgcac ttggagcggc tccccaagtg aatggcaaat ggatctatgc    138960
     cgattacaat atgacctgtg tcagcatggc cgctgaatgg ctgacggaag atattccgtt    139020
     tttcaatata ggcggccata tgccggatta tccggtgcgt attttgaaac gacttggcgg    139080
     caaggttcat actaaaatgc tcggcagaag caacgtagta gaagatagag aactgattac    139140
     gggccaagat ccttatagtg ccaaggaact tggagaaaag ctcatgaaaa aaattgaagt    139200
     gagacaaaac ttctgaacgc aataatgttt ccatccgatc accaataagc cacgcctgat    139260
     ccgcgtggtt aaaggagcct gattagcgtt aatcctcaaa tgcgcagatt gacggcgtgc    139320
     catagaaccg gctcaggcga aggatttacc gggatcgtca gtatgtatca gatattgttc    139380
     ccaaagagca aagatgtccg cttcccccca ttgctgacgt aacttccgcc agaatacgca    139440
     gttaaattct cacgaaatta gcctgctatt tttatcatta ataagtggat ttttatgacc    139500
     taggtagaac attatccgga ttaaatggat tcataagccg ctgataaata ataactttga    139560
     ttatcattat cttctggttt tcgacaaggt tttttcggaa accagaagat agtaataaat    139620
     tcccttgccg cacggaaacg cccgcaacga tgccgacaga cccagacatt ccgctgtcgc    139680
     ctacttctcg gacgtcaatg tgcagccggg ggcttctccg aggcggacac ggctcaaagc    139740
     ttgcaggaat tggtaaccgt caatcccggg gcggttcagt cctttaagcc taaaatgacg    139800
     ggggacctgt gccgcaagtg gcctaaaggc acagagccag acgtgcttgt cactcgatca    139860
     acctgccgac caacaatatc aaactggcaa accctggtta tgatcgaggg acaatcggtg    139920
     gagaaggtca attcgagttc attggacgaa ttcatcgtcg ccgaagtctg ggcgggcacg    139980
     cttcagttca ttgtcagcgc aggctttgtg tcagcgcctc cttgacgctt agatatagtg    140040
     cagatctgaa cgcctcgtcc tggttgtgaa gcttgtagag ttccaactcc tctttccggc    140100
     gttttagcat gacttctttc ataatttttt caaatgccaa gttacggctg tagggatcag    140160
     aattttcatc aaatttcttc tcgaaatcgg ggtgggcctg aacactttca acgatgttca    140220
     gaaacttgat ccgttgttct tccggggtgg cgctccagcc ttggaaccaa cgttcgttga    140280
     agctgcggat gatctcttcc aacgggtctt cctgcacctc tccttcgcga tagccgcggg    140340
     gggtcgggtt ctgtggatct agctctgctt ctgaagtgtc caggccgatg gtctggttta    140400
     gttttgtccg ctctagccca tatgacgaaa ggtcaacggc cttgagaaga tcatccaacg    140460
     catcctggtt cgggtcctta atgtttagct tcgggaccaa gaacttcagg aaccagaaga    140520
     gcttctccca agcctccact tcgaacggca tgattgcagc catctggccg tagatcttca    140580
     cgaactgctt cgctttgatc ttgaagtcga tcttctccgg gtcttccagt tccaggccgg    140640
     tgttgaaacg ttcggcagcc acgtcaatca gggggctgag cttctcggaa tcttcgccgt    140700
     caaagaacct tttgcagaat tcctctacct ctgaccattc gtagacgccg acatcatcca    140760
     aagctgcttt cagctcgtgt aaaacgttca cgtccgtcgc ctcggatagg gtcgtcaccg    140820
     tgaagaacgg gtcgaaggca gccttgatgt cctcgatcga gttgaagaag tcgagaacga    140880
     acagatcctc ggtccgtttg cctagcttgg gggaggaccg gttcaaacgg gacagggcct    140940
     ggactgccag aaccgactgc agctttttgt cgacgtacat cgcacagagc ttcggctggt    141000
     cgaaaccggt gagatacttg tttgcgacga tcagcaggcg gaattcatcc ttatcaaact    141060
     cgctgcgggt cttgtcctca ggtacgccat tcatctcggt ctcggtgtac ttgaccccat    141120
     cgacctcctt ctcgcccgag aaggcgatta gcgccttgaa cgggttaccg cgcttggcaa    141180
     gctctgcctg tacggccttg tagtagcgga tcgccacctc gatattttgg gttacgatca    141240
     tccctttgcc tttgccgcgc aatttcttgg ggtttaccac cttgtcgatg aaattctcga    141300
     ccatgatctc ggccttggtg ttgatcgtct gctggctccg ctcgacatag gcgcgcagct    141360
     tcttctgcgc cttggatgtg tcgaacagag gattgtcctc aatggacttc tggatctcgt    141420
     aatagccctt gtaggtcgtg taattcgcca aaacgtcgag gatgaagccc tcctcgatcg    141480
     cctgcttcat gctgtacagg tggaacgggc ggaagcggcc gtccgactgc tgctcaccga    141540
     acttctccaa ggtgatcggc ttcggcgtcg cggtgaaggc aaagtaggac gcattgccgc    141600
     gcatcttgcg ggcctgcatg gccgccagaa tcttgtcctg cgcgtcatct tcgtctgggt    141660
     cgccgcccat tgcctgattc atcttgtcac tagcgatgcc gctctggccg ctgtgcgcct    141720
     cgtcgatgat cactgcgaaa cgcttgtcgc ccaaatcctc tataccgtcg atgatgaagg    141780
     ggaacttctg gatggtcgtg atgatgatct tcttgccgtt ctccagtgct gctttcaggt    141840
     ccgaggactt cagcgccggg gccacgatat ttttgacctc ggagaaatcc ttgatgttgt    141900
     cgcgcagctg cttgtccagc aggcggcggt cggtcacgac gatcacgctg tcgaacagcg    141960
     gggcgtccag cgccctgacg ccgggcaggt ctagcttcgc cggataggtc tcgatcagct    142020
     ggtaggcggc ccaggtgatg ctgttggatt ttcccgagcc ggcagagtgc tggatcaggt    142080
     atttatgccc tacgcccgtc tgagcggcgt gggacagcag ctttcggact acattcagct    142140
     ggtgatatcg cgggaagatc agcgtcttct tcgtcagcgg gtcggtcttc ttgccctcca    142200
     gcaggacgaa atgctggatg atcccggcaa ggctctgcgg ttgcagaacc tcttcccaca    142260
     ggtaggacgt tttgtggcca ttggggttcg gcgggttgcc cgcgccctcg ttgtgcccct    142320
     tgttgaacgg caggaagaag gtcgaggctc ccgccagctt cgtcgccatc cacacctcgt    142380
     cggtgtcggc ggtcatgtgg accagcacgc ggccaaagcg cagcagggtc tggtttgcat    142440
     cacgctcacg gtactgcttc tggccgtggt agcgggcggt ctggtgggtc caggcgttct    142500
     tcagctccag cgtgacgatg ggcagcccgt taaggaacag caccatgtcc acagattcat    142560
     tcgggttggc tgtgctgtga tggacctacc gagtcacgct ccagatattg gcggcaaagt    142620
     tgtcgtggac cttttgcgcc gaactggcca gcggagcggg atacatcagg tggaaatgcg    142680
     cgttgtcgac gggcaggccc tttttcagga cgtgcagcag gcccttggac ttgattagct    142740
     tgtcgagctg gccggtgatc ttggcctgcc aatcggcggg gttgtgctgc ttgagcttgt    142800
     cgaggtcttt ggattgggtg gtttcgagga actcccagaa cttcgcgcgg tcgagcgcga    142860
     gggtcgcgtc gaaatcagcg ggctggccga tgcgaaaagg gccagaggcg atggccccgg    142920
     cggccagctc ttcggagctc gcaccgcaaa gccgtctctc gacggcctgt tcgagggcga    142980
     tttccttggt attgctgacc gcgacattca tggcgttgct ttcaaatgag tttctacccc    143040
     gacacatcga ggggccgggc gcttacaata ccttgatctt tccagtcacc gccgcgttga    143100
     tcaagctcgt cttgtattcc cgtaatgcgg tgatctggga ttcttttatt gcaataacgt    143160
     tatggaattg cgctgttgta gccctgacat gttcaacgat ttgcaattgc tcgtccaacg    143220
     gcggaagaag cagcgggcaa tccatgaagt catctgtgta gaggcgatag aagccttcga    143280
     cgatgccgcg tacgcgcaac cgaaattcgc caagatactt cgacgtcttg aacagaatct    143340
     caaagtaatc actcgacgcc ccttggacta aggggcggaa caccgaatag tcagggctga    143400
     cgaggccttc cattggagcc aaggagaaaa cagcaaggtg cgccttgagg cggttcagaa    143460
     cgaggtcgcc cgtccggacc agcttcgcac cttgatagct ctcggaagcc aaggacttct    143520
     caacgagatc agcggggacc agtccgagct tctggctcat tgataaatgc tgctcctcgc    143580
     ccttggccga gcgttcgttg atctcgacga acatgtgctt gttgcgcttc acctcccaat    143640
     gcgcggggat ctggccgatc cagtcgatgc cgctatcctt catgggggcg tcggggttca    143700
     ggccgcgggt gacggcctgc tggatcagga tctgcctgcg ctcgaccagg agcctgatct    143760
     gcttctcctt gatacgcacc gcctcgtcaa tcagcgcgca tttcccatcc agaaacgccg    143820
     cgatggtgcg ttgttcatcg ggcgacggga gcgcaatcaa gatcgtccgc atttcgtcgt    143880
     atcgggtcgt ccataggtca gccacgatgc cgcgacccac gcggtagtac tcctcaacga    143940
     aagcatagga tttcaacaga tgatgacaga attcaggcag aattcgcttc ggttctagca    144000
     caatgttgat cagtgaaact gaaccgtcaa gcggggaaat accgctggaa cccttgcggt    144060
     cggaccgact gttgatgacg aaatcacccg ctcttaccag cttgcgattt tcaccatcgt    144120
     tagtttttgc tgcgttcgcc aattgcggga agatgccatt cttcgtgacc gacaacggtt    144180
     cgaaatccgt gtcggatacc ttatgacgcc gttcttcgaa aagcccgcca aggcgagcca    144240
     gttcccaatt ggcggggaac tggccaaccc actgaacgcc actgtcgcga tacgcgtcgt    144300
     acttcgaata tgccgcgatg gtcattccgc cgtctccagc ttggtcgcga cctcaacacc    144360
     aaggatatcg gcaatcagcc cgtcggcctt ttcttccagg gccagaatgt cctgcgtcac    144420
     ctcttcaagg ctgcgcagcg gcttgtggcg gtagaaatac ttgttgaagc tgatctcgta    144480
     gccgatcttc acgctgtcta ggttgatcca ggcttcttcc acatgcggct tcacctctgc    144540
     caggaagtag cggtggatgt tatcctttag ggccacgctt tcggcatcgc gcagctctgc    144600
     ggtgctctca taggtcaggt agctgccatc cttctgccgg taccaaccga aatcggccag    144660
     atcctccgcc gcacagccca gatgcgtggt cagttcctca acctctgcgc cggtcagctt    144720
     gtgcttcttg gcgatgacct tctgggcggt ctcgtcgtac cagctgacgg cattcaggat    144780
     ggcgttcttc tcggtcacgc ccagcttgat cttgcgcgcc ttgatcgcgg cgttgaccac    144840
     cttgcggaag gcgttgaagt cgtcggtctc ctcaaggccc acatcgccca tgatctgggt    144900
     cgccgtggcc agtaggtcgc gcagcttgac ccagtacctg gtgtcgagca gcttggcctt    144960
     cgctttggcg ttcaaggtta gcccggcttc ctcacaccac gcggtgatct gcttggcctg    145020
     ctccttcaga aagcctggct gatagacctg atccccgtgt tcatcgtaga gccattccat    145080
     cggctcgcgc agggatttgt caaagcgcag aggggcgagg cgttcggcgc taaaggccgc    145140
     acggcgacgg tccgggcgtt cgatggtgac tttgtgatag ccgaaatccg cgttgtcgaa    145200
     gacttgcacg gcgatgccct ccggatcgcc cgccgcgtcg atctggcgct cgacaggggc    145260
     gaagttcagg aaggcctcgg tgatctgctg gatatgttcg tccgagaact cgcagttctt    145320
     gtcgccaagg ttcttgcgca gcttgcggaa catgaggttg gcgtcaatca gttggacccg    145380
     cccgcgccgt gcctcgggct tggcgttaga caggagccag atataggtgg tgatgccggt    145440
     gttatagaac aggttgttgg gcagctggat gatggtatcc aacatatcat tttcgatgat    145500
     aaagcggcgg atgttggatt ccccgctgcc cgcatcccca gtgaacaggc tggagccgtt    145560
     gtggaccgac gcgatgcgcg agcctagtgg gctggcgctg gtgggtttca tcttgctgat    145620
     catctccatc aggaacagca gctggccatc cgatgagcgc ggggtggcat ccatcgtttc    145680
     gacattgccc cagtagtcgg ccagcttgac ctgaaaacgg ggatcaatga cgcccttgcc    145740
     gtctttgatg tacttcacct cgctgttcca gcttttgcca tagggcgggt tggaaagcat    145800
     gaagtcgaag cggtgagcgg agaattcatc ggtggagagg gtggagccga tgcggatgtt    145860
     ttcagggtta ttgcccttga tcatcatgtc ggatttgcag atcgcgtagg tttcgtcgtt    145920
     gatttctttg ccatagaggt aaacgtcccc gtgggcatgg aaaggaccat ctgcgtccgt    145980
     gatatagttc tgagcctcgg tcagcatgcc gcccgacccg caagccggat cgtaaatcgt    146040
     caggatctgg ggaagacggt cctttatcgg gtcgaaaacc agatgcgtca tgagatgaat    146100
     cacctcgcgc ggggtgaagt gttcccctgc ctcttcgttg ttctcttcgt tgaacttacg    146160
     gatcagttcc tcaaagacgt atcccatacc caggttagag aggcccggaa gcgtgttgcc    146220
     ttccggatcc tcaatgtcat tcggggtcag gttgacccag ggggagacga atttctcaat    146280
     gacgtccaga agcacctgct tctccgccat atggcgcatc tgttcgaaca ggttgaagcg    146340
     accgatgatc tctttgacgt tgtcactgaa gccgtcgagg taatcctcaa tattagctag    146400
     gaggatctgc tggttgttgg tggcagtgtt gtacagcttc tttaaggtcc agtggctggt    146460
     gttgaagaag acgtaaccag aggcatcctt gagcggctca tcgtccaact ccgtcacgcc    146520
     aatgtcttct ttttggtacc ggacctcttc cagaacggcg tccttggtcg gctcgagcaa    146580
     cgtgtcaagg cggcgcagca caaccatcgg caggatcaca tcgcgatact tgccccgtac    146640
     gtacacatcg cgaaggcaat cgtcggcaat acgccagatg aaggaaacaa ggctgctgtg    146700
     ggacgtctgg ttcaatgtgg gcctcaaaag ttgatgcgag ggcaatagcc cttcgacgac    146760
     tactcttaag ggcttgattc tgcaatcagc cttgggacgg gctctgttgt cagctgctcc    146820
     gcctattggg cgtaaaagaa accccactta acttcacgtg gcccggggac gaagtcgagg    146880
     actgaactgc accgagatcg gcggtcatgt ctgcttccaa gcgctcgcga cgcgaagcgg    146940
     acagaccggt ttccccccca tagctgcttt tcctgaacga tttttttcag aaggacaagt    147000
     tgtacttgat gtaggcattt ttggccctga aaattgcggt atcattctcg gccagtttct    147060
     atctctcgct ggcggtttca aaactgtgag ttatcattaa agaagaaagt gattcgtgga    147120
     tgtcacggat ctggccatgt cagagggtca tcatgtcacg aaacgcaaaa tgcttgtctc    147180
     aactggatag tctggaacag aagtccggct cacaacgcat ttccgcatat gtaaggcggg    147240
     gattgatgcg gtatcaggaa gcagcggatt atctcgggat cgccaaggga acgctggcca    147300
     actgggtttc acagcgaatt ggcccacggt ccatcaagat cggtagcatg cgattgtttc    147360
     gtcaggaaga tcttgatgtc ttcattgagg aaaagctttt tgaaaccgaa aggtttgaaa    147420
     aacgccgtcg ccgtcagcgc ggacggggtg cgctggtcct gacctgccag catcctgatc    147480
     tgtttctctt ctccgtgctg gtcctggcgt tggcagtctt catcttcacc gtgccatagg    147540
     ctttttttaa acgcgctctg gttatctttg gttatcctga ctagcagcta gcgtgttttg    147600
     tctgcgatgt ctccaggcac gggttggtag tagcgattga gcgacttcaa gtcgcgatgg    147660
     cccgtgaccc gggtcagttc aatcgggttc agatagcggg ccagacgcga tgttgcttca    147720
     tggcgcaaat catgaaaggt caggtcctga attcctgctt gccgggtcat gcgaccgaac    147780
     aggacagaaa agatttttct ctctcccacc gaaaagacga cgtcttttcg gtcaggcacc    147840
     ttttccatgg ttgcacgctt ttccatgaga acgcgttgtg cacccttggt catggggcgg    147900
     atttcgggac cgagctcttc tctatgccgg tcactcttca cacgggcgag ggaaatggtc    147960
     tgtctgcgga agtcgatatc ctgccagcgc agactgaggg attcccccag acggcagcct    148020
     tgctcgattg accacctgat gagccacact acatcagggt agtgcctgaa aaccccgtcg    148080
     ggccgagaag cagctcgcag aagttcggct tcttcgccat cctttaatct ccggtttctc    148140
     ttgcgatccg ctccctcggg ccgtttggtc cgtttggcag atgcatgatt gaggatggtc    148200
     gtgtcccact ccgagttggc gtattcgacg atggctgcaa tcatgttcag gcgtttgacg    148260
     acggttccct tggccagtcc cgcagccagc atggcgtctc gaaagttccg gacgtcgctg    148320
     ttggtccatt tgtcgatttt caatgaggca atgtcggaac caagaagggc cggaaggtga    148380
     cccatacgat cggcatcgcg ctctgtcatg cgttcccgac caaagcgctc aaagagttcg    148440
     ccaaaagtaa tctggtttct cttgcgtgcg gggggctcaa gttggcccac atgcgccttg    148500
     gcgcgtacgt cctggagcca gcggcgggca agactggctg acgcgaaggt ttcgcggtga    148560
     cgtttgccgt tcaccatcct gcgggcctga tactggccgg ggccacgata ccagacgcct    148620
     ttgggcaacg gcttccctgt tacagggtcc ttgagggtct cttttggtga tttggtcatc    148680
     gttattcgat cctctcccag tttggctcgg gattggctca aaaatcaacg attttcagat    148740
     taacctgctg caagtccttg aaaaacttgg cgtcccgtac gggattcgaa cccgtgttgc    148800
     cgccgtgaaa gggcagggat aaataggcaa attcaggcag atgggcgcaa ttatgcacaa    148860
     cttcgggcaa caccaaaacg gcagggaata gccccgcgca actgtttaaa ggtcccactg    148920
     gaccacaacg attttcctgc gtttagtacc cgcttcgtgc cttggtctac cggaccaccg    148980
     tgatcgctcg ccttccaatc ttccatacaa ttgaaggtga aagatcgtgt acgaagataa    149040
     cgaaatgcgt gttgaaatcc gtgccagact gaaaggacgg atccgctaca atgtgactac    149100
     ggaccagatc gaagtcatgg tgggtgaaga tgatgaactt ctgcgctggg agaccataga    149160
     ccgcaggaca atgtctcagc atctgccacc aaccgtgata gatcgactct gggacatgat    149220
     ctgtgacgcg gctggaagcg gcgtttacgc tgatgatcgt ctggccgggg tgcaatttct    149280
     tgggctccat cgcatcgtcg atcatctcga acgggaaggg cttcggattg aggcagtccc    149340
     tgtgccatct ctgtcgccgc cagcgctggt cgcggtgact ctggccgcgt tcctggctgc    149400
     gcgagaaaga acaaccttgg cagaaatcat gcaaaacgtg atcgacgtgc cgccagaaaa    149460
     agagctgctt gttatgctca aaaatgcagg atgggagtca cgaaggaccg ccaccgggcg    149520
     cttctgggtg aaaaccaggg ggtgaatagc tgacatcgga tacgtccgtc cggcttggat    149580
     gggcgtatcc gatgaaagga aggccctgac acgccggacc aacactgggc gattgcgctt    149640
     cctgagggag agccataacc tgcttccatg actcaaaatc cctctgaaaa gcccaagtcc    149700
     cgtgcctcag cgaaagtcgg cacgactgtc acaaaggata atctgaaggc gcttggtgcg    149760
     gaccgacttg cggacctgct catcgaactg gcagggcagg acaccgcact gacccgcagg    149820
     cttcgcatgg cgctgacagc ggttcacgcg aaggataaac tcggcaagga gatcgaaaag    149880
     agactgcgca cgatccagcg ttcccgtggg tttctgccct gggaccggat ccgtcctctg    149940
     gctgctgaac ttgatacctt gcggcaatcc atcctgggtg acgttgcctc tgccgatgtc    150000
     gggcaggcca tttcagccat gaggctgctt gtggagattg ccccatccgt ctacgagcgc    150060
     tcggacgaca gttccggata cctgtcggac gtcttccggg aggccgcttc tgatcttggc    150120
     gttctctggg gacgacaggc caaccgggat cccgccatcg ttgtcacaga ccttcttacg    150180
     cttctcgatg atgacgggta tggcacctgt gatcgtctgc tcgccgcgtg cggcacggca    150240
     ttaggcgaaa cgggcgcagc catgctcaga actatgcttc tggcacgact gcgcgacctt    150300
     cctgcgtcaa aggggaatag cgattatcat accgacatcg cgcgtatgca ggtgatcagg    150360
     cacctgcggg atcttgcgga tgccatgggt gacgttgatg cgtatagtga agctgtcagc    150420
     ctgagtgacc gccagtatgc ctataccggc gacgtcgcac gccgcttgct ggacaagggg    150480
     cgcgcccggg aggcacttga ctggctcgac cgggaaactg aagagaactc tcgcttttac    150540
     aaggaaaacg acgatctgcg gattgaagca tacgaggccg ttggagaccg agacaaagct    150600
     caggctctgc gatggaacgt ttttcgggaa cgcctgagcc tgccgcactg gaaagcctat    150660
     cagcgtcatc tcagtgatta tgatgcgatc gacgccgaag agcaggcact cgatcacatc    150720
     cggaatttcc cgaatagaag cgtggtcctg tctactcttc tggaatggcc cgctctcgac    150780
     gaagctgccc gtctcgtgcg gcatcataca gcggaactgg acggacggga ctacgggacg    150840
     ctgcgtccgg cagcggaacg tctatctgaa gcttatccca acgaagcgac gctgctctac    150900
     cgtctgctgg tcgaggccgt gctggacagg gcgctttccc gttactacgc ctatgccgca    150960
     aaggatcttg cgtcctgtca gcgacttgca cccatgttga ccatggctga aggcatggaa    151020
     tcccatgaaa cgttcatgac ccggttgaag gcttcacata agcgcaaact gggattctgg    151080
     tcattgatcg ccgtgccctg agagcagggt tgggggaaaa tggtctggcc agtattgcga    151140
     gcgaattcca ttgttacccg gcaagagttt ggatatactg tcggcatatc ccaaatggag    151200
     gttacgatgc tcacccgcac gacgctcttt ctgtccaatc gctcccaggc cgtgcgtctt    151260
     cccaaagcgg ttgcatttga cgtcaacctg aaagacgtcg tgatcatccc ggacggtgcg    151320
     cgtcgtataa tcgcacctgc aaatgccgca tgggacgatt tctttgccgc gccgggcact    151380
     ccactgcctg agcgtgatca gccgaggatg caggaacgcg aaagcttctg atgcttcgtt    151440
     atcttctgga tacaaacttt tgcattcgtg tcctgcgtga tcgtccgcaa ggcttgcgtg    151500
     agcgtttcaa tgataacgcc gaggcgctct gcatctcgga tgtcgtgctt tacgaacttc    151560
     tctatggagc cgaaaaatct cacgatccgg caaagattcg acgtgaggtt gagcattttg    151620
     ccgcacgtct gtctgttttg ccgtttgatg atgacgccgc agcccataca gcggaaatca    151680
     gggcagagct ggaaaagcgt ggctgtgtca tcggcccata cgatttgatg attgccgggc    151740
     acgctcgaag cagggggctt gtctgttgat tttcactgag aactgacccg ggtagggcgg    151800
     aaattttcat cgagatttga cccatgcctt cacactcccc ggcatcatct gctggggggt    151860
     ttttggagtg attgacatgg agcttctgag tgtgatccgc cggtggcact gccgggatca    151920
     tcttccgatc cgcgagatcg aacgccggac gggactgtca cgcaatacga tccggaaata    151980
     tctccgggca cagagtattg aaccgcggtt ccaggtcccc gaacgtccca gccgactgga    152040
     cccgtttgct gacaggctga ggggatggct ggtcctggaa gccgctcgcc cccgcaagaa    152100
     ccggcgcacg gcgcgacgac tgcatgaaga ccttgtggca ctgggttatg atggatccta    152160
     cggacgggtg gccgctttca tccggcagtg gaaacacgaa cagcaccagg cacgccagac    152220
     aacgggtcgg ggtgtttttg tgcccctgtg cttccagccc ggggaagcgt tccagttcga    152280
     ctggggcgag gactgggcgg tcattgccgg ccgtcgcgtc aagctgcagg ttgcccacac    152340
     caaactgtcc ttcagccggg ccttcatact cagggcctat cccctgcaga cccacgagat    152400
     gctttttgat gcgctgaccg aggccttccg cgtgctcggt ggcgtgccac ggcggggtat    152460
     ttttgataac atgaagaccg ctgtggaccg gattggctct ggcaaggcac gtcaggtcaa    152520
     tctgcgcttc atggccctgg ccagccatta cctgttcgag acgaccttct gcaatccggc    152580
     agccggatgg gagaaagggc agatcgagaa gaccgtgcag gatgcccggc gccagatctg    152640
     gcaggatctg cctgcctttc ctgatctggg ggcgctgaat gcctggctgg aagcccgctg    152700
     cctggactgc tgggaacggc tgcagcatat cgaactggcc cggagcatcg ccgaggtcca    152760
     tgctagcgag cgtcctcacc tcatggtgcc ggggcgtccc tttgacgggt ttgtcgaaca    152820
     gaccaagcgc gtctcaccaa cctgcctgat ccagttcgat ggcaaccgct acagcgtgcc    152880
     ggcctccttt gccaatcgtc cggtcagcct gcgggtttat cccgacaggc tgcgcattat    152940
     cgccgaaggg caggttctgt gcgtgcatga ccggatcatc acgcgttcgc atggtgtgcc    153000
     aggccgcacg gtgtatgact ggcggcatta tctggcggtc atccagcgca aaccgggcgc    153060
     cctacgcaat ggcgcgccgt ttaccgaatt gccagccgcc ttccggaccc tgcaggatca    153120
     actgctcagg cggcctggag gcgaccggga aatggctgaa atcctggccc ttgtgctgca    153180
     gcatgatgag caggctgtcc tctgcgcggt tgaactggca cttgaagacg gcgtggcgac    153240
     caagacccat gttctcaata cgcttcatcg cctgatcgat gccaagagaa ccgtggttcc    153300
     ccggctcgat gccccacagg ccctggtgct cgaacacgaa ccgtgcgccg atacagggcg    153360
     gtatgacatc ctgcgaaggg acagccgcca tgcgtcatga tcctgcggct gcttcacttg    153420
     tggtcatgct ccgtggattg cggatgtatg gcatgtccca ggccacggcc gacctcatcg    153480
     agcagggggg cacctgcctt cgaggcggcc atccccatcc tctcacaact cctgaaggcg    153540
     gaactggccg aacgcgaagt gcgctccatc gcctaccaga caaagaccgc ccggttcccc    153600
     gcctacaagg acctgtccgg gttctccttt gccgatacgc aggtcaacga gcccatgatc    153660
     cgccagctcc atagcgggga cttcatcgag cgtgctgaaa atgtcgtgct gatcggcggt    153720
     ccgggaaccg ggaaaaccca cctggcgacc gcgctggcca tccaggcgat cacccatcac    153780
     cgcaagaagg cgcgcttctg gtcaacggtc gacctggtca atgcgctcga acaggaaaag    153840
     accgccaacc gggccgggca gattgccgac aggctgctcc gcctggatct cgtgatcctt    153900
     gatgaactcg gttatctccc cttcagtgcg tctgggggcg ccctgctgtt ccatctgctc    153960
     agccgcctct acgagcgcac cagtgtcatc atcacaacca atctgagctt cagtgaatgg    154020
     ggagacgtct ttggtgaccc gaagatgaca acgacgctcc tcgatcggct gacccatcac    154080
     tgtcatatcc tcgagacagg aaatgacagc tacaggttcc gcgccagcac cgccgcgtca    154140
     aaaaacagaa aggacagatc ctcttcttga ccgcccgccc gactgtgcct gaaatagcat    154200
     ctggctgggt caattcctga tgaaaaaccc gggtcagttc tcagtgaaaa tcaacaggct    154260
     tgtcgttgtg actggaaact tacgagaact tacgagggta gatgggttgc gatctgagga    154320
     ttggacggcc ggttaaggga taagtggagc ttctgcttcg gcttctgcct catgtcagac    154380
     gtaacaggaa ttgctggagt tttctgaaag cagacatata gcgagatgat aatatgcgca    154440
     tggaaatgtg cataaacatg tgctatgctt cagttctcat gtaaatagga tcaaagctat    154500
     ggttcgtgtg cactccacca gtccgttgcg tcgtcccact aatgtgacgt tacctgctca    154560
     gttactcgaa gaagccagat cgcttgatct caacatatcg caggcctgcg aacaggggtt    154620
     gaagtcagcg atcgcttcgg ttcgtgctca acaatggctc gcagaaaatc gctcctccct    154680
     tgaagcatcc cgacagtatg tcgaaaagaa tggtcttcct ctggcggatt atcggaactt    154740
     ctgaatggcc cgttttgatg tgtattgttt ggccggacga ggtgaagcgc gtttcgtttt    154800
     agatgtgcag gcagacctgc ttgacgagtt gggcacccgc attgtggtgc cgcttttatc    154860
     acagaaagtg gcacccaggc cggcaaagag actgaatccg attttcgtag tcgatgacca    154920
     gtcgttcgtt atgatgacac agtttatggc tgctgtacct gaccgtgatc tgaaaaaagt    154980
     cgtgacgtca ttgtctcttt atcaggatga aatcatccag gctattgatc tacttttaac    155040
     tggtttctga gggagagcct tggtcggctt ccgcctcatt gcagacattt gttccttctg    155100
     tggggcttgc cgaaagcgga catttcgtat cacaatcagc tagggaaggc cgcgaacacc    155160
     cgccgtgcct atcgctcggc aatccggggc tggtacgttt gggcggcacg tcatgacctt    155220
     cccgccttac ctgctcgtag tgaagacgtt gccacctatc ttgcagatct cgctttgcgc    155280
     gaacgtaagc cggccactat cgaactccat cgtgcagcac tgcgctatct tcatcacatc    155340
     tcccatcttc ccattcctac gacacacgcg ctcgtctctg agacgctggc gggcattcat    155400
     cgctcaccaa ggaaaacgcc accacgtcag gtcaaaggtt tgacatggga gatgatctgc    155460
     gaagttgttg ataggatccc gatgacctcg ctggtggatg ctcgtgatcg cgccattctc    155520
     ctccttggtt atggtggtgc gctacgacgc tccgaactgg cggcgatcca gctcgacgcg    155580
     gaaatctcac agaagggttg tacatcgggt tagattatga aaaagtctgt tttgtagaaa    155640
     agaaatttcc ataatcatca agaaaacccg atgcagacag agtgtagcgc aggcgcgtat    155700
     gagtttccag cctcctgtgg acggcgtgtt gtggcccgtt ttgacggggg tcgcatgagt    155760
     tcggatgggg gcgtaattct ggtgaagcag gctgatgaca ttctgggtct cagccgccgc    155820
     tttgctgcct gttttcgcga taagcggcat cccggctttg tggaataccg ggttgaagac    155880
     cttgtccgtc agcggatcat gggcctggca ctgggctatg aagatctcaa tgatcacgat    155940
     gccctgcggc atgacctgat ctttggtctg gcctcgggtc gtctgtcagg aggccgggca    156000
     aactgcgcag cattggctgg caaatctaca ctgaaccggt tggagcgcag tgggcacaag    156060
     gcagatcgtt actgtcggat cattgctgat catgaggccc tggctaccct gttcgtcacg    156120
     ctcttccttg accagcatga gcacgcaccc gcccggatcg ttctggatgt ggatgccacc    156180
     gatgaccgta tccatggcca tcaggaaggc cgcgcctttc atggatatta cggccataac    156240
     tgctatcttc ccctgtatgt cttctgcggg gaccatctcc tcagcgctac cctgcgcacg    156300
     gcagacaggg acccggggaa ggaagcactg gcagacatcc gccggatcgt ggagcagatc    156360
     aggagccgtt ggccccgggt gcgtatcctg gtgcgtgggg acagcggttt cgcccgggac    156420
     agtctgatga catggtgcga agacaaccac gttgacttcc tgttcgggct tgcaggcaac    156480
     acccgcctgt atgaccggat tgcctctttg tccgctgagg ttcgtgacga agccgccacg    156540
     acaggcagag ctgcgcgcgg tttcgcctcc tttgactgga tcacaaagga cagctggacg    156600
     cgccgcaggc gggtcgtggc caaggccgaa tggcgccacg gcaaccgcta tcatcgcttc    156660
     attgtcacca ccctaccgca gggaatgtcc gacccccgcc atctctacga acagatttac    156720
     tgcgcacgcg gggatatgga aaaccgcatc aaggaatgcc agatggatct gttctcagac    156780
     aggacctcgt cccacaccat ccgggccaac cagctccggc tgtggttctc ggccgcagcc    156840
     tatgtcctgc tgaccgctct gcaaagactg gcccttggcc agaccagcct ggagacggcg    156900
     acctgtggca ccatacgcgc acggctgctc aaaatcgcga cacgtgtaac gctcagcgtc    156960
     cgtcggattg tcctgtccat gccggacatg ttcccctgtc agcatgaatt cgccctcgct    157020
     catgcacgat tgcgaaggct ccggcaggcc atctgaagaa acagacagtg cacagaccac    157080
     atagcttcca ccaacactgc cttctcaggc cgtgacaccc tcactgcgtt cagaacccgc    157140
     cgccagaagc acaatatcgt caatattcca gatcgggctc ctgtgggatg actgaattct    157200
     acaaaatgac ccgaaattgc ctcaagtgtg agaaatccgc gtcgatcctc cagcgcgtcc    157260
     cttcaacgtt caccagttcc tgcgtggttg tccctttcgg gctccaggtc gtaaaatagg    157320
     caaggtcccc gtcagcgatg tttcggcgga tcaacaggcc acgtgtccat ggtccggcta    157380
     tagggcagtc aaattcttca gcatccagat cagcaagcgg aagatacgcc cagtcataaa    157440
     gtcgctcacc ttttgtgccg tgccccgctg acagacgacg ccaggcctgg tctggcagtc    157500
     ctgctgcaat atctttcgcc tctccggcaa tcagcggttc cgttgcccat gatccgaacc    157560
     agtgattgcc cttgacccca agcacatatc caattcctgc ccggcgaagc gtgcgttcta    157620
     cgtcgcccac gccatacacg ctgtctgctg caacccagcg gaacggcaca ccggcctcaa    157680
     tacttcgctc aatcatcatc gaggctaacg ccggtttggt tgcaaacacc acgtcatcgg    157740
     gaacgtgggc ccgcttcaga cgctcaggct ttgatgtcca gtctttcggg agatacaggg    157800
     cgcggtcaat aaaggcatgc ccccgttccg aaacataagc gccaaacaca ccaatctggc    157860
     agttcgtgat cttgccggca gatcccgtat actgccgccc cacaccgcag gacgcctgac    157920
     ccttcttcag aaaaccggtc tcatcaatga ccagcacgcc ctcttcagtg cccagatgct    157980
     caatcacata atccctgacg acgtcacgaa gggcatcggc atcccagtgc ccgcgtccca    158040
     gaagcgcctg ctgccgccat ggaccaggat ctcctgcggc ttccgctcgc atccatcccg    158100
     tcttgcgtgg ttcattgcca atcaaaacat caagaaaagc acaggccgaa tctacgacac    158160
     gtttttgcgt gaacagcggc gccatccgat ccttggcgga ccgaagcgag cgcgcccata    158220
     attccagcgt ctcttcaaca gacgtaccgc cactcatcat atcctgaatc atggttaccc    158280
     atagattcag aactcaacac aaaatgcaac tgtagtgcta acaacctagc aagatacatt    158340
     gctctttcaa ttacaacatc ggcagtatgt ttattttttg tccggccatg ccagaaggca    158400
     gaaaacttgt agacatacgg cccccagcgg gagccagaca aatccggccg taatccagaa    158460
     tgataggtct gatgattgtg tggttcctcc ttcaacgtaa tgaccttgtg acaggaactg    158520
     cgccagaaca aagccggtca gccccattgc cagcttcgta acccatgtgt tgatcgaata    158580
     tgccagacca gcagatccgg tcgatgttcg cgaatctcca tcatccacgg cttccgccaa    158640
     taaggtataa tacagcggag acatcacgcc ctgagccagc gccagaagag ctatggacag    158700
     gaaaaaacct gttatggatg cgcccgccac agccatcgcc agataggcta ttccctgcac    158760
     gatcaggcat ataatcccgg cgccaactgt tcccatacgt ctggcaagcg gtagacacgc    158820
     gggcacaccc gcaaacagca gaacagtgac aaaagtaatg atattggcgc ccagttgctc    158880
     cgtgccgcca agaacaatgc gggcataata cagggcaaac ccgaacagag ccgcctgccc    158940
     cacgaaatag aaaaacgcga gcagattgct cagcacccat cgccggtttc ccagaagatg    159000
     gcgcagcgtg ctcacaagat cctgtcgaac gggtgctggc ggatacctta cggcgcagcc    159060
     gcgtgccaca cacagccaca ggaaagtgcc gaaaaccgac agagccagca catagaccgc    159120
     catgccatat cggtgctgcg ccgcgctttc acccccaccc aaccatgtga tggcaggaat    159180
     ggtcagcagc gcaacaagca gcgatcctgc ctgacagccc atcatgcgga atgcattgag    159240
     accaacgcgc tgtgaggcag agcggctcat catgacggcc agcgcaccat atggcgtatt    159300
     gatgcacgaa tagatggcac caaacacgat ataggttgct ccagcgcaca caactttccc    159360
     cgtaggcgaa agcggtaaag ccagaaagca cagaaaaccc gttataccga acggaatggc    159420
     aagggagcgg atcaggcgtg gcacaatcag cccgccgata cggtcaacaa catagccgat    159480
     ggccggatcg cagaaagcat ccacaacacg ggccaccagc agtatccatg agacagccac    159540
     cagcggcagg cgtagatatc tgtgtaataa tacatcagat aggatgacgt catgccccac    159600
     atcatgttgg aggcagcatc accacagccg taggctatct tttctttcac ggaaagcgcc    159660
     tgccctttct ccataattgc gctttcctta caaaatttag gctaagtcca atgtttttat    159720
     aagtagagtt cttccaagac tctttcataa cgagagtgag attttccttt aaataaaaag    159780
     agctttcgga aaatgatggg atgttatgat gcgcgtggat aatctgtata gccttctgtc    159840
     ccctgcgtgt accaagtgcg catatcatct ttgttcagag gaaggttatc ctccagacga    159900
     tgcaccaaat ctggattggc aagaaaaagc cgcccgaatg catgtccgcc gtcaggatct    159960
     atgggacgaa attggtgaat tgaataatgg aggatttctg gctcatcgta acgacgaagg    160020
     agtgaagtat gagccagaaa tccttgccgg agacgacatc gggggaacgg ttgatccgcg    160080
     atatccgccg ggcgacgcgt cggcagtatt cggcggaaga gaagatccgc attgtgcttg    160140
     atggcctgcg gggcgagagc agcatagctg agctgtgccg ccgtgaaggt attgccgaaa    160200
     gcctgtatta ttcctggtcg aaggagtttc ttgaagccgg gaagaaacga cttgcgggcg    160260
     atacggcgcg taacgccaca accagtgaag tccgtcatct gcgtgacgag gcgcgggccc    160320
     tgaaagaggt cgtggccgag cagacactgg aactgcgcct gcttaaaaaa agcatgatcg    160380
     gggctggggg agacctcgca tgagatatat ggcttcggaa aagctcgaga tcatccgcct    160440
     tgtcgagcaa tcagccctgc cggttcggca ggttctcggc aagattggta tcccgcgttc    160500
     aacctttcac cgctggtgcg atctctatcg gacgggcggc ccggaagccc tggctgacaa    160560
     gccttctgga cccaatcgga tatggaaccg catcgcggac gatatccgtg cacagatcat    160620
     tgatctggcg ctggagacgc cggaactgtc gcctcgtgaa attgccgtgc ggttcaccga    160680
     cgagcagggc tatttcgtct cggaagcctc ggtctatcgc ctgcgcaagg cccatgacct    160740
     gatcgccagt ccgaaattca tcgtcatcaa ggcggcggag agcttccata caaaaacaac    160800
     agcgccgaac cagctctggc agacggattt cacctatctc aaggttatcg gatggggatg    160860
     gttctatctg tcgaccatcc ttgatgattt ctcacgctac atcatcgcct ggaagttgtg    160920
     cacgaccatg gccgcatccg atgtgacgca aacgctggaa ctcgccttgc aggcatcagg    160980
     gcctcatcaa gccacggtca gacaccggcc gcgactgctc tccgataacg gcccctgtta    161040
     tgttgctgac gaactcgcaa aatggttaaa tcagaacagc atggatcatg tgcgtggcgc    161100
     tcccaaccat ccccagacac aggggaagat cgagcgttgg caccagacgc tcaagaaccg    161160
     cgtgcttctt gagcattatt atctgcctgg agatctcgaa agccagatcg aggcattcgt    161220
     cgaaaactat aatcagcacc gctatcacga gagtctcaac aatctcacgc cggcagatgt    161280
     ctggttcgga cgggggcaga caatcctgtt cgaacgtgag cgcatcaaaa gagctaccat    161340
     ccagaaacga cgcttgcttc atcagcagcg cgccgcctaa acatcataat cagatgggcc    161400
     agaccctccc ttatttcaca ccatccatag tcccaaatct ttcgacgacg gacagcagag    161460
     aggagagttt cttacgtgtg atcttcggta ttgccgtccg gtccaaaaaa tcagttatgg    161520
     cagcgtccat agtgtcatac ggaccatgcc agttgcgggc attgaccggg aatatgttcg    161580
     gggtgcgtaa aaaaacggct ccatcaggcc gaaggcaagt ttcgacaaca tatcgaccac    161640
     atgtctgtcg cgtgacatcg agtgtcttgc tcatttcaaa acgtccctat caccactgta    161700
     ttttatggtg ctgttggatg acagatataa aaaagccgcc ctttagggcg gccttccagt    161760
     agagagcgtc agcgttttca gtattcgctg ggaagcaata cgacgcgtcc cataccgggc    161820
     tcacggaaag caaacagttt ggcctcattg agcggaaaat ccgtataagg aatctcctga    161880
     cgatagagtt caatttcgcc ttcgccagtt ttatccccat ctgtgcaaac aacgaccgcc    161940
     gcatgttttt caaggtcaac ctgcaatgtc cagaactgac gctcttcagc acgcatggct    162000
     ggcagatact gaacacttgc caacacatca atcagccacg ctgcaccatt ggccgcaaga    162060
     taatgggcgc catctgtcag cagcagaccg ctatgcctga gtacggacct caccgataat    162120
     cttctgaccc gttccggaaa tatccgcacg ttccttaggc ttctcggcag attgggcact    162180
     cgaaaacgaa agtgacccct cctcacagct ctgggctgtc cgttgcgtga ttttgcgcat    162240
     ccggccagtc ttgatcgcca gagtgcggga actcacccag atcgtcgaga tatcatctgc    162300
     ctgctccatt tcccatgacc caacactccg gtgtccctcg ggaacaatcc cttctccata    162360
     ctcgttggcc ggaatgaaga cgcagccttc aggtttcttt ttttcggccc atatctgctg    162420
     tgccttgaag atcgccgcga actgggtgca gtaacgattg tcctgcccac cctgcccgaa    162480
     cagatcctct tcccagacca cgcccgcctc ttgtgccgtc tcatcatcaa attcaaaatc    162540
     acgggcatat aactcgacct gatcgagata gcggacaaaa tcttcccagt cgaagtgcgc    162600
     aaactcttcc ctgctcattt cataatcagt tggatcgaca ccctcatccg cactttcggc    162660
     ccagatctct gcccatacat cgcgttggcg ctccagcggc gtgcgcgcaa ttgcgttccg    162720
     ttccgtatag gaaggcccaa tcccaccatc tattgccgca ataatgggcg gatgaatctg    162780
     ggataacagc atcaggccac ggagataggc tggtgtgacc ataaaagccc gacagatttc    162840
     tgtatcagta gcgcccttct cgcgcatatc cagcacacca cgccattgtt cggattccgt    162900
     catgtcggca cgcacgacgt tctcggcaac agcggccatc gtatcgcttt tttcatcacc    162960
     agaacggaca tgcacgtcaa tttcgtccag tttcgcagca atacaggccc gcacccgtct    163020
     gtgaccagcg acaatcatca accgaccatc ctcaagttcc cgcacgcagg gcgcatgaat    163080
     caggcccact gtcttgatat tcagcgcaag ctgatgttcc gcacgagcat ctggctgggt    163140
     cttacgtgga ttgttcgggt ttggtacgag tgttctggga tcgacgcggc gaagttccgt    163200
     catgatacgc tcctcacttt cagggtcatg aggtgtaatt ttctgacctc ataccttcgg    163260
     caccgccgca gacgcctaca cggggcaagg gcgagcgtca gcgaggcccc ggaacggggc    163320
     gaacccttgc ggcgtgtagg cggcctgtgg cccgcccttc ccttttcgga tttctgtttt    163380
     ccttttttct caggccatct cctctatttt ctctccaacg tcagaagcag catcatcatt    163440
     ggctgaggcc aatttcagtg cggttccctc ttccttgcct tctgcttcca gctcggcatc    163500
     cagtgcgtac agctcagcac atttggcttt gaggtccgcg gcttccgcaa aaggcagtcc    163560
     ttcgcgtgcg cgataagctg gcagtcggcg ctgtgcctca tccagactgc gacgtgcttc    163620
     agccagatcg ctgtccagac gtaaggctgc gtgctcaatc cgtgaaatca gtcccagagg    163680
     cttggtctca cgatccgtct cgacctcgat ttctcctgca ggtgtatcca gatagatgga    163740
     ggagactact tctggttttc tcttgtcgga cgttctgaac tgctgttcat gagcttcgca    163800
     catcacttca aatccggcga tccgacccat gctccactgc ccggtccggc cttcccgttc    163860
     agcaagccgc gcctgcgaca gtatccatgc cccagctttt tcacggctct caaccaccgt    163920
     ggtgtcacgg tgcagcgcaa acgcctcccc tttcgtggac acacgctggc ctattgccgc    163980
     ctcaattttc ggaatgcgtg tctgcgctgt ctggatgtcg cgttcagctc tctggatctg    164040
     gcgacgcaca ttgaactgat catcgaaatg cgcggcctgc aaacgctcaa gacgcgcgat    164100
     atcggcttcc aggccagcct tctgtatcag acgcatgtca cctgatgcca gcgccttggc    164160
     cattgcaaac tggttgcctt caccgcccac atcctcaatc cggcgaatgg ttcgatctcc    164220
     cgacatcgca agaccgataa aacgcatctt gcgttcaagc agctgccagt tggtggcgtc    164280
     tacagatccc tgctgggcgt aagcgtagat ttccacttca tcgtgctggt tgccctgacg    164340
     cacgatccga ccttcacgtt gcatgatgtc agcgacgagc caaggcacat cgagatgatg    164400
     cagggctttc aggcgctgct gggcattcac tcccgttccc attgtggctg ttgaaccgat    164460
     caggatacgc ttgcggcctg cattgagatc accaaacaga cgcagcttgg ctgctgcctt    164520
     gtcgtagtcc tgcatgaagg caatctgctc ggccgggatc cccatgcgga tcagctctga    164580
     cctgatccag ttataagccg agaacccgcg cttggtctgg gaggcctgtg tgccgagatc    164640
     ggagaagatc atctgcaccg cccccggtaa atcgtaagcc ctgcccgtct cgggattggt    164700
     gtaacgattg gcagatgtct catgccagat ttcaaacacc ttccgaatca tcacattcag    164760
     cttggaatgt gggtcatcat ccgcccacgg tgcgataaac cgcagatcga tcgcgccatg    164820
     ccgggcatca ttcatcacac tcagaatgat gtcgtccccc ttctgaggac gacctgaacg    164880
     ggcttcaatc gcgcgcatcc gttctgcaag ggtctgctgg aatgcccgaa agtcttctgt    164940
     gctttcggcc accacaatct gtctgttgcc gctctttact gagggcagct ttacatatcg    165000
     ggacaactca tcagactgaa cgacatcagc aaaatcacga tacatggcca tcagatcggc    165060
     cacattgacg aattcggtaa agcgcgtgac cggtttgtaa agaccgttgg gctgaagctc    165120
     cagttcggta cgtgtttccc caaagttggc ggcccacgca tcaaattcat gcagattgcg    165180
     tgcgacaaga gcatccaaat ccatgtaccg cccgacattc cacaattcgg cgatggtatt    165240
     cgtaatcggc gagcctgagg ccatgatcag tgggcgtgtc ggatccttct tcgcgaggta    165300
     acgggttttc acgaacagat cccatgcacg ctgagagcca ttgggatcga cacctcgcag    165360
     atcggactga ttggtggcgt aggacagttt ccgaaagagc tgggcttcat cgacaaggat    165420
     ctggtcaatg cccatttcgc ccatatgaag gagatcatcc ttctgggcgg ccaatccttc    165480
     cagttttgac tccatccctt ctttcatgcg ttcaatgcgc ttgcgggaga tgcggtcatc    165540
     gccatccagg ccagacagaa tggcctcata tgacgcaatc tggtcttcaa tcatctcccg    165600
     ttcaaacccc gcctcgaccg gtatgaactt gaaagcgtca tgcgtaatga tgatcgcgtc    165660
     ccagttttct gtcgccgcac gggcaatgaa acgctggcgt ttggctttga cgaaatttgt    165720
     ctcgtccgcc acgataattc tcgccgtggg atagagcatg agaaactcac gcgccatctg    165780
     tgcaaggcaa tgacctggca ccacaatcac ggccttgctg atcagtccaa gccgtttctg    165840
     ctccatgatg gccgcggcca tggagaatgt tttccccgct cccacggcat gcgccatgta    165900
     ggtgcgtcct gaagcgataa tccgccaaac cacgcgcttc tgatgagcac gcagggtaat    165960
     cacactgctc gctccaggca gacacagatg actgccatca aaggcacgcg gcacaaggtt    166020
     attgtaggtc tcgttataga gctttacgag acggtccgag cgctcgggat ccccccagac    166080
     ccatttttcg aacgcgctct tgatagccgc cagtttttcc ttggctgcct cggtttcctg    166140
     cgtattgagt tcgcgccggt cattgccatt ctcatcgcgc cagtgatccc agatcttggg    166200
     aatggactgg gacagcgcgt cttccagaag ttcagcggca ttgcgtcgtt ccgtgcccca    166260
     gacggatgtt gcttcagcac gagacagaaa cggcgcacgg ttgatactcc agcatgccac    166320
     ttccggggta tgacggacgg ttgtttcaat ccccatgacc tcttgtacga agtcctgaat    166380
     gtccgtgacg ggcaaccaag gcgctcccag acgggctgta atttcagagg gtcgcagatc    166440
     cgggggctgc acgccttcca gggcgctgac attgcgtgcg aaccgtggat caagttgtgt    166500
     ggcatcacgt gacaaagcca gcttggtacg cacggcgcct gagagcatct catcagccgt    166560
     aacccagacg tccctgccct gcacgctgcg ttctggatca aggtaaacac tttcgcctag    166620
     ttcagccaaa gtatcggctt cactccgtcc cagcagttcg gcaatgagag gcagatccac    166680
     acgacccgtt tcatgtagcg atacagccag tgcgtcatgg gctccgtgga tttccggctc    166740
     tgttggggca tgaatgacac gctcagagaa tatcggcccc atgcggcccg tgtccgtgcg    166800
     ttcgtcatac tcctcaatcg aagccaccag ccagacgtca ggatcatcca taaaaggctg    166860
     caggttcggg cgccgctggg tttcgcgtgt tttcccagtt tcagggttct cgcgtagcgt    166920
     ggtgcgggta tgattgatgg ggccaaattc acgcacgaag ctctgatagg ccgttttcag    166980
     agtgcgctgc tgcgctccat aaggcaggtt ctgcatctgc gcccgcaaca cacttcgcgc    167040
     ggcatcacgg atgggcacca gcgcacgaat gatccgcgca tgtttggcaa aaatcccttc    167100
     tgtctgtcct gccttgcgga tcggcacgat ctgcgcctgt ccctcaatga tctggtgcag    167160
     cacactccga tcaacaaagt agcttccctc cttgaggtcc gccccacttg ctgcagttcc    167220
     aatagtgacg ccctcaccgg ctggtcggac aatgcgggcc tcgcgtgggg ggaggaaatg    167280
     cgtgttgggt gctatccggt tcagggcttg cggaagaaga aggtctagtt cagcgccggc    167340
     ggtggcagag catgtgtaac cgggaccaaa ctgcgttgtc gtccagatat gactgccgag    167400
     cacctgttcg ggatggtcat ggaaataccg gtttatgacg agcggaccat tcccctcatc    167460
     tgagtctggg atgtctgcag tttcaaccca gctctcgttt gacggctctt cccccatttc    167520
     tcgtttgcgg aatgccagta catcgaccac gacatcagtt ccggcatcgt cccgcattgc    167580
     gccttcaggt aaacgtacag cgccaagaag gtcagcgctc tcgccaatga tccgtcgggc    167640
     attcggatcc gtcttgtcca atgtgtatcg ggaggtcacg aacagggcga taccgcctgg    167700
     tcgtaaagca tcaattgagc gggcaatgaa gaagtcatga agacttagtc ccagcttctc    167760
     taacccatca cgaccgtgca ccgtgcgatt gctaaagggt gggttaccaa tcgccagatc    167820
     atagccctgt gggagctggg cacgcgtgaa gtcctcactg cggatccatt ggttcggata    167880
     gagcttgcgc gcgatacggg cagagatggg atcgttctca atgccggtaa aagcgatctt    167940
     gccttccagt ttttcaggtc gtgcggcaat gaagagcccc gtgccacatc ccggttcaag    168000
     caccgaaccg ccccgaaacc ccatacgcag ggccatatcc cacatcgagt gaacaatcag    168060
     ttccggtgtg tagtgggcat attgcgtggc gcgctgcagg ccagcccttt cagtctccgt    168120
     cgtaagttgt tcaagttctg aagcaagact ttcccatccc ttgcgtacct ctctgcctgt    168180
     tggagggaaa aggctgttgg ccagttcacc agcgccaaag cccgtaaaac gggccagcac    168240
     gtcctgctct gctgccgtgg cgtttcgatc ctcgcgttca agtgtcgcga gcagggcgat    168300
     cgctgcgata tttgcttctg cacgcgcttt ccagccttga gccagaccac gtacgccatt    168360
     tagacgaaaa tcccgctgtg gaatacggaa agggtgaggg gaggggatgc agacttcggg    168420
     aatgggctgg tcatcgtcta gagaccagag ggctgcaagt tcacctgaca gcactgtagt    168480
     atcgaacaga ttgagttgcg aggcagacat ggacatgatg acacactccg ttcaaacggc    168540
     ttcgcccgac acctcttctg agggtcgggg gcctgattgc tgggttggtc gggatcaagt    168600
     gcaggactgg gagtgtttac tctctcctta ttccttctcc ttgatacttt cctgacaacc    168660
     gggccggagt gggtggggca agtgcggcgc tctgcgccgg gagcggagcc acgcacagac    168720
     cgcgtagcgg gggagcatgg cgagcaccaa ccacttgcgc cacatgctca gggctggtgt    168780
     atggtatatt tgaccgcatt attttacgcc gtaaaatttt tacggtgtaa aaattctgga    168840
     tatatctatc tgcctacgtt atgttttgcg ggtatactgc aattaggtta cacgttttta    168900
     gcgtgttttt atctcatgat ctgaggtcac aatggtaagg ccaaaaaaca atcaccgaca    168960
     atctataata atgctatctt ctcccaaagg aggagtaggt aagtcgtcct tgtcacgaaa    169020
     tatcttggtt ttagcttcaa gggcagggaa aaatgtactc ggtcttgata tggataaaca    169080
     agcaactcta gccacctggg cagagcgacg tgaacgcgtc agagctggaa tctctggcgt    169140
     ctcggaaatt ccagtgcgtc gcgtaatgct agatgactgg cgaggcgcat tgaaagaagc    169200
     gcgtaattct acagctgact ttattgttat tgatacaccg ccatcaatag aaattaatat    169260
     gaccgcgatt ctcggactgt gtgaaggggc tgatttcgtt cttgtacctt gccaacagac    169320
     ccaagatgac tttgatagtg tcgctccatg gatgcgacat ctgaaacaaa gtgatgtaaa    169380
     agcggctttt attattaatc gagctaatat acgtgcgcgt tcctacgcga ctattcgttc    169440
     aaaattaatg aatgtaggtc cagtctgccc aatagaaata tcacaagctg aagaaatatc    169500
     tttagcaaat ggtaaagggc ttggagtgat ggacctaagt aaaccgaaaa atgctgaagc    169560
     tttcggtgcg ttgtgggcat acctaaagca ggagttggat ttatgagcaa agcaacttca    169620
     aggcggggcg tttctctgcg agctctacag gatttggatg cagatgaagt gcctgcattc    169680
     gatgcccgtc cccaagagtt acgggaatta actattgtat catcggaaac cttagagact    169740
     atcagtagcg ttttttctgg cactgaactg gcaaatgatc aagcacgtat tcgcgttatt    169800
     cttgaaactc aacgagccgt taatgctgca tgggaaaggg ctgcgcgttc atttttggag    169860
     attggacggg cattaaatac gctcgataac gtactttttt ctcgagaaga aaaaaatcga    169920
     cttaaatcaa gcttcgaaga attttttccg ttttcagaac ctgttgcttc tcaatttaga    169980
     cgcattgctc atgtcgtaga tagcggccgt cttgatgaga cttctttgcc tggctcatat    170040
     agtgctgcct atcaattaag tctacttgca ccagaagagc tcgatattgc tcgcgcgcaa    170100
     ggtcttgtgg gtccaaacac ttcaaggtca gccatcattg cttttcgtaa atcaatcaaa    170160
     cggaatattt cgcatgttga ttttgctgca ttatctactg aggctcggcg attaaaatct    170220
     acccgaaggc atatgcttga gcagctaatc gcgataagaa ctcgtctcaa agaaatccaa    170280
     acattacttg atgaggatta ataagctcat tcatttattg cgaatagaaa gcataattct    170340
     acggcgtgtc gtcagttaag caggatgatg attgaggcga actgcacggc tgcgaggaag    170400
     gtcgatttca gtttatcgta gcgggttgcg atagcgcgaa actgcttgag tttattgaag    170460
     aacctctcaa caaggttccg ttcgcgatag agagaaaaat cggttttccg tcgtgtcgtt    170520
     ctgttgcgtt ttggcgggat gaccggggta atcccgcgct gtatcagccg atcgatcaac    170580
     ctgtccgcgt catacgcctt gtcagcaagg aaagcatccg gttcgatgtt ttccagaagt    170640
     ggttctgcct gggtgatatc ggcatcctgt cccggtgtga tgccgagttc cactggattg    170700
     cccagagcgt cgcagatggc atggatcttt gtagttagcc cgcctcgtga tcgtccgatg    170760
     gcctgatccg tgcccctttt ttgagagctc cggcactatg ctgatgcgct cggacaattg    170820
     tgctgtcgat catcatgtat tcgttgtcgt aatcagcggc cagataacga aatatccgtt    170880
     cgatgacgcc gctttcacac cagcggcgca gacgccggtg cacgtttttc cagtcaccga    170940
     aacgagcagg aaggtcgcgc catggaatac ccgcgcgata gcgatacagc accgcctcca    171000
     cgaacagacg gttgttcacc gcagtgccgc cgacatagcc ttctcgacca ggaagaagat    171060
     cctttatccg ctcccactgg tcatcgcgta aactatagcg ccgcatctgt ctgtctcccc    171120
     aaaaaatggg aaaacagtca gcacacgcag acacaaagta caaccctcac gtgccactct    171180
     cagggcttaa ctgacgacac gccgtagatg aatccgctac gttttgtaag catatacata    171240
     ttcatacaag tcgtagcggg aattcaaata ttgtcttact gatgtcggag tatttcccat    171300
     taaattaaca ggagtaatca tcgtgacaaa ctcgttaaaa actaacattt ggagggatag    171360
     caagactata gtttagtgct tctggcttct catttcagat ttctaacata tcattcgatg    171420
     gactacgggc tgtttttggc gcagcaactt gaactgcgag gattttgtgc tttctcttgc    171480
     gatccgcagg gctaattctc tcgagaaaaa gagaaacggt gcgctattat gggtaataag    171540
     agcaagctga tctttatgga aagcccgtta tgataagatg catgcggata aatagtcatg    171600
     cctgtgattt ctggttaaaa aaatgtatgt taacggagga ttggataatg gactttccaa    171660
     tgctgatccc tcattgtgga cagagtccaa aaataattca aaaatgaatg gtaatgttta    171720
     gatgtgacga aagtttctta gaaattgatc ttattacggt aagaaattta cgttcgtaat    171780
     aaggattgga ctctgtccac aaagtttgca aaaattttaa tttgcgctta tcgaaaagta    171840
     gttaatctaa aatcttcctg caatactaat atattttttc ttattaacat gtaaatttac    171900
     tttccaattc gcttttcggg aattggaggt ggagaaggat aaagaatgat tccatattta    171960
     tcgtccattt gtaccttagc ttccgggtag actgagagag caattttaag cggagtaaca    172020
     atgtcttttt taaaatatcg taattcttta tattccgggc cgaactgatt ttttaacgta    172080
     ttccaactta aagtaagcgg atcgttaagt acatgtaatc tgtacgccaa ccagatataa    172140
     atatcgatag ccttagattt attagatatt tgtcgaattg cgatttcacg aagaggaagt    172200
     ggatgttcaa taaggctctc ataaaagcct tcatctagtc ttacggcttc tttccaaaat    172260
     gatagttggt ttccattttc agattcaatt ggcatgatgg cgtcacggac aaacgcaccg    172320
     ttagttataa tttctgcacc agcatttatt ctagtgaacg tcaaacggca tcgactaata    172380
     cgattagctt gatctctgac ggcaatatag gttttgccac caactgaaac acccattgct    172440
     tttaaccaag cattcatgct ggatccgagc tcgacttctc tggatctggt tcttacagct    172500
     tgtgtttgta gatatagaag gataagtcta gccattgcgc caaatggcac gcctacggct    172560
     ttattttctt tatctaagcc actttctact agaagttgaa ttgaacctcc ttcgcggcgc    172620
     caaatagatt ctgagatttt tttatgtggt aaagcggcca ttgcaaatcc tgcatgagct    172680
     ataccaatag cctgatcttc atcagacatt acttcatgag cggcttcgac acacaggcgt    172740
     tgcgttttat cctcaagtga ggctaatcgc cgcatttctt caacgccaaa tctgtctagt    172800
     aagctatgaa tctgtcccat acttgaacaa tgtcataagg aaaatttgtt cgtcaatttg    172860
     gactttgtcc acgagaagga atttggactc tgtccacggt tctttggact ctgtccgcaa    172920
     aagctatttg ttattatttg attctttatt agtttatgtg tgggcaaagt ccaagggata    172980
     agcccattat cgtggagaga gtccaaactt atcgcgggta gagtccaaag gataagattt    173040
     ggtgcgtaaa ctagattgtg gataagtccg cttgataaaa gttggacatc gtggaaagag    173100
     tccaatgaaa ccgaagggtc acggatatat tttatacccg tggagagagt ccaaattacc    173160
     tccaatacga gtcggctccc aaaaagcagg aattactgtg agtgtaaaaa ttcttcatgc    173220
     atcgatttta gatatctgaa ttttgaaata tcaggcgacg gcctttcttc gtttttgaga    173280
     ttaggtaaag gcagaattaa gcctatatcg attcaaaacc gactttttcc tggatgtcgg    173340
     gttagggcct gatcatcctc aatataagct tccaggactc ggtaatcccg gtgacgcgag    173400
     aaacgcttga gcgccatcag atcgtaattg tcttgcgccc ccgtcgtgat ggccccacga    173460
     cgcagactat gtccgctaaa gtctccttcg aggccggcgg caaggcatcg ttgtttgatg    173520
     atcttggcca cagaccagtc agagagactt tgtgtgccaa ttttcgggag agggggtgac    173580
     acacctggtt tcgaggccgc aggagaccag atgcgtggaa aggccgcagt cgtggaatgg    173640
     tcgtttgccg ttttcttgcg cggtttaaga cccgatagcc gtaaccacgt ctcccacgca    173700
     cgaactggac aaaagcgcgt aataccacgg ggaatggcga ccacagtgcc cttgttctgc    173760
     ttatcgccct tggattgagg gagcgtaatc cgcatgcagt catcatccag agtgacgtat    173820
     tcaagccgaa tagacgccaa ctccgagcgt cgtaacgccc caccatagcc gatcaggagg    173880
     attgctcgat cgcgtgcgtc taccaatgtg gtcatcggga ttgcatcaat cacttcgcac    173940
     atcatgtccc atgtcagacc tttgacctgc cgcggcattt ccttgccagg agatcgatgg    174000
     ataccagcca ctgtttccgt gaccaaagcc tgggcagtcg ggataggaag ttgagcgatg    174060
     tgatggaggt agcgaagtgc tgcacgatgc agttcgatcg tcgtcggctt gcgaccacgg    174120
     agcgcaagat ctgcgagata ggtcgccaca tctgtgctgc gtgcgggcag ggcagggaga    174180
     ccatgacggt ttgtccaggc acaccatccc ttaatagctg aacgataggc gcgccgcgta    174240
     tttgcggact tgccatgttg cacgaatgct cccacagctg cttgcgatgt ttcaagccgc    174300
     ccatcgtgct ctggtatatc gatttcgcac aatgctgaaa accagcgtgt tacgttggct    174360
     ggagcctgcc cgataggtgc gggaggcaga atctttgaag tgtcttcttt ctcggctcgt    174420
     gggccactgt tactgctgat cttggatgac accaatgtgg caacgaacgc cagcttttcg    174480
     cagtcaattt ccaacgccag ttcgatctga tagccagaag gcaaagtagg aaaggtcgcc    174540
     ttgacagctt ctcctgcagc ggcggcatgt tccgcatggc ggggcaattc ggtatctggc    174600
     aggaaggatc catcgggaag tgcactgccg gcgatcagca caggaagcgg tggggaaaaa    174660
     tgtgccgtcg agagaatagg ccgcaaaaca tcaattgagg cctggggatc attcagacgt    174720
     tggcaggtca gacgatctac ctgctcaaga acataagaac gtaaaaccgg ccaggagcca    174780
     gttatatgca gggtatcaag catgactcgt tattctaatg atcttgggag attagaccag    174840
     aagtaaactt gttttcgaag ttctctctga aactttgaga ttcagaaaat ctgttcaaac    174900
     agtttcttgt ctcttcatcc gatagcctgc gatacccttg atattcctag cactacagtt    174960
     gcattttgtg ttgagttctg aatctatggg taaccatgat tcaggatatg atgagtggcg    175020
     gtacgtctgt tgaagagacg ctggaattat gggcgcgctc gcttcggtcc gccaaggatc    175080
     ggatggcgcc gctgttcacg caaaaacgtg tcgtagattc ggcctgtgct tttcttgatg    175140
     ttttgattgg caatgaacca cgcaagacgg gatggatgcg agcggaagcc gcaggagatc    175200
     ctggtccatg gcggcagcag gcgcttctgg gacgcgggca ctgggatgcc gatgcccttc    175260
     gtgacgtcgt cagggattat gtgattgagc atctgggcac tgaagagggc gtgctggtca    175320
     ttgatgagac cggttttctg aagaagggtc aggcgtcctg cggtgtgggg cggcagtata    175380
     cgggatctgc cggcaagatc acgaactgcc agattggtgt gtttggcgct tatgtttcgg    175440
     aacgggggca tgcctttatt gaccgcgccc tgtatctccc gaaagactgg acatcaaagc    175500
     ctgagcgtct gaagcgggcc cacgttcccg atgacgtggt gtttgcaacc aaaccggcgt    175560
     tagcctcgat gatgattgag cgaagtattg aggccggtgt gccgttccgc tgggttgcag    175620
     cagacagcgt gtatggcgtg ggcgacgtag aacgcacgct tcgccgggca ggaattggat    175680
     atgtgcttgg ggtcaagggc aatcactggt tcggatcatg ggcaacggaa ccgctgattg    175740
     ccggagaggc gaaagatatt gcagcaggac tgccagacca ggcctggcgt cgtctgtcag    175800
     cggggcacgg cacaaaaggt gagcgacttt atgactgggc gtatcttccg cttgctgatc    175860
     tggatgctga agaatttgac tgccctatag ccggaccatg gacacgtggc ctgttgatcc    175920
     gccgaaacat cgctgacggg gaccttgcct attttacgac ctggagcccg aaagggacaa    175980
     ccacgcagga actggtgaac gttgaaggga cgcgctggag gatcgaagaa gggttcgaga    176040
     cggccaaaaa cgaatttggt cttgatcata acgagacccg ctcctggcat ggttggcatc    176100
     ggcatgtctc tctggtcatg ctggcctatg ccgtcatggc cagtgtccgt taccaggcaa    176160
     actcactgaa accgaaaaaa acacaactca gaacacgaca gtccttgtcc gctggtccat    176220
     tcaggagatc aggcgcctcg tcgtaaaact tgcacaacgc agactacccg tctctcacat    176280
     cctcagatgg tccgtctttc gacgaacgca tcaggccagt gctatccgcg ctcactcacg    176340
     acacaaaatg caactgtagt gctaggttgc tccatcaccc gtataatgag gaaatttcta    176400
     tatttttgga ccacttgacg agggaaaaat cccttccaat cttaggtgtg tcagacgcct    176460
     tcgggtctga ccttaagcgt cctgagctaa acgattgaga tccatgttgc tttaatagga    176520
     ggatatggat gtcgaaactg aaaagactct atttacgcta tcgctgcttt ctgcgtacgg    176580
     tttctcggaa aaggcgcaac cgattggatg gaggcgtgtg atgataacat gtcccatctt    176640
     tggtgatgat gtgctggaag agcgtgtcat ctccttgttt cgccgtctgg gccatgatgg    176700
     acggggcgta actctgacat cactccagac ctataccggc gtccttggga ctagacttcg    176760
     tgccttgctg gcaagtctcg tccagagggg taaacttgcc ccagctgggt gcgatcctct    176820
     ggcttctgat tttgcgttcc gtttgccatt atctgcaaaa aacgcgcgat cgacatcgat    176880
     agcggcgtaa aacgtaaacg tacatcctat ctcaaagatg ccgttttcgt ctgggttttt    176940
     attaaaacga gagggctgct gggccttcca taaaaggccc cgtgtttcgg aatattgtat    177000
     tcaagataga gggaaaggga gatgtcgagc ataatccatt tgcttaacct cgtagcgctc    177060
     cgacaatatt ggaataatta cgattttgta tcgcattcat tgggaatgat agagccatca    177120
     ttatcgtttc ctgagagaaa gtgcggcttg aggggtagtc aaccccttag gagagcacat    177180
     gggactgcat ggaaatcggt gcccatatca gccggatcca gaggttcggc gagtttctcc    177240
     ttgtcaggat caacaggtaa tttatctgca tctgaagtcg acattagccg ttagcgtagt    177300
     ctcttctcgt aagaaaaaga gaggtaactc aaatagtcaa taagcgatcg tggtccggtt    177360
     catgtcctga gtgaggacgc tcaagattat tgaaagaaaa gccaaacact taaaactata    177420
     tcaattatct aatgggaaaa cggttatgga agaaatctcc atgaaacgtt cctggcacag    177480
     cagggattgg tcgcgtctgg tcaggctgtt taatggtctg acattctatg aacgctttga    177540
     acaggccatt attctgatac tgattgccct catcatgctt gtcactgcca tagcgacagt    177600
     tcatctgatc agcgcggtct ggcatctgat cgttgacatc gggatcgatc ccatcaagca    177660
     ggagatcttt caggaaattt ttggtgcgat ctttaccgtc attattgccc ttgaatttaa    177720
     acattccctg cttgtcgttc tggcccagca cgagaatgtt atccgggtga gaaccatcgt    177780
     tctgatcgcc cttttagcag ttgcccgtaa attcatcctg ctggatctga ataaggtgtc    177840
     cgccatggaa ttgttcgcgc tctctgtcgc agttttggcc ctgggcatcg tttactggtt    177900
     agcactacag ttgcattttg tgttgagttc tgaatctatg ggtaaccatg attcaggata    177960
     tgatgagtgg cggtacgtct gttgaagaga cgctggaatt atgggcgcgc tcgcttcggt    178020
     ccgccaagga tcggatggcg ccgctgttca cgcaaaaacg tgtcgtagat tcggcctgtg    178080
     cttttcttga tgttttgatt ggcaatgaac cacgcaagac gggatggatg cgagcggaag    178140
     ccgcaggaga tcctggtcca tggcggcagc aggcgcttct gggacgcggg cactgggatg    178200
     ccgatgccct tcgtgacgtc gtcagggatt atgtgattga gcatctgggc actgaagagg    178260
     gcgtgctggt cattgatgag accggttttc tgaagaaggg ttgaattgcc ccgggttttg    178320
     tggagacgtt ttttatctga tttaagcggc taatgcatgt gatttctgtt atgcataaaa    178380
     gcgtgcctca gcttctgctg gcgggatgtt tccaatggag gacaggagcc gccgattatt    178440
     gaaccagtcg acccatttaa gtgttgccag ttcaacagct tccctgtttt tccatggccc    178500
     ctgccgatag atgagttcgg ttttgtaaag tccgttaatg gtctctgcca aggcgttatc    178560
     ataggaatcc ccaacactgc cgacagaagc aacgagcccc gcttcagcca gtctttgcgt    178620
     gtagcgaatg gacacatatt gacagccgcg gtcggaatgg tggggcactt ttccctcagg    178680
     tcgcctctgg cacagagcct gctcgagagc atccagcacg aagtcggtat gagccgttga    178740
     ggagacgcgc caacccacaa taacccgtgc gaatacatca atgatgaagg ccacataaac    178800
     aaagccctgc catgtggaaa cgtaagtaaa atccgaaacc cagagtctgt tgggggcagg    178860
     agcatgaaac tggcgctgca ccagatcctg cggacacgga cgttgcggat caggccgtgt    178920
     ggttctgacc cccttgccac gaatgacgcc tttcagcccc atccggcgca tcagccgctc    178980
     taccgtgcag cgggcgacat ccagaccttc acgtctgagc tgatgccaga ccttgcgcgc    179040
     tccatagacg cagaaattat tattccacac tctacggatg tcatcgcaca gttctttgtc    179100
     tttctggctg cgcacacacg gatttttctg tctggcaaca gttgcataat aggcagatgg    179160
     tgcaatcgac agaaccctgc agattgaccc gacaccatat gtctgccggt gctcctcaat    179220
     gaagcgtgtc atggcttgaa gatgcggtcg agctccgcct gggcaaaata tgccgacgcc    179280
     ttacgcagga tttcattggc ctgccgcaat tcgtggttct ctcgctccag ttgcctgatc    179340
     ttctctcgac gcggaaatct cacagaaggg ttgtacatcg ggttagatta tgaaaaagtc    179400
     tgttttgcac aaaagaaatt tccataatca tcaagaaaac ccgatgcaga cagagtgtag    179460
     cgcaggcgcg tatgagtttc cagcctcctg tggacggcgt gttgtggccc gttttgacgg    179520
     gggtcgcatg agttcggatg ggggcgtaat tctggtgaag caggctgatg acattctggg    179580
     tctcagccgc cgctttgctg cctgttttcg cgataagcgg catcccggct ttgtggaata    179640
     ccgggttgaa gaccttgtcc gtcagcggat catgggcctg gcactgggct atgaagatct    179700
     caatgatcac gatgccctgc ggcatgacct gatctttggt ctggcctcgg gtcgtctgtc    179760
     aggaggccgg gcaaactgcg cagcattggc tggcaaatct acactgaacc ggttggagcg    179820
     cagtgggcac aaggcagatc gttactgtcg gatcattgct gatcatgagg ccctggctac    179880
     cctgttcgtc acgctcttcc ttgaccagca tgagcacgca cccgcccgga tcgttctgga    179940
     tgtggatgcc accgatgacc gtatccatgg ccatcaggaa ggccgcgcct ttcatggata    180000
     ttacggccat aactgctatc ttcccctgta tgtcttctgc ggggaccatc tcctcagcgc    180060
     taccctgcgc acggcagaca gggacccggg gaaggaagca ctggcagaca tccgccggat    180120
     cgtggagcag atcaggagcc gttggcctcg ggtgcgtatc ctggtgcgtg gggacagcgg    180180
     tttcgcccgg gacagtctga tgacatggtg cgaagacaac cacgttgact tcctgttcgg    180240
     gcttgcaggc aacacccgcc tgtatgaccg gattgcctct ttgtccgctg aggttcgtga    180300
     cgaagccgcc acgacaggca gagctgcgcg cggtttcgcc tcctttgact ggatcacaaa    180360
     ggacagctgg acgcgccgca ggcgggtcgt ggccaaggcc gaatggcgcc acggcaaccg    180420
     ctatcatcgc ttcattgtca ccaccctacc gcagggaatg tccgaccccc gccatctcta    180480
     cgaacagatt tactgcgcac gcggggatat ggaaaaccgc atcaacgcgg atttctcaca    180540
     cttgaggcaa tttcgggtca ttttgtagaa ttcagtcatc ccacaggagc ccgatctgga    180600
     atattgacga tattgtgctt ctggcggcgg gttctgaacg cagtgagggt gtcacggcct    180660
     gagaaggcag tgttggtgga agctatgtgg tctgtgcact gtctgtttct tcagatggcc    180720
     tgccggagcc ttcgcaatcg tgcatgagcg agggcgaatt cgtgctgaca ggggaacatg    180780
     tccggcatga acaggacaat ccgacggacg ctgagcgtta cacgtgtcgc gattttgagc    180840
     agtcgtgcgc gtatggtgcc acaggtcgcc gtctccaggc tggtctggcc aagggccagt    180900
     ctttgcagag cggtcagcag gacataggct gcggccgaga accacagccg gagctggttg    180960
     gcccggatgg tgtgggacga ggtcctgtct gagaacagat ccatctggca ttccttgatg    181020
     cggttttcca tatccccgcg tgcgcagtaa atctgttcgt agagatggcg ggggtcggtc    181080
     attccctgcg gtagcgtggt gacaataaag cgatgatagc ggttgccgtg gcgccattcg    181140
     gccttggcca ccacccgcct gcggcgcgtc cagctgtcct ttgtgatcca gtcaaaggag    181200
     gcgaaaccgc gcgccgctct gcctgtcgtg gcggcttcgt cacgaacctc agcggacaaa    181260
     gaggcaatcc ggtcatacag gcgggtgttg cctgcaagcc cgaacaggaa gtcaacgtgg    181320
     ttgtcttcgc accatgtcat cagactgtcc cgggcgaaac cgctgtcccc acgcaccagg    181380
     atacgcaccc ggggccagcg gttcctaaca ctacagttgc attttgtgtc gtgagtgagc    181440
     gcggatagca ctggcctgat gcgttcgtcg aaagacggac catctgagga tgtgagagac    181500
     gggtagtctg cgttgtgcaa gttttacgac gaggcgcctg atctcctgaa tggaccagcg    181560
     gacaaggact gtcgtgttct gagttgtgtt tttttcggtt tcagtgagtt tgcctggtaa    181620
     cggacactgg ccatgacggc ataggccagc atgaccagag agacatgccg atgccaacca    181680
     tgccaggagc gggtctcgtt atgatcaaga ccaaattcgt ttttggccgt ctcgaaccct    181740
     tcttcgatcc tccagcgcgt cccttcaacg ttcaccagtt cctgcgtggt tgtccctttc    181800
     gggctccagg tcgtaaaata ggcaaggtcc ccgtcagcga tgtttcggcg gatcaacagg    181860
     ccacgtgtcc atggtccggc tatagggcag tcaaattctt cagcatccag atcagcaagc    181920
     ggaagatacg cccagtcata aagtcgctca ccttttgtgc cgtgccccgc tgacagacga    181980
     cgccaggcct ggtctggcag tcctgctgca atatctttcg cctctccggc aatcagcggt    182040
     tccgttgccc atgatccgaa ccagtgattg cccttgaccc caagcacata tccaattcct    182100
     gcccggcgaa gcgtgcgttc tacgtcgccc acgccataca cgctgtctgc tgcaacccag    182160
     cggaacggca caccggcctc aatacttcgc tcaatcatca tcgaggctaa cgccggtttg    182220
     gttgcaaaca ccacgtcatc gggaacgtgg gcccgcttca gacgctcagg ctttgatgtc    182280
     cagtctttcg ggagatacag ggcgcggtca ataaaggcat gcccccgttc cgaaacataa    182340
     gcgccaaaca caccaatctg gcagttcgtg atcttgccgg cagatcccgt atactgccgc    182400
     cccacaccgc aggacgcctg acccttcttc agaaaaccgg tctcgtcgat gaccagcacg    182460
     ccctcttcag tgcccagatg ctcaatcaca taatccctga cgacgtcacg aagggcatcg    182520
     gcatcccagt gcccgcgtcc cagaagcgcc tgctgccgcc atggaccagg atctcctgcg    182580
     gcttccgctc gcatccatcc cgtcttgcgt ggttcattgc caatcaaaac atcaagaaaa    182640
     gcacaggccg aatctacgac acgtttttgc gtgaacagcg gcgccatccg atccttggcg    182700
     gaccgaagcg agcgcgccca taattccagc gtctcttcaa cagacgtacc gccactcatc    182760
     atatcctgaa tcatggttac ccatagattc agaactcaac acaaaatgca actgtagtgc    182820
     taatctgctc cacgatccgg ctgatgtctg ccagtgcttc cttccccggg tcccggtctg    182880
     ccgtgcgcag ggtggcgctc aggagatggt ctccgcagaa gatgtataac ggcagatagc    182940
//