Dbfetch

ID   AP011122; SV 1; circular; genomic DNA; STD; PRO; 191799 BP.
XX
AC   AP011122;
XX
PR   Project:PRJDA31129;
XX
DT   30-AUG-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-011 DNA, complete
DE   genome.
XX
KW   .
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
OG   Plasmid pAPA01-011
XX
RN   [1]
RP   1-191799
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma Y., Hosoyama A.;
RT   ;
RL   Submitted (06-APR-2009) to the INSDC.
RL   Contact:Yoshinao Azuma Yamaguchi University School of Medicine, Department
RL   of Microbiology and Immunology; Minami-Kogushi 1-1-1, Ube, Yamaguchi
RL   755-8505, Japan URL    :http://www.bio.nite.go.jp/dogan/Top
XX
RN   [2]
RC   DOI:10.1093/nar/gkp612
RX   DOI; 10.1093/nar/gkp612.
RX   PUBMED; 19638423.
RA   Azuma Y., Hosoyama A., Matsutani M., Furuya N., Horikawa H., Harada T.,
RA   Hirakawa H., Kuhara S., Matsushita K., Fujita N., Shirai M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37(17):5768-5783(2009).
XX
DR   MD5; 2f6ae00ffa66cffdaa51b78327b707a8.
DR   BioSample; SAMD00060943.
DR   EnsemblGenomes-Gn; EBG00001034329.
DR   EnsemblGenomes-Tr; EBT00001637084.
DR   EuropePMC; PMC2761278; 19638423.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF01497; ALIL.
DR   StrainInfo; 481055; 0.
DR   PubMed; 19638423.
XX
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty
CC   of Agriculture, Kyushu University, Department of Biological
CC   Chemistry, Faculty of Agriculture, Yamaguchi University and Mizkan
CC   Group Corporation Central Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..191799
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT                   /plasmid="pAPA01-011"
FT                   /strain="IFO 3283"
FT                   /sub_strain="IFO 3283-01"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /db_xref="taxon:634452"
FT   CDS             complement(287..550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40010"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00788"
FT                   /db_xref="GOA:C7JBI0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBI0"
FT                   /protein_id="BAI00788.1"
FT                   /translation="MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             639..953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40012"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00789"
FT                   /db_xref="GOA:C7JI62"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI62"
FT                   /protein_id="BAI00789.1"
FT                   /translation="MEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQN
FT                   AYIERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA
FT                   "
FT   CDS             complement(1020..1358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40020"
FT                   /product="DNA helicase II UvrD/Rep"
FT                   /note="Probably pseudogene, Middle domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00790"
FT                   /db_xref="GOA:C7JI63"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI63"
FT                   /protein_id="BAI00790.1"
FT                   /translation="MAGHHVEAMIARAHAQKRFMDDAGWRYVVELYGRYQSLLREQNAA
FT                   DFGDLLMWPTLAMLHNDAYRYRWSRRFTAVMADEFQDVNRAQFLWLKMISEVSAEFFAV
FT                   GDDSQSIL"
FT   CDS             1437..2498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40030"
FT                   /product="transposase"
FT                   /note="IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00791"
FT                   /db_xref="GOA:C7JI64"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI64"
FT                   /protein_id="BAI00791.1"
FT                   /translation="MVVGRNDCAKGRQMKDTVIGVDLAKNIFQVHGASRAGEVMFRKKL
FT                   RRQQFMQFMATQPPALVVLEACGSAHYWARELAGAGHEVRLIAPQYVKPFVKRQKNDAA
FT                   DAEAIVIAARQPEMRFVEPRTEAQQARGVLFRARQRLVHQRTELVNALRAVLYEFGLVV
FT                   PQGIAHIRHIEAMLDEAVLPEAVKQECLDLLRQISEQSVRIDVRTKKIRMLAQESENTC
FT                   RLQSMPGVGPLTALAIEAFAPDLQSFRRGRDFAAWLGLVPRQFSSGGKERLGKISKAGQ
FT                   ADIRRLLIMGAMTQVNWASRKAPAPGSWLARMLARKPRMLVAIALANRMARAIWAMATK
FT                   QEDYRDPALSVAA"
FT   CDS             complement(3042..4082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40040"
FT                   /product="transposase"
FT                   /note="IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00792"
FT                   /db_xref="GOA:C7JI65"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI65"
FT                   /protein_id="BAI00792.1"
FT                   /translation="MEQIIRIGMDTSKSVFQLHGVNAKEQPVLRRKLSRREMVKFFEKL
FT                   PPIEIAIEACGASHYWGRVLSCLGHTVKLIAPQLVKPYVKRGKNDAADAEALCEAMSRP
FT                   TMRFVPLKSEEEQAALMLIGMRARLIRNRTQLANTIRGYAAEFGITAPKGMCRIEALLD
FT                   RIAADESLPTLTRELFALHAKEYAELQGEIEQLEGKVMAWHRANECSQRLAKIPGVGPI
FT                   GAALLMMKTPDPHLFKSGRAFAAWIGLTPRDHSTGGKTRLGRITRAGDEVLRSTLVVGA
FT                   TAVVSHARRTNGKNASSWLRELLERKKPKLAAVALANKIARIAWKLMVSGEHYKRLLQQ
FT                   PGAAAV"
FT   CDS             complement(4115..4558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40050"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00793"
FT                   /db_xref="GOA:C7JI66"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI66"
FT                   /protein_id="BAI00793.1"
FT                   /translation="MVPPKPGKTPVGGRLIGYARVSTDDQGTDAQLNELRDAGCTMIFE
FT                   KHASGADRNRPVLIRLLRDMNAGDTLVVVRLDRLARSVSHLLAVIEQLDYAGAHFRSLD
FT                   DPIDTTTPQGMFSLQVLGAVAQLDADFFCDGVDGSQRHRDVPR"
FT   CDS             4860..5111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40060"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00794"
FT                   /db_xref="GOA:C7JI67"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI67"
FT                   /protein_id="BAI00794.1"
FT                   /translation="MLTSRIHRRKPMGKPMSKATARANAAKSSIRAHVEHVFAHQKNRF
FT                   NLFIRTIGLARAEAKLTLCNLAYNFNRLIFHERLETAG"
FT   CDS             5357..6835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40070"
FT                   /product="D-mannonate oxidoreductase"
FT                   /note="Mannitol dehydrogenase, NADPH-dependent L-sorbose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00795"
FT                   /db_xref="GOA:C7JI68"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI68"
FT                   /protein_id="BAI00795.1"
FT                   /translation="MNLNRNAISHVPDTVYTPRYDPALLRPGIVHLGCGNFHRGHQVVA
FT                   TQAAIDAEGRDGLRWGIVSATMRRPDLATVLQSQDNLYTLLTREPANTVASVMAAITEA
FT                   VYAGDDNANLAARIADPATAIVTLTVTASGYYLSADGRLDPTFEAIQADLTAITPRTAP
FT                   GIIAAGLAQVRQRGGVPPVILCCDNVNSNGATLRQAVIDLAALKGDDLLAAWIETNVQF
FT                   PDTMVDRIVPTATPDDIADACRLLGGIEDRAPISAEPWFQWVIGEFDGPRPRWVAHPGT
FT                   KFVSDVGVFERAKLQMLNGTHMLLAYVGALANLNTVSEAASDDALGRIAARFMRNEQTA
FT                   DVSLDTDELDRYTVDLMQRFRNPGIVHEVTRIGRNGSAKMASRIVQPMRSNIEAGRPVD
FT                   GAVLLIASWIRWFALHEQDEFDIALTDPRAETLRGLCADARDDHKAQAEAFLAMEEVFG
FT                   APLPDHGKQVEAIASMLRRLTEESVPELLRTIAH"
FT   CDS             complement(6908..7621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40080"
FT                   /product="phosphatase/phosphohexomutase"
FT                   /note="HAD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00796"
FT                   /db_xref="GOA:C7JI69"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI69"
FT                   /protein_id="BAI00796.1"
FT                   /translation="MTDTVFPAHLLKHKQEPVHGVVFDMDGLLLDSESLAMEALVFAAR
FT                   DLNYDIPMSFCRTMIGVPADGCRTMVRKTYGQDFPLERFFELQEVHLRNFVDTGKLALK
FT                   KGVLPLLDLLDTYKIPRAIATSSSRVRTDHHLKLVNLFHRFNAIVTRDDVSKGKPDPEP
FT                   YLTAAKKIGVNPAHALALEDSHSGARAAHAAGIRVIVVPDLLEATDEIRGKALAIVQDL
FT                   SIVEAYLKHAITGQA"
FT   CDS             8327..8710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00797"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI70"
FT                   /protein_id="BAI00797.1"
FT                   /translation="MRRDMDLVRQLLLKLEGIEKGPHDVLLIGGNSEEVAVDGRTSDEI
FT                   YFHLTKIEEAGFLERVGGGAMTAVTFRALSWKGQEFLDTIRDDSIWKKTKEKAGSASFD
FT                   ILAAVAKAVIKDRIKSLTGLDIG"
FT   CDS             complement(9001..9363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00798"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI71"
FT                   /protein_id="BAI00798.1"
FT                   /translation="MRPLGSGLSVRTYGCSEADDQENDGWAKKDTGEIVALYEMSSPVM
FT                   PSGLVSISRWKIKGCYPKSGLSRAMLCPTKIPQSASNIALLIGSDWSFIEENVFCNHIE
FT                   WQTCLPVFVMNLDHPA"
FT   CDS             9426..13385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40110"
FT                   /product="DNA helicase superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00799"
FT                   /db_xref="GOA:C7JI72"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI72"
FT                   /protein_id="BAI00799.1"
FT                   /translation="MSSKPSHHSVLSYWHSALLDDAQMKISFSRDNLVALDEEGFEKGK
FT                   LPPDKTQALRKMHPASRDLAPDDSIIAMAGIRILLGQVSHSTEHSKQPALFCMAMLVNV
FT                   SPEGTIQPLKDAPPWINRELLEPSDGDVLIGDLATMDTWLQLNPFEGGSLGKTLEWAEK
FT                   LWNAVTGEDGLPDGYELWERVALQPAEASIGMIATLHQRRFYDTVLADTGLVTPLLARY
FT                   IDGGPEPAVVDESQKWAAAGRARGTMTFAYGMSSSQSEAMTAFCSVKDGDILAVNGPPG
FT                   TGKTTLLQGIVATELVTRALEGGDPAVIVGTSTNNQAVTNIIDAMKKAMASKDSRPWAR
FT                   RWIEGADALGLYFPSGEKEKEALKAGYLIASPGRGLGTMEWKGFPERERDTVDAWASRD
FT                   AWINGYYGSFYPGVTPPLRKEHLSGHGPQGARHDISLVEDGIAKIRARMKVLVETGRVC
FT                   AGEARKLNQLYVASGYGTYPDITKAIAQREALLQERRPREDALKSDLKEKEAAAAVPRA
FT                   RINEENRKTRDLLKQRDDAVHAAGQKVEEVGAHAVALIAALPGGGFFSNLMSGRNWANV
FT                   ERLVAEGRQGSFFRSLMQAQVKSKREWMDAINEMTASAERELATVRESREETRQARDTL
FT                   IQKLEREVAAADLVSKTARAEYDHYVGGSYVLAGRELEKLVTLKHQILQQLQDCCTAIE
FT                   TVLAPSDWAAMFDMPEEKLPWRQSNWTGRLDVIEDFLDRTIRYALFQYALRYWEGRWVL
FT                   EVQALQDALEQNDNKVYPFKVGGRAMEAMYRRWAMLTPLFIVTAASLPKFPKCTMMEKG
FT                   KFVERFMAGFFDLLIVDEAGQIAPYQMVPAMAFSKKAVVVGDVFQIEPVVTSSHATDTG
FT                   NARKAGVQEYFWDDDGPVDPRVVTAAPGNNNIMGSVMRVVQTGTSHSSPDSPVPGIFLT
FT                   EHRRCRRDIIEICNELVYNGRLKPMTAEPDREPSLPPLAWANVNGTSERLGRSQRNPRE
FT                   AEAIARWIVSKADEWKDFYDKPVNEIVAVIAPYGPQRDAIRRALRKFSTAHTDKNISKI
FT                   KVGTVNAMQGAERDIIIFSPTCDRKASTGFLDGKRSLLNVAISRAVHSFVVIGTMEIFE
FT                   RNPASALGILGRALFSKGYELGDVTGNWAADTSLILRGKRLSSVSEHHAQLDKALADLK
FT                   DGEEIVIVSPFLSLSGVNAPELQDSIREAVGRGAVVNIVTRAPNAPGYSNGTSPACRKA
FT                   LEETGARLHDIKLLHSKTLMTQSFIAEGSFNWLSVMRDKPEGANLDTSWVLTGEDAHKA
FT                   AREAIDELNLLLKESKPPSEIGHGIMAAFVSQGKD"
FT   CDS             14318..15757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40120"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00800"
FT                   /db_xref="GOA:C7JI73"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI73"
FT                   /protein_id="BAI00800.1"
FT                   /translation="MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
FT                   RMSSDGGVILVKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDL
FT                   NDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALA
FT                   TLFVTLFLDQHEHAPARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLL
FT                   SATLRTTDRDPGKEALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDF
FT                   LFGLAGNTRLYDRIASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWR
FT                   HGNRYHRFIVTTLPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQ
FT                   LRLWFSAAAYVLLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLFMPDM
FT                   FPCQHEFALAHARLRRLRQAI"
FT   CDS             16032..16460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00801"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI74"
FT                   /protein_id="BAI00801.1"
FT                   /translation="MQKEAKGDLAKDEKADARYLEAKEKSILDIKVSVGKTVFNSNGQV
FT                   VPTTVKNKELHMSEAELDKLIRDLLNTQEDRCAITGLPFQFLGVKKDDNMLPSLDRIDS
FT                   DGHYAKGNLQLVCRFINFWKQASDDKEFRRLLAILRKS"
FT   CDS             complement(16677..18047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00802"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI75"
FT                   /protein_id="BAI00802.1"
FT                   /translation="MAADELTGLIRYLGQEDWQECFGEVLGDHIGPALEAGDITFEDLA
FT                   EMIGPDVAMTLWGCAFEDFLGQDWDDSRNFVDVYLKRRGWKEGPRNSAYMRALKASVMS
FT                   LYEVSDIKPGQSLMARDLLRGGDPVLVHEGTATRTLEQWDRIAARLVLSDGKTILAGGL
FT                   LAYSRGACEDLATHLYKVLRKRRGKAEFPKVDTQTLRELAPMFTLTWLFRTLEDMARQM
FT                   EGPALFNGDGEDLVFHEVCFPLAKGVTQKTVADVLDGIMALRPENRSFWNWLKEPMSDP
FT                   VRKAGRDENGRFLRTEMDDGAIVLGTLDLKGRQLRLQVNSKERAERGRAMLQVGLGDLV
FT                   HAPFTQIMTPAQAMEDRGTHGREVSPELQIPPEEEARIIGQMLERHYRQVLDEPVPALG
FT                   DLTPRQAVQTASGRKKVAIWLKDIENTTVRAQGSGGAMAAYDFGWMWHELGIIRLRK"
FT   CDS             18486..18815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00803"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI76"
FT                   /protein_id="BAI00803.1"
FT                   /translation="MDCLSRDPEDTKSIECKSVAHDSGEKQHVAAASYSRTLPNQNIAY
FT                   HEIIDISHDCTRLALFRQLWGGNGRSAIGRKIRQVAIRAFNVHDNFAPNFDADFSHLRQ
FT                   FRVIL"
FT   CDS             complement(18958..20343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40160"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00804"
FT                   /db_xref="GOA:C7JI77"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI77"
FT                   /protein_id="BAI00804.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPAFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHERAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYIFCGDHLLSATLRTADRDPGNEALAD
FT                   ISRIVEQIRNRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             20552..21010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00805"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI78"
FT                   /protein_id="BAI00805.1"
FT                   /translation="MKERATSAPEINSEEVQHLLASTVSLTDQRLVNQIRGMVEDMRSG
FT                   VADPEHPDFLFSIEQLERAVSGAQNVNEPQSSSDTRPTDETRPGLHPSPGGGHAEENNP
FT                   SADQTTPQKEGSRTEPQNAEQAKKEPAGTDKAQSTDKKEPEAQKEPEG"
FT   CDS             21076..21339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40180"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00806"
FT                   /db_xref="GOA:C7JC92"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC92"
FT                   /protein_id="BAI00806.1"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             21336..22163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40190"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00807"
FT                   /db_xref="GOA:C7JI80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI80"
FT                   /protein_id="BAI00807.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             22224..22886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00808"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI81"
FT                   /protein_id="BAI00808.1"
FT                   /translation="MSMGAALVGGFSRLAGALATKLEAEPGKLSPGWLDRAREKSQRHD
FT                   AAQAEKNMDHTAHLGSEAVEAMQALRQGPGSSILAAIAEAAASDPGGMSAVLSEMKPGG
FT                   KYASLHGQFEAEKQNNQAFASSLENAASKLDAYGKGREAAQKLGETMSTSTRVEQRFAQ
FT                   IDAQIGKEAESLPGSNPGTSMMEELGEKTKELVKKAVETLARLFRAAPSSGPTMSPG"
FT   CDS             22900..25275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00809"
FT                   /db_xref="GOA:C7JI82"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI82"
FT                   /protein_id="BAI00809.1"
FT                   /translation="MTVRGFLASVFMVLGLALYVSSAMAQSGSVTGSTTQSTMSGSSSE
FT                   ASSSHTVTWDLLDPGDDWTAVVVRSIFPVFSSGDSSIGSENTVIGTMLAWLSAFAGVIA
FT                   SGWVTYLWFNTNFRGAETAKLLGDNQSQMSIVKIGLAALMMFPTISGFNGGQAVVVQGS
FT                   LWGIGMAKTIYHYAVKAIGPDGKVIATPIVPGTKGIVLNLVKDEFCRSLLNVASNNPNL
FT                   IPAPTGRTIQGISGQSIGLVVNYAYNMTLGDGTPTCGAINLETPAMGKTNLAGVSVDTA
FT                   AMQKNVLDAVLAADIRGPVETVARNFWMSKKTQDLAPLMQIVMTATNDYTSRLTEQAAQ
FT                   MRSQLEKAISDRSTTLNQWGLGTNGDATNTANRLDSLGWSGAGAYYLEFARLNGQTLSL
FT                   MTATPNVTTPSYSGIGSALASDVAPLIQSAHTFLGNIDAMVATTDGMSAPGGNGDLYSG
FT                   AMPGGDGSSVVTQLFRALHLNDYALQMLVGFMEPSGTGGYWIDPFGNLMSLGHWLITLS
FT                   VTTMGTASVLSSNAGTISTGILSLLAGQPEGAVAAGLGHMAMQFFSTPIMAGCMAMLML
FT                   MPGLTIAFVLPMVPYVMWIAGIASWLILVCEAVVAAPLWMLAHMTLNGEGLHGNARQGY
FT                   ALLFDVLFRPTLMLFGLFFGYFVFDAMSWLVHQTFGVAAGFALSHGWLVSNFLGMLLLV
FT                   WMFVLLHMILALASFRLIAIVPNRVPQILGFGGGERIDVDAFSRDVAVIGMAGAMQNMQ
FT                   KALAPPERQQGNGNGISAPQKEIEKGTGLIDTTLKKNS"
FT   CDS             25293..25694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00810"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI83"
FT                   /protein_id="BAI00810.1"
FT                   /translation="MSDSGLGAFAAYMLGHNAGSAAERNSRFIRSIFDRSNAADYDEVL
FT                   KLARKGVSAVKTLGERLDTLNAELAAEREKSATLEEQLAAANAANAELQRRLEAEKAHA
FT                   VMLDDRLFDLTRRHVRLCKQTGMTETSST"
FT   CDS             complement(26101..26721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00811"
FT                   /db_xref="GOA:C7JI84"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI84"
FT                   /protein_id="BAI00811.1"
FT                   /translation="MSEHDNSFQASQKKGVIKTTAKLAKHVTGSPSDAVGWRQISGNFN
FT                   VIRLLWTILKLSAKPEPHKDEGKVPNPPSLQDDDHELIEDARNDIVGKKPLPAIRSAIP
FT                   YRYLTDDDLYNVIRKRQRETFFRALCAGLLTIVLFIMWSTEMIFFPWTSSRLLSSVAFL
FT                   PFLALLGSVSLWNCSVNWQLRTRQIATFREFLDRADSLLPRLP"
FT   CDS             complement(26718..27725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40240"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00812"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI85"
FT                   /protein_id="BAI00812.1"
FT                   /translation="MLRFYPLALTLILLEPTVTQAQQCSIASNGTSSAPSPSLPPKRQS
FT                   NPSDSYDALNRLTGSGAHLASPGQFHGFETGAAYTPDRVFIYFLLKDHRGVLGGTAIPV
FT                   PYDTLRSLSGKRATDLAQWHGIRGMFLQNGSHFQVIYATPDGQAAVAGSLWDASGRDVT
FT                   RQQIQHIPGAVPSVRMDGAQITKTVLASLHGGTVGSLSAPSAVMLIDPQCMYSIKAAQN
FT                   LMPLVQAGKLRLKVVPLSVLDYEDRGESTRNAQAMLSYPETDMVRAWLGGHLHERADTP
FT                   ASNAASQLAENGTFAKSIALKGTPTFLWIRTDGSLGRLEGNPTDVSSFLGELAR"
FT   CDS             complement(27766..28143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40250"
FT                   /product="conjugal exonuclease V alpha subunit TraA"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00813"
FT                   /db_xref="GOA:C7JI86"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI86"
FT                   /protein_id="BAI00813.1"
FT                   /translation="MHEEFYRGFSSLALLAKEDLPTCVREAIVFLEKHICRVIPDCPHP
FT                   ILRSSLVLTLSFPREQWVHLIEVIKWYRRRATPSERRLISRFLKIVRPILPEATPEPFH
FT                   WIPPASLINCSSNKKKQSVAS"
FT   CDS             28613..29998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40260"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00814"
FT                   /db_xref="GOA:C7JC03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC03"
FT                   /protein_id="BAI00814.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             30213..30710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40270"
FT                   /product="phage integrase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00815"
FT                   /db_xref="GOA:C7JI88"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI88"
FT                   /protein_id="BAI00815.1"
FT                   /translation="MRITLPHSKGDKKHQGTTIVIPRGITRHCPVRAWETWLRQSKLTP
FT                   RNKNKDTKPENVNETTAAFPRIWLPAAAKNNEPPPAPKIGMKSLSDWSVAKIIKQRCQS
FT                   AGIEGDFSGHSLRRGAITTGAQDGLDLIRLKRFSRHRDYRVLEAYIEEDQALSKHPGKT
FT                   RF"
FT   CDS             31135..32058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="APA01_40280"
FT                   /product="plasmid replication initiator RepA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00816"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI89"
FT                   /protein_id="BAI00816.1"
FT                   /translation="MADVHHLLLQHGLDEARRLQNIDKNSRACVDAAHEVLCDEQQAIG
FT                   IAHAGFAMAALPHKKPNSPVWERDGGPVKLLIESGLDANKEPVGIPYGSVARLILLYLQ
FT                   TQAVRNKSRQIELGASMNAWLSAMNLSIGGKTYNLVREQSRRISRCRLTFFRSDAGNQY
FT                   VSNGAFVRDAIFPLDPSNSDQQSLWLEVVTLDESFYNSLIQHPLPLREVAIRQISGRSM
FT                   AIDLYIWLAYRLHILPGPVKVSWAALKSQFGPDYRELRFFRRDIIPSLNLALSVYPEAV
FT                   VTIDDRQGLTLFPSPAPVKERNRYLP"
FT   CDS             32269..33324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="APA01_40290"
FT                   /product="chromosome partitioning protein
FT                   ParA/MinD/MRP/soj"
FT                   /note="ATPase, Cobyrinic acid a,c-diamide synthase with a
FT                   DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00817"
FT                   /db_xref="GOA:C7JI90"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI90"
FT                   /protein_id="BAI00817.1"
FT                   /translation="MTENNAGNTLKKIRTNLGLSQAELKSLLNERLSRNYDRHTISRWE
FT                   NGRQPIPSEVLNELQQLIERRPQPLQVIVFANQKGGVGKTTSALNVAYALSRLNYRVLL
FT                   IDADPQASATSALVGDALVELYRNGRTLDAALLKGIPFADVILDKSTELGNGRILPFSF
FT                   IPSHIDLAEVDVRREPGTEGLLREAIQGVQNDFDYIIIDSPPHLGFLTWMALTAGNQVF
FT                   IPVRTEPYDVMGVNLILDTISKVNRRSNPRLRIGGVIPTQFSSNQYVDVGIIEHLITTL
FT                   AGKADVLEPVPSSTAFSNAAWEGKISVEVSPTNPAVRPYVRLAEAISKGNQPTLATDAL
FT                   DLNQTEEDVRG"
FT   CDS             33311..34183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="APA01_40300"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00818"
FT                   /db_xref="GOA:C7JI91"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI91"
FT                   /protein_id="BAI00818.1"
FT                   /translation="MSVARTFKKRNPSAFLEAQKGITTSFSTPFLGKGRFNHSFEVQLS
FT                   ELVPDPDQPRKFFNSEDIKALASSLSERGILQPILVREAEEGSAKWIIVAGERRWRAAA
FT                   SLGWEKLPAIEYEGDYRAASLVENLLRTDLSAVEEARGLRNIMDLNNWSQSEAGRQLGL
FT                   SQSRVNRTLRILDLPCAFLDFASAHAVPINVLVQIVREEDPTQQQVLMDRVMTGSATVA
FT                   EVQDLRKKTDTKSQNIADKKTGSELKAFKTIRRFIKETTSIGGKKIALSEEEKNDLRQA
FT                   RDMIDQLLG"
FT   CDS             complement(34240..34434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00819"
FT                   /db_xref="GOA:C7JI92"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI92"
FT                   /protein_id="BAI00819.1"
FT                   /translation="MASTNHLRHTLRTGGSSVLLSFCPSVLLSFCPSVLLSFCPSVLLS
FT                   FCPSVLLSYATLHRRKEHK"
FT   CDS             34662..37370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf2"
FT                   /locus_tag="APA01_40330"
FT                   /product="DNA methylase/helicase SNF2"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00820"
FT                   /db_xref="GOA:C7JI93"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI93"
FT                   /protein_id="BAI00820.1"
FT                   /translation="MSMSASQLNLFDTTVLSGELAALWSLEDDQPIPEVSLPSPQTFRI
FT                   PQRDFRLKGVRGLAQGWKALAEANLAAIALLGTLEREDRNATEAEQEVLARFTGFGAGE
FT                   LANNLFPPTGREVRKGWESLASELEQLTTETERAGLQRATQYAHYTPELIVHSMWDMAL
FT                   RMGFRGGSVLEPGCGTGLFIAARPEKLEGKIAFTGIENDPISARIARKLYPNQWIRSED
FT                   FTRAQLPQGYDLAIGNPPFSNRTVHGRDGLEKLGLSLHDFFIARSIDALRPGGIALFVT
FT                   SRYTLDKTDPNARRIIGESADLLGAVRLPEGAMRDDAGTDVVVDVLAFRKREMGEEPSN
FT                   ESWVETADIPDSDEGNGPLVINRYFHDHPEQVLGSHIWTTTQFGPGYTCSATAGAELDL
FT                   LLPQALNRIAPNTHFLPPREARIVRPAGEGVTIGTAASGADLKEGSYFVDRSVLHQIIE
FT                   GQAQIVPIRKAGQTEGIFAKHARIIRALVPIRDAARSVLRAQMQNLPYGAQQRTLKTAY
FT                   QSFVREFGPINHTRTTLRENPETGKTRETQRRPNLQPFMDDPDVWLVASIEEYDERTDT
FT                   GRMGPIFSERVIHAPTEPEIHGAHDALAVSLHETGRVDLPLIAELLGRSEADTLAELGE
FT                   SVYLDPERSVQGRDVWVTADEMLSGAVRTKLALSRDATQLDPRFARNVSALEGVQPPDL
FT                   RPSEITARLGAPWLPVTDIQDFVQEVMGIETTVRHTPEVACWSINRAPFLSRAEATSVW
FT                   GTERRNAAELLEDALSQSIPKIWDHWRDENGNDRRELNTQETEAAKEKLAAIKSAFEKW
FT                   VWGDPERSDRLVKLYNETYNNLVPRAFDGSHLCLPGASSVITLRAHQKRVVWRIIASGR
FT                   TYMAHAVGAGKTFSMAAARLCCVNARSGFTE"
FT   CDS             37567..38328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40340"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00821"
FT                   /db_xref="GOA:C7JI94"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI94"
FT                   /protein_id="BAI00821.1"
FT                   /translation="MPDAESVLFGFALRQTTGFVESLLRLAVLSWSVPDFSTLSRRQKS
FT                   LTVDIPYRSSGGPLHLLIDSTGIKVEGEGEWHTRKHGASKHRIWRKLHIAIDEGSLEIR
FT                   AVEITKNDVGDAPVLPALLEQIPDEEDIACVTADGAYDTRKCHETIANRGAQAVIPPRK
FT                   NAKPWCPTSPGAIARNEALRTCGHLGRAIWRRWSGYHRRSRVETKMHCIKLLGQRLTAR
FT                   DFDRQITEVHIRVAILNRFTALGIPLTHAVA"
FT   CDS             38442..38720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hu"
FT                   /locus_tag="APA01_40350"
FT                   /product="histone-like bacterial DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00822"
FT                   /db_xref="GOA:C7JI95"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI95"
FT                   /protein_id="BAI00822.1"
FT                   /translation="MNNHDLIERIVATTDISKKDAKTALDTVFAAIIEAAAEGDDTAIP
FT                   GFGKFVVRQTSERKGRNPHTGAELVIPASRKLAFTPAKAVKDALTGK"
FT   CDS             39117..39425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00823"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI96"
FT                   /protein_id="BAI00823.1"
FT                   /translation="MTGSDEPTHAAWRAHVDEQFDAIHESLRALHQRQTLILELLTPEE
FT                   REGPTLDDLLARIVTLIADQRPVLRRIDHTTGTALDLLEGRSSRTPPDTNADEVPEE"
FT   CDS             39422..40018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40370"
FT                   /product="conjugal exonuclease V alpha subunit TraA"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00824"
FT                   /db_xref="GOA:C7JI97"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI97"
FT                   /protein_id="BAI00824.1"
FT                   /translation="MMTFRKISAGCRGQVISNYYLQDIPDPDIDFRLDPTKAPDSDGAR
FT                   LTNYYTGRDGRASWRPDMSWRAAEALGIDRFKPPTREQLSHLYEARRADNGEEWSAHQR
FT                   KISAYDLTLAPHKSVTLAAEFAETDAERAAIWHAMQVANDETMRYVARELGLARRGRGG
FT                   KDGAEEGHVAWVTYRHTTARPTVDAEISQKGCTSG"
FT   CDS             40022..40537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40380"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00825"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JDS2"
FT                   /protein_id="BAI00825.1"
FT                   /translation="MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
FT                   RMSSDGGVILVKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDL
FT                   NDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHDAEI
FT                   SQKGCTSG"
FT   CDS             40595..41980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40390"
FT                   /product="transposase"
FT                   /note="IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00826"
FT                   /db_xref="GOA:C7JI99"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI99"
FT                   /protein_id="BAI00826.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMDLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             42264..43649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40400"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00827"
FT                   /db_xref="GOA:C7JC03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC03"
FT                   /protein_id="BAI00827.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(43996..44613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40410"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00828"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA1"
FT                   /protein_id="BAI00828.1"
FT                   /translation="MKQPGFFDVEERLARLSGLGDQLEAFSRTVDFEVFRPDLELALAY
FT                   SDGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINNRLSFMRFLGLGLSDRVPDAK
FT                   TVWLFRERLTQAGAIERLFDRFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEKADL
FT                   RAGRIPEDWQDKPAKMSHKDRHARWTLKFTKAKRQDDGVDFH"
FT   CDS             44964..45557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tetR"
FT                   /locus_tag="APA01_40420"
FT                   /product="transcriptional regulator TetR"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00829"
FT                   /db_xref="GOA:C7JIA2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA2"
FT                   /protein_id="BAI00829.1"
FT                   /translation="MKIAEKHHAARQHILKAAKPLIGQRGFSAVGLTQILDVAGVPKGS
FT                   FYHYFESKEVFGEELLRTYIEDYLVKMDDLFENADGNAAEKIARYCQFWRDTHLSKQIG
FT                   NKCLIVKLAAEVCDLSERMRAILEGGTKSVIDRLSALITAGQGEGSIGNRQEPEMLAAS
FT                   LYQLWLGSTLIVKITHSSQPFDQAWQATKRLLEI"
FT   CDS             45645..46802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40430"
FT                   /product="alcohol dehydrogenase NADH-dependent
FT                   iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00830"
FT                   /db_xref="GOA:C7JIA3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA3"
FT                   /protein_id="BAI00830.1"
FT                   /translation="MQNFEFYNPTRILFGKGMIARLDEQLSPEARVLVLYGGASAERSG
FT                   TLAEVRAALGNRTFREFGGIEANPTYETLMKAVALVREEKLDFLLAVGGGSVMDGTKFV
FT                   AAAVPYEGEPWDILVSKGKAATKALPLGTVVTLPATGSEMNCLSVISRQSTGDKLLFSN
FT                   PLVYPRFSVLDPMRTMSLPMKQVINGVVDSFVHVMEQYMTYPVDGMAQDRFSEGLLSSL
FT                   VEIGPRIVATPDDYDLRSNLMWVATLALNGLIGAGVPHDWSTHMIGHEITAKYHIDHAR
FT                   TLAIVFPALIKVRRAEKRAKLLQYATRVWNLTDGTEDQRIDVAIRKTEEFFEGLGVPTR
FT                   LSAYEIGAEGINDLVGQLEDHGMTHLGENGDVTLDVSRKILEAAA"
FT   CDS             46887..48278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40440"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="Succinate-semialdehyde dehydrogenase NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00831"
FT                   /db_xref="GOA:C7JIA4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA4"
FT                   /protein_id="BAI00831.1"
FT                   /translation="MAYATTNPYTNEVVATFPEATDAEVQTALAEAHAAFEAWRDTSFA
FT                   ERAKVMNAAAAILRRDVDKYARLGTLEMGKLFEESKAEIILSAEIFEYYAKHAEALLKP
FT                   ELLPVADPAEGKAMLVHEPLGIVLAIEPWNFPFYQVVRIIAPQLSAGNAVLLKHASNLP
FT                   QCAAAFDTLMAEAGLPKGLFRNLYAARPHTAMILNDPRVCGIALTGSEGAGTVIAGIAG
FT                   KALKKATMELGGADAFIVLDDADVEKAARWAVIGRHWNAGQVCVSAKRLIVADAIYDQF
FT                   VALYKEGVAALKAGDPMDPKTTLAPLSSQAAADDLRDQVTRAMDLGAKVEVIGAPVPEQ
FT                   GAFFQPLLMSNLDQKNPARHWEFFGPVTQIYRAKDEADAIRIANDSPYGLGGSVFTKDE
FT                   ARGTRVARAIRTGMVVINHPLSPKADLPFGGIKNSGYGRELIGLGIKEFINHKLINVVD
FT                   IDAAF"
FT   CDS             complement(48525..48839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40450"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00832"
FT                   /db_xref="GOA:C7JIA5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA5"
FT                   /protein_id="BAI00832.1"
FT                   /translation="MRFDMICEAHGIEHRLTKPNHPWTNGQVERMNRTIKEATVKRFHY
FT                   DSHEQLRTHLNDFMAAYNFGRRLKTLSGLTPYEYLCKIWTSEPERFIINPTHQTPGPNT
FT                   "
FT   CDS             complement(48849..49484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40460"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00833"
FT                   /db_xref="GOA:C7JIA6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA6"
FT                   /protein_id="BAI00833.1"
FT                   /translation="MGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTVAKWRK
FT                   RQSVEDQKTGPKEPRSTVLSETDEAMIVAFRRHTLLPLDDCLYALQASIPYLTRSALHR
FT                   CLQRHGISRLPDIERDKAKRQRFKRYPIGFFHLDIAEVQTAEGKLYLFVAIDRTSKFAV
FT                   TQLVEKADRKTAWEFLEHLLSIIPYRIHTILTDNGIQFADQPRNRNTA"
FT   CDS             complement(49678..50928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40470"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00834"
FT                   /db_xref="GOA:C7JB26"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JB26"
FT                   /protein_id="BAI00834.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTQLR
FT                   TRQSLSAGPFRRSGASS"
FT   CDS             complement(51242..51691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00835"
FT                   /db_xref="GOA:C7JIA8"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA8"
FT                   /protein_id="BAI00835.1"
FT                   /translation="MIKNIPGFEKISSIFDLFEEIAMLVLTLCIMVVAALGLIHVLYAV
FT                   FEMLRTATLSPTNPVVLQSLFGLFFTVLIALEFKHSILVSPDTPSHSMVRMRSVLLIGM
FT                   MATVRKFIVLDLSGLDVMEVLALSAAILALGIVYWLVRGNNKITS"
FT   CDS             complement(51728..53050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00836"
FT                   /db_xref="InterPro:IPR011486"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIA9"
FT                   /protein_id="BAI00836.1"
FT                   /translation="MSDPFYAAFLSGESTTMMTRVYLDKSAFLKWTPRSGNVGFFLTAA
FT                   ITMVLLDMNDAIAKPATEWLDDITLAGQIEGGINANVSRPANGINFGQFFGDRANQAQL
FT                   DQLTLTAARAVDTTASSYDVGFMVRGLYGADGRYFNIAGITDRLMTSRYQFIVPQAHLD
FT                   VHLPWLTRHGLDMQAGILASPMGVESLDPSLRPFYTLSYTTEYSTPFEHVGAMFQWHLT
FT                   DHIDALFGVDTGNQVSFGGGDNNHTAAGYFGLTASSLANGKLSLTYLGRVGPENSTRSL
FT                   GQRANSAQRYWNDLSGSYKISDRLTFTGELNFLHDEGLHANTYSFVSYLSYQLTPTLLL
FT                   NYRGEIYRDDTGLFVTSFIANNAYMQATLGKPTVTQSAPPTTYGALTLGATWRPVLGHS
FT                   VKLFEIRPEVRFDRSLNGTRPFNDLRNVGQFTFGADAVLGF"
FT   CDS             53418..55124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="APA01_40500"
FT                   /product="potassium transporter ATPase A chain KdpA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00837"
FT                   /db_xref="GOA:C7JIB0"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB0"
FT                   /protein_id="BAI00837.1"
FT                   /translation="MSFYGWVAIMAFLICVIAMTRPLGGFLKRVLEGEQHVLGRIFGPV
FT                   ERGIYRIAGIHKDREQSWSQYAIAVIVFKVICFIAVYTLLRVQGVLPLNPNGMGGVAPD
FT                   LAYNTAISFLTNTNWQSYGGETTMSHLTQMLGLTVQNFVSAAAGIAIAAAVIRGFARRS
FT                   ATSIGNFWADLVRTTLYVLLPICVVLALFFVLEGVPQTLLGSVTVSTLEGARQTIAFGP
FT                   VASQEAIKMLGTNGGGFFNVNSAHPFENPNALTNFVQMLAIFALGAGLTNMFGRMVGRE
FT                   RQGWAIFSAMALLFLIGTGVAYWSEAHANPLITALGADPSAGNMEGKETRFGIIGSALF
FT                   ATVTTDASCGAVNSMHESFLPLGGMVPLLNIMLGEIIFGGVGSGLYGFLLFAIIAVFMA
FT                   GLMVGRTPEYLGKKIEAREIKMTMLAVLCLPLVMLGFTALAVVVSPGLSALSASGPHGF
FT                   TEALYAYTSAAGNNGSAFGGLTANTFWNVTLGIGMMAGRFFVIIPVLAIAGAMAAKKTA
FT                   TPTPGTFPTDTGLFIALVTGVILIVGGLTFLPALALGPIVEHLAMLGGTLF"
FT   CDS             55139..57247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="APA01_40510"
FT                   /product="potassium transporter ATPase B chain KdpB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00838"
FT                   /db_xref="GOA:C7JIB1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB1"
FT                   /protein_id="BAI00838.1"
FT                   /translation="MALHLPHSEAPHGGRHSEHRSQSSLMQASLLLPAIRESFRKLDPR
FT                   IMWRNPVMFVVEVVTILTTVLLIRDIVAGGTHLGFAIQINLWLWFTLLFANFAEAVAEG
FT                   RGKAQADSLRRTRTETLGKRLLMNDEGGYSHLGLYEEVPAPELVVGDVVLVQAGDFIPS
FT                   DGEVVDGIASVDESAITGESAPVIRESGGDRSAVTGGTRVLSDWVIVRITAAQGSTFLD
FT                   RMISLVEGAQRQKTPNEIALTILLAGMTLIFIFAVATIPSFVHYAGGHISVLILVALFV
FT                   TLIPTTIGALLSAIGIAGMDRLIRFNVLAMSGRAVEAAGDVDTLLLDKTGTITIGDRQA
FT                   TAFVPVSGVTEHELADAAQLASLADETPEGRSIVVLAKEKFGIRGRDMRDLGAHFVPFT
FT                   AQTRISGVDVGDRQIRKGAVDSVIASLGETLPSVEQIRQIADDIARQGGTPLAVADNTR
FT                   LLGVVHLKDVVKGGIRERFAELRRMGIRTVMITGDNPMTAAAIAAESGVDDFLAQATPE
FT                   AKLALIRSEQASGKLVAMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDPT
FT                   KLIEIVGIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFVGFYPALSALNIMHLATPES
FT                   AVLSAIIFNALIIIALIPLALKGVRYRPVGAASLLRRNLLVYGIGGLIVPFIGIKLIDM
FT                   LVTSIGLA"
FT   CDS             57258..57881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="APA01_40520"
FT                   /product="potassium transporter ATPase C chain KdpC"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00839"
FT                   /db_xref="GOA:C7JIB2"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB2"
FT                   /protein_id="BAI00839.1"
FT                   /translation="MTLIRQLRPALVIFGFLSVLTGLLYPLGITAISHLLLPEKAGGSL
FT                   VHENAQTVGSALIGQNFTQPRYFHGRPSATTGADPNDPTKTVPTPYNAAASMGSNASPT
FT                   SRALIERVRIAVAQLKTENPDAIAAGWSIPMDLVTTSASGLDPDISPQAALFQVKRVAH
FT                   ARNLPEQTVRQLVEHMIAHPLMGWLGEPHVNVLELNMALDALHR"
FT   CDS             57881..60568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="APA01_40530"
FT                   /product="two component sensor histidine kinase KdpD"
FT                   /note="Osmosensitive K+ channel"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00840"
FT                   /db_xref="GOA:C7JIB3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB3"
FT                   /protein_id="BAI00840.1"
FT                   /translation="MEAHLIRPDPDALLRQTVLDGESRKRGRLKVFLGAAPGVGKTFEM
FT                   LTVAHQLQRDGVDVVIGVVETHGRAETAALVNGLELVPLRTMTYRDRMAQEMDLDAVLR
FT                   RAPCVAAVDELAHTNVPGSRHPKRWMDVEELLAAGIDVLTTVNIQHLESLNDIVASITR
FT                   IRVRETVPDHVIGDADEVELIDLTPNDLLQRMRDGKIYAEHTAGRAMLHYFSPGNLTAL
FT                   RELALRQTAQQVDAQLVDHMKANAIVGPWAAGERIMVCLTLQDGDASLLRYGKRLADHL
FT                   HAPWIVLHVETNRDLSDAARATMASQMHLAQSLGAELVTIPGQDVALDAVAYARTQNVT
FT                   QIVAAHPVGRGWSARVRQWLGRSTTERLIQFAQGFPVHVVPRSPGENAPTEQLLNIAPF
FT                   TARPYVVGTLIVLGALVVALLLRQSFEVSNVSLAFLTAILGVAVAYGLWPSLWASLMAM
FT                   LCFNFFFLPPFYTLTIAAPDNVVALFFFLVTALIASNLGARVRNQAVVARHRADITQSL
FT                   YHFSRTITGILQLEDLLWSASHQIATMLDCDVAMLLPDGEILKVKASYNGGKAVGAADL
FT                   AAATWAWKNNKVAGRGSDNLPGGRWLFIPLRTGRGPVAVIGLHAERTGPILDLEQQGLL
FT                   DALADQTASAIESILLAGELDQARLDVETDKLRGALLTSISHDLRTPLASILGATSSLE
FT                   SYGEELDENARKELLSTIHDEADRLNRFVANLLDMTRLEAGALQPRKERVDIGEVIASA
FT                   LCRAARLLSDHETEMVIEPDLPMLLLDDVLLEQALFNILDNAGKYTPVGTKIVVTASVA
FT                   ADTLLIRVTDEGEGFAAHDPETAFSKFKRFKSADRSRPGTGLGLAISRGFIEALGGKIV
FT                   SRNRKDCSGAELVMTFPLDEKNTK"
FT   CDS             60565..61248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="APA01_40540"
FT                   /product="two component response regulator KdpE"
FT                   /note="Winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00841"
FT                   /db_xref="GOA:C7JIB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB4"
FT                   /protein_id="BAI00841.1"
FT                   /translation="MSNPSVLVVDDEPAIRRLLRTALGSQAWRVIEARTGEMALNMAME
FT                   VVPDIVVLDLGLPDMDGVDVLRRLRSAHPTLPVVILSVRDDERGKVAALEAGADDYVTK
FT                   PFSMAELVARMRNAVRHALQQEGTIPLFVSGDLSIDLVRRQISRGESEIRLSPREWDIL
FT                   RMLVRYAGRVLTHQTIMSQLWGATGDVQQLRVYIRQIRQKIEIDPERPRHIITETGVGY
FT                   RMVQL"
FT   CDS             61506..62768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaAP"
FT                   /locus_tag="APA01_40550"
FT                   /product="Na+/H+ antiporter NhaA/NhaP"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00842"
FT                   /db_xref="GOA:C7JIB5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB5"
FT                   /protein_id="BAI00842.1"
FT                   /translation="MDTISLFALLLTLSAGFSILNHHTFRLPVTIGVLVFSLLASLLVM
FT                   ILNPLIPAYDLQALPRSVLGAINLPTALLNGALSLLLFAGATQVDVRHLRAKLASVAAL
FT                   SVLGTVLAVAFLAIAAWYVFPLLGHAIPFTWCIVLGAILAPTDPVSVVGMLKRLGPPGP
FT                   LQAVFAGESLFNDGVGVVIFGVTIGLATGNSQGVTASGIALSFCREAIGGGLLGALTGW
FT                   IALRVLKGQRDPHIDLLTSLALVTGTFSIANQLGMSGAIAVVVAGLCFGTSYSHSVFDE
FT                   VSRKELDVAWTLIDEVLNVLLFMLIGFEILEITPHLFTVLATLAVIPLSTAVRALSVLF
FT                   STLPVHLRQWERGRVLGILTWGGLRGGISVSLALGLPPGNLRDLLLPVCYGVVVFTIIV
FT                   QGLTMERVARRLYPPSTLRSQ"
FT   CDS             complement(63073..63795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00843"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB6"
FT                   /protein_id="BAI00843.1"
FT                   /translation="MRNPRRECVREALLEGDEPWERRSWRTGATVTCERHRRVLEEACP
FT                   RCNKIGKGCLFLSDKGRVQPLCAVKGDKINLWGDALDDQLPWGLTIDRTISRCVNALSI
FT                   DLCRSLVGQTLRAQWRGVSRERRLTTIIEELTLITLITIDYLPRPQPPLYWMLEQSDWK
FT                   AAFHYTPAMLPTSLATGIIMLASVVLSDEQFFEELVFWDPLESQIPNEPLTPETYVMWL
FT                   HPKVRSWGRQIISAPFGV"
FT   CDS             complement(63967..65406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40570"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00844"
FT                   /db_xref="GOA:C7JIB7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB7"
FT                   /protein_id="BAI00844.1"
FT                   /translation="MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
FT                   RMSSDGGVIVVKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDL
FT                   NDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALA
FT                   TLFVTLFLDQHEHAPARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLL
FT                   SATLRTADRDPGKEALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDF
FT                   LFGLAGNTRLYDRIASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWR
FT                   HGNRYHRFIVTTLPQGMTDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQ
FT                   LRLWFSAAAYVLLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLFMPDM
FT                   FPCQHEFALAHARLRRLRQAI"
FT   CDS             65837..66799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="APA01_40590"
FT                   /product="transcriptional regulator AraC/YbtA"
FT                   /note="Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00845"
FT                   /db_xref="GOA:C7JIB8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB8"
FT                   /protein_id="BAI00845.1"
FT                   /translation="MAEKSTQTVASSDVPESRQTDTTQSSMIRLNAYTRLIALQSGLHI
FT                   LYWDARTKHDFSYSAYHDDDLIYFGAYTGGNSHMETRCWDGLTTYDTLSKPDDAYVAYR
FT                   PGCRIDFTKTAGAGAGVTITLSPTTLASLSAEDATCLDQKLRSGHYFNQVRGGRQLLSF
FT                   ANALRSVGTSPKRPGSQLQMLGQSLSFMGSLIEQVCHIAPPNISLSEREIRRLNDTRDM
FT                   LLADLASPPRLDQLARHAGMSVSRLQRHFRMLFGSTIYALFQKERMHEAYRQLVKDDES
FT                   ILTIATLMGYANPGHFSAAFRKQFGINPSELRQIPRLRR"
FT   CDS             complement(66789..67619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40580"
FT                   /product="sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00846"
FT                   /db_xref="GOA:C7JIB9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIB9"
FT                   /protein_id="BAI00846.1"
FT                   /translation="MSDSSYSVHVISGLPRSGSTLLAALLRQNPQIIAASHNTPVMPML
FT                   IRIMSLMSEGEYRTEFKNGQWQRLMRGILQSYLNPDAQKHVMLDINREWCAHAGLLGHL
FT                   YPKAKIICCVRDPVWILNSFEHLIIRDPLLGSRLVPITHRGTQHDRIDYLASREGAFGY
FT                   AWRLLTEVFFGPFADKVIIIDYDKLVREPVFVMERLTQLLNIQPFAYNFEHIETPDVDA
FT                   FDAALGTPGLHYLRQSVAASRKRLILPPYIVERMAHQMFWRKPDLNSGGAVVIA"
FT   CDS             68164..70137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40600"
FT                   /product="acyltransferase"
FT                   /note="Membrane associated"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00847"
FT                   /db_xref="GOA:C7JIC0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC0"
FT                   /protein_id="BAI00847.1"
FT                   /translation="MNIGSISFSETVKKFSYRKDIDGIRAIAILMVIINHLNTKWLPGG
FT                   YLGVDIFFVISGFVITGSLFNYGHGKGLPSLLYDFYAKRLRRITPALLTNIVICSAAVW
FT                   IIDPQPQISLQTGFLALFGFSNFYLWKISQDYFSPSTKLNAFTHTWSLGVEEQIYLLYP
FT                   CILKITGFFNEKTSRLFPLTAICALSIVSAIVLMILPGHTTGGAAYLLPFGRFWEFGIG
FT                   CIACLLSLHFENRDQKNIKSVICYLSFLCVIFSAVLPQYQNVLWSFLAAPATAALILFL
FT                   PHTNKARLFLSGNILQFLGKISYSLYLWHWPILSLLNLYMKSNTSYLYNFLLLTFFTSI
FT                   SSYFILEKRLKTFLQNKGNVFSYLLSLPLILFSSLYVFTLHKSHNPHPLAINGFRYLPD
FT                   SYENFPVKHTNFFYCTVELPKRPLHSNTMEKCTIPPANKNLPTLWVMGDSHAGHLMGLL
FT                   SQLQQKSGYGIHLVETVGEPFPASGGISSPERQKLWNAALARMKSGDFVVLGRIFLTRD
FT                   GEIKPLPDIENWLQQVGKIASYLEAKNVSIIIMSPIPMFRFDSLYNCAPSQSNNTTCDI
FT                   KRKDEAKPLNDIMHAMIDVQENHKNLYVFDAFSEICPEELTSCSPVRNGIPLYRDKDHL
FT                   NVYGSEILYKNFSGFLKNISKP"
FT   CDS             70489..71574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00848"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC1"
FT                   /protein_id="BAI00848.1"
FT                   /translation="MFGSETLKHSDGYLHKNLTQTAIAFGRIDQRLRHHPLLPAILFRE
FT                   RLEAARACAAVDGHLIDPWRLAAELEGLRVVPLGSDVFERGSSVDAAHAAFAQYQWLVK
FT                   PDEAQRNAIESALGWLSEHSKASGPLLGAATAFHAWVETGHARAPMRAALIRHWRRTDI
FT                   LHFPLPLVGARAFIADAPWEPSEWIPCFLNCLYDEMTAVENRTRKLERSWRHARMQSGA
FT                   QRSTSRADKVIDILAAYPLISATRLSDELGLSLKAAYIYLERFLSDGLIVEVTHRTARR
FT                   LFALKELEPLREIVRPPKRPLPGRKRGRPRKSESLETTPPEEDVDIRPLEPVPTFAPIN
FT                   YEELERAIENAERIIRRYRAD"
FT   CDS             complement(71587..72633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="APA01_40620"
FT                   /product="cell filamentation cAMP-inducing protein Fic"
FT                   /note="Yeast CDC2/29 and FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00849"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC2"
FT                   /protein_id="BAI00849.1"
FT                   /translation="MMPVTDPYLYPDTDVLVNKKGYQNADRLRVFETTRYLSRAITMPT
FT                   ATSSPSALKNLHHHLFQDVYDWAGQYRTCNLSVDGRKGLHPQSIHQSVNAVFQNLNANN
FT                   GLQDLSSDRFARAAATHIASLDKILPFRHGNQQVTLLHLAHLARNAGHTFDLSQLDHDQ
FT                   WNRASSQAAVNDERLMTHAIASLFKSGRTITPDQARREALSLRDPARHEIQSRIEGATR
FT                   ILDAGRADGTTLKELRGLRGELKALESDTQVGTVLRHIDQAQKAGIEKLTVLPGRDGSA
FT                   RDAIYAIGRAAVRSLDLREDQRAAQGMKAEQAHLPSSWFTRASQKLSASEGPAPQSNGP
FT                   KSRGPQIG"
FT   CDS             complement(72630..72986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00850"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC3"
FT                   /protein_id="BAI00850.1"
FT                   /translation="MQTIRDTYPHSLGTTGRTEGNMNEPTRFPRVERYRKELAKLTFEP
FT                   VSPEMTSFYKVLIQDAMSAMTEHDRPERNLMAEICSITTLLIEARVPAEILMDYLERLH
FT                   EELDEPIRPMEGDE"
FT   CDS             complement(73078..74394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="APA01_40640"
FT                   /product="replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00851"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC4"
FT                   /protein_id="BAI00851.1"
FT                   /translation="MLSEGYSRSAGIRKITPAMVAARTTAEALPLQAVEMSDLYRYLRQ
FT                   GRSILGLTCQQTELLCYLIAFTQPADWSGEDDVLPVSTASNLDIQQRFDLGRTRVKNLL
FT                   RELAEAGWLLHRDSPNGQRYRRSNPFTPRSQQAYGFDLSPLARRFDDLKRAAETALWRQ
FT                   QEGRRLHREVTTLSRTIYALFQTAEEAGVTVKDGKQILARTSALVSQRGSERDPKWLDP
FT                   ICQELRQIHEQVEREIAFAKEMTVSSDTSDSVPLSVESDPMGTPERPHYTYTKSTSLAK
FT                   AAVEAAGFAENCNEASRSRSSSSSRAAQTQPVPSAVTDPLRGFRAKPSFVLHIAPIFRQ
FT                   YCSSDKPAETEIIQAALFACEQLGISRHAWAQGQAVFGDYPNAVVIAAIAARTDAGEVR
FT                   SPGGLLRAMIARFLAGQLALDRTLYGLAEKLKRGPTIVQ"
FT   CDS             74403..74822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00852"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC5"
FT                   /protein_id="BAI00852.1"
FT                   /translation="MSDEWEYLPRRDADPQDKRPLWQEKTCNFTGYVGEKLSPNSFSSD
FT                   IPIRECILCLQASRKRGLSRFRGKLCHGSLFLLALTDGSRRTWGMAIVILGSLNAPYLP
FT                   FIGKFDANECLWLALLKRARHATECTLMMRPTTRA"
FT   CDS             complement(75535..76920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40660"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00853"
FT                   /db_xref="GOA:C7JIC6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC6"
FT                   /protein_id="BAI00853.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASDR
FT                   LSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             77328..79796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40670"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00854"
FT                   /db_xref="GOA:C7JIC7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC7"
FT                   /protein_id="BAI00854.1"
FT                   /translation="MHLLSFSRRKALWLFCSPLAFSVAHAATTAKPHHTTHRAHVAPRT
FT                   TAPGITPVAAPVATVPHAAVRRTSTQRAAHAAESEQIIATGRHSRSEQTVGHIQMQRTL
FT                   PGINPIKSLQILPGVVFNNADPWGNNEQNSSLVIHGFNQNQLGYTLDGIPLGDQSYGNY
FT                   NGLSPQRAAISENFASASVATGAGALGTASTSNLGGTLQFTTQDPLHRAGGQLSQTFGS
FT                   WSTFRTFARIDTGDFGNGNSAYVSWGRQDARAWDFAGHQGGNQVNAKFVHEDSKNKVSV
FT                   FFDWSEKVEPNEDGIVMPNGGSLYVRPFMYPNLNEAVNYYKNSQAYTSAGLNYRNYYSA
FT                   AQRQDYLMYASWQHEFSKNLKWDTKIYYHHDIGEGVVAGPITAAGLPTLFSSYFPNQSS
FT                   SQLSDVFGGSGMATRTTEYWDNRGGIMSNLTYHLGQHTIELGGWYERNNNTQARRWYPF
FT                   DINNPTTPYERQQNALINQYTNYFYTNTWTTHLQDSWKISKNFSLNAGFKSELVYTNGT
FT                   LPVAGLPGSLSPKTAITVPGGTIAAVRPFLPSFGALWNITQHEQWFANIQENMRSFQAA
FT                   GYGNATPWGVTSQAAFEDFKRHGKPETSWTYETGFRTNRHLDAGPLTNISGQLEYYHVH
FT                   FSNRLLAVASTQTLSSIVGSATTLTNVGSVSTDGMDFSFTAQFGQHFSFYNALSYNKST
FT                   YNDNYLNGSTVVHTAGKNVAGVPNWTEKFVASTHWGNFDAQFIGDVVGKRYTTFTNDLH
FT                   ASAYALFSLNAGYNITGIPHVRSLRVQGNITNLTNEKGWSTLNTNNASGQYTAFPIAPR
FT                   MYFLTLTASF"
FT   CDS             79809..80918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40680"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00855"
FT                   /db_xref="GOA:C7JIC8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC8"
FT                   /protein_id="BAI00855.1"
FT                   /translation="MADLSRRALLAATCAAGFMGATRSWAAPSLVPKPLVFAHRGCSAQ
FT                   RPEHTLASYAKAIADGADFVEPDLVPTKDGILVCRHESNIAETSDVADRPEFANRRRTL
FT                   KIDGREETGWFTTDFTLAELKTLRARERLATLRVHNTRYNGQFDIPTFEEMIDFVAADS
FT                   AARGRVVGIIPEIKNSTHFHALGFDPETTFLRIIAAHSYTRFAPLEVQSFETTNLRHLK
FT                   DAVKAVNPQARVMFLMGERGQTPPDLAAKGEKTTFGDLMKPEGLKEVRTYADVIGPSLT
FT                   DLIPRDAQGAWTTPTTLIDDAHAAGLLVHAYTCRPENIFLPKQLRNADGDAARNIKGSL
FT                   AEIRRYLDMGLDGFFTDDPAIGRKAVDRI"
FT   CDS             complement(81096..81971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40690"
FT                   /product="drug/metabolite transporter (DMT) integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00856"
FT                   /db_xref="GOA:C7JIC9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC9"
FT                   /protein_id="BAI00856.1"
FT                   /translation="MAAFLFFAVVLIWGTTWYAIHMQVAVTDANTAIFWRFLVASALLA
FT                   AWLKLSGKWKAVPRQDIPLLALLGATMFSCNYMFMYRAEQSISSGTVSVVFSLAVIFNM
FT                   LNQWLFFRIRPALHGIVGGVLAVAGVALMMGVTGASLTEIDGIALALGGTACFSIGNMI
FT                   SRHLLLKGLDLPTVVCRGMMWGCGFTGAWLLLTGHGLAGSWQPGWVASLLYLAVPGSII
FT                   GFVAYLRLVHVIGADRAAYTTILSPVVALVISSMAENSVWSASMGAGIALVLVGNLVSF
FT                   FPWHKLKPRA"
FT   CDS             82164..83054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="APA01_40700"
FT                   /product="transcriptional regulator AraC"
FT                   /note="Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00857"
FT                   /db_xref="GOA:C7JID0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID0"
FT                   /protein_id="BAI00857.1"
FT                   /translation="MSALSRFTIRNYLHGRSVPAVAEVELGAGLAMVIWDRDERTCTTY
FT                   ETPNHHTLSLYLEHGDKLRKRTASGWQNSHGAGDFCLMPHNVSTEWDVQGPIRMFHFYI
FT                   APQTFDRAAHEIFDMDPDRVRLGHDAYFRNPRLERQIRTCMINLCWQPPENRLTLGQQA
FT                   QTLLHHVLKQCSTRLVNAPQRGGLSPANLRRVDEYVRQALDQPLGVEDLAAVVGVSPYH
FT                   FIRSFRQSSGETPHAFVLRRRLEYAAFLLKTGEPASTVAHACGFSSHSHLSARFRQFMG
FT                   VTPTEYALWAGPRQI"
FT   CDS             complement(83295..83687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="APA01_40710"
FT                   /product="integral membrane protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00858"
FT                   /db_xref="GOA:C7JID1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID1"
FT                   /protein_id="BAI00858.1"
FT                   /translation="MGTLARYVVSVLTGPYSRMMPWGTIIAVNMVGSFIIAFFGTLTLA
FT                   DGRYAVSENMRLFVMIGLCGGYTTFSSFSLQTLDLLRIGAWGRAMLTVGLSVVLCVGAA
FT                   SLGHILASRLNHHTMLVAQADIEEEV"
FT   CDS             complement(83651..84049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40720"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00859"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID2"
FT                   /protein_id="BAI00859.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKAVPWARWPATLCPC"
FT   CDS             84836..85597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40730"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00860"
FT                   /db_xref="GOA:C7JI94"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI94"
FT                   /protein_id="BAI00860.1"
FT                   /translation="MPDAESVLFGFALRQTTGFVESLLRLAVLSWSVPDFSTLSRRQKS
FT                   LTVDIPYRSSGGPLHLLIDSTGIKVEGEGEWHTRKHGASKHRIWRKLHIAIDEGSLEIR
FT                   AVEITKNDVGDAPVLPALLEQIPDEEDIACVTADGAYDTRKCHETIANRGAQAVIPPRK
FT                   NAKPWCPTSPGAIARNEALRTCGHLGRAIWRRWSGYHRRSRVETKMHCIKLLGQRLTAR
FT                   DFDRQITEVHIRVAILNRFTALGIPLTHAVA"
FT   CDS             86138..86752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00861"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID4"
FT                   /protein_id="BAI00861.1"
FT                   /translation="MQHGVNPSCDAVSTWEDTGIQGEHLKLEETSTSVVTFRTPSSPEV
FT                   RARYRQIAQDGEGDVPHPRFGDGWRLRVDILSEDGSIVDGSVFFRLFRGPEQIVRPYLL
FT                   GLMTWDEDMRLGALITASLLGSLGYAQGKINPTEKPKEIKKSGILPQLITLISNTPHGP
FT                   RPSEDPHMMELIHEIAAVLMQEVKRRVGEIAPPPPMVKFCL"
FT   CDS             87186..87821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00862"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID5"
FT                   /protein_id="BAI00862.1"
FT                   /translation="MTTKKTSRTKKPVVSKAPEDPARHRYTEEEMDALIDKAWPEEKVE
FT                   AYFRAEREDAPIPVVHDFAVMRPQTARLAKALADMFPGQFKGVEIGAWPPINAEDGMID
FT                   VIYLGESWIVQLGYDGYEPSRLGFVNATCDGLDYEEALEIDCGLYQQEGFDTYEAAFPL
FT                   TDEDREEFIDYMQRNFNRPAEKVILVREDDREANQANGDKVVPFRKPS"
FT   CDS             complement(88925..90310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40760"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00863"
FT                   /db_xref="GOA:C7JID6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID6"
FT                   /protein_id="BAI00863.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPAFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHERAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(90327..90734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40770"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00864"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID7"
FT                   /protein_id="BAI00864.1"
FT                   /translation="MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAY
FT                   SDRSKGGRPPFDPVLMFKILVIQTLNNLSDDRTEYLINDRLSFMRFLGLGLSDRVPDAK
FT                   TIWLFRRGNLTEGLYIGLDYEKVCFVEKKFP"
FT   CDS             91584..91916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="APA01_40780"
FT                   /product="transcriptional regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00865"
FT                   /db_xref="GOA:C7JID8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR031848"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID8"
FT                   /protein_id="BAI00865.1"
FT                   /translation="MVDLLKAESTITAKGQTTIPKSVRKALGVDYGGRIAFVVDDQRRV
FT                   HVEKATEETSDPVVERFLEFLEKDMLDHSRSRLVNLPASLPDRVAALVGNMDVDLDDEI
FT                   EGDVAL"
FT   CDS             91919..92410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00866"
FT                   /db_xref="GOA:C7JID9"
FT                   /db_xref="InterPro:IPR021679"
FT                   /db_xref="UniProtKB/TrEMBL:C7JID9"
FT                   /protein_id="BAI00866.1"
FT                   /translation="MLTINGWTILAHPLFLDQLEKLIGAVEELKEKKPHEYQKKPSTKL
FT                   LAALNKLIFQSIPADPTATVYRQGGTLGEAHKHWFRAKFGNGRFRLFFRYSSAEKIIIF
FT                   AWVNDETKLRTYGSRTDAYKVFKAMLQKGNPPDDWDALCAAASDQATVDRLGKSSPPNS
FT                   "
FT   CDS             complement(92845..93117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00867"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE0"
FT                   /protein_id="BAI00867.1"
FT                   /translation="MSRHWSSDPYFVDALDKYTALRNAGQKTLELDLDAIEEVISNRDG
FT                   PAYRLFDAMVNIKETEGDEGYRGAPRILLAILEHLGEISKQKQTD"
FT   CDS             93491..94876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40810"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00868"
FT                   /db_xref="GOA:C7JC03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC03"
FT                   /protein_id="BAI00868.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             95288..95713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40820"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00869"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE2"
FT                   /protein_id="BAI00869.1"
FT                   /translation="MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFW
FT                   RHENGAKWRSIPAELGPWWRAAQLFIRWAKLGVWERLLALVQEQQGVAFGMTFLDGTNI
FT                   RAHHKAAGAQKKGPLSKSETIVKHLAALAVAMAQKSA"
FT   CDS             95476..96084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40830"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00870"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE3"
FT                   /protein_id="BAI00870.1"
FT                   /translation="MAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQGSP
FT                   QSGGSPKKGASFEERDHREALGRSRGGYGTKVCVIADGHGKAFGFALAPGQAHELPLAP
FT                   AMLDSLPATPLWVVADKGYASNAMRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLV
FT                   ENLWARLKEWRAVATRYEKTATSFLAVIHIAAAADWIKP"
FT   CDS             complement(96439..97812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="APA01_40840"
FT                   /product="transporter of manganese MntH"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00871"
FT                   /db_xref="GOA:C7JIE4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE4"
FT                   /protein_id="BAI00871.1"
FT                   /translation="MTQDSHSSVSPLPPQKSAWRFAKTGDADSQSLPEVFASIKLPAAG
FT                   TPWFKRFLAFIGPGYMVSVGYMDPGNWATDLQGGAQFGYTLLAVIMLSNLMAILLQALS
FT                   ARLGIATGRDLAQACRDHFPPAINIVLWLACELAIIACDLAEVIGTAVALQLLFGIPLL
FT                   GGAIISVLDAFIVLFLMNRGFRYLEAFVIGLLSIIAICFGVQIVAAAPPVAEVLKGFIP
FT                   SPEIITNSQMLYIAIGIIGATVMPHNLYLHSAIVQTRAFEHTLPGRKEAIRWATWDSTI
FT                   ALMLALFINAAILIVAAAAFHTTGHQNVAEIEDAYRLLSPILGLGIASTLFAVALLAAG
FT                   TNSTVTGTLAGQIIMEGFLRLRIPHWMRRLLTRGLAIIPVIVVTALYGSKGVGELLMLS
FT                   QVILSMQLPFAVIPLVMFVSDRRKMGELAISRKITILAWGVATVILILNFKLLYDTLF"
FT   CDS             97998..98513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntR"
FT                   /locus_tag="APA01_40860"
FT                   /product="transcriptional regulator MntR"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00872"
FT                   /db_xref="GOA:C7JIE5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE5"
FT                   /protein_id="BAI00872.1"
FT                   /translation="MDMQQRFDTVDTLPDAQTHSEGFRVSREARQHALIEDYVELIADL
FT                   LDEGQEARQVDLAIRLGVSQPTVAKMLMRLGDEGLVVRKPYRGIFLTPEGRELAEKVRA
FT                   RHRTVEAFLLALGVSPCNARIDAEGLEHYVGAETLKAFQLAIDADLGNFMQKARKNKGA
FT                   SSLNIRRF"
FT   CDS             complement(98500..100230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40850"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00873"
FT                   /db_xref="GOA:C7JIE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE6"
FT                   /protein_id="BAI00873.1"
FT                   /translation="MKQLFQMMGDLWFLSRPYFSSEDRKKAWLLIIAVLGLTLLMVGLD
FT                   VWQSFSRNIYYTALQQKDLSTFLRGLFWYSHTFEGFVPGFFLIAIPALLAGVYATYLQQ
FT                   LLQLRWRTWMTRSMSQQWLHQNTAFLIAMQAANMNISADNPDQRIQEDIDRFAADTLTQ
FT                   FTSLFSNLITLVSYIGLLWVLSGPLVIFGLRIPGYFLWVALIYSIIATIITHFCGRKLI
FT                   NLQTQQQKVEADFRYALVHIRNHAASIALTGGSKREQGALTSRFTAVYDNFFLIMKRSK
FT                   WLGLLTSGLEVLSGNFALLVGSVRYFAGKISFGTLMQLVLAFSRVQGALGWIASSYSSL
FT                   AEWRANVIRLAMFQRMMVRAKEYEQTIERQTIPDLSDMILQNVDVFKPDGSILLQNVSL
FT                   TLPHGQSIALAGPSGIGKSTLLRVMANIWPFASGCIHQPQLRMMFMPQRPYLPLGNLKQ
FT                   ILCYPLEAENYDDTVLQQILRQIGLPQLAPRLKDEEVWEQTLSSGEQQRLMFGRILLNK
FT                   PDWVFLDEATSNLDETAENILYAHLRQSLPNITIVSVTHKPSLQAQHNLIIDISRFKSA
FT                   "
FT   CDS             100781..102373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprB"
FT                   /locus_tag="APA01_40870"
FT                   /product="porin B carbohydrate-selective OprB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00874"
FT                   /db_xref="GOA:C7JIE7"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE7"
FT                   /protein_id="BAI00874.1"
FT                   /translation="MPDLTNKIWKKFPYSLHCLLLVAGVWGTLPTFAHGEETQIEEDRR
FT                   RLGNSGPLIEQIDPATVRDSQRASEDAAAEKKGDDTPDMSDHLLGNMWGARDWMAKHGI
FT                   SFDIQEVDELWGNTTGGTASRADGASGSGTGPAYDGVTMPTLTVDLEKLIGLKGGTFNV
FT                   RALQLRGRSISQDHLANFNHVSGFEADRSTRLFELWYQQSFLDGKLDVKIGQQNLETEF
FT                   LVSDYGALYLNSNFGWPMAPSVNLYAGGPSWPLSSPAIRIRYRPSDKFTFMFAAADDNP
FT                   PGNRNNSFGIQNGGNSADPTNQNTNDEDGANFNMGTGALLITELQYALNPQPDDMSHVT
FT                   KDPGLPGIYKLGGYYDTAKFPDYRYNNQGKALGSAADTTGIPRWDRGNWMVYGIIDQMI
FT                   WRPSLQSPQSVGVFARATGNGGDRNMISFAIDAGINLKAPFKGRDNDTVGLGWGIGRAS
FT                   SGQRRYDRNSGAPVQGNENHLELTYQAQVMPWWVMQPDFQYVWHPSGGVTDWTGNRLVG
FT                   NEAIFGLHSNITF"
FT   CDS             102519..102737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00875"
FT                   /db_xref="GOA:C7JG66"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:C7JG66"
FT                   /protein_id="BAI00875.1"
FT                   /translation="MNTSVHTAMPVAAAGQSIPVRAILPWAVFGLIVSALLIYFVGAEQ
FT                   GATSLISGHAVHEFVHDGRHLLGFPCH"
FT   CDS             102761..103495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00876"
FT                   /db_xref="GOA:C7JIE9"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIE9"
FT                   /protein_id="BAI00876.1"
FT                   /translation="MVGRLLARGMVAGILAALLSFVFAKIFGEPQVALAIAFEAAQDAA
FT                   AGAAPEPEIVSRGVQASWGLLTAVLMYGAAYGGIFAIVFAFAYQRLAALSPRSMALLLA
FT                   GVGFLTFVLIPDLKYPPNPPAVGQEETIGLRTEMYFAMVGLAVAVSMISLLVGRALSHV
FT                   IGYWNGVVCSIVLGIALVAAAQFGLPDINEVPDNFPAVVLWRFREASIGMQIVLWSVLG
FT                   LVFGALAEKCLPEANGMARKVA"
FT   CDS             104298..104675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00877"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF0"
FT                   /protein_id="BAI00877.1"
FT                   /translation="MLAPDRTCISKFFGPEYFLPVEVQLQQNGYDLFECMITGLPVHHQ
FT                   ARGDYLEAHFRPLLDATLDMVMALQHVSACTSGTEYVQTYIAVQNLIGAQKAAMAMYCS
FT                   TYNYEKNLLNRECSLKIFSYA"
FT   CDS             105426..105785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00878"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF1"
FT                   /protein_id="BAI00878.1"
FT                   /translation="MTQQEKKPSNHRELSVGELVHIATTVCRGEQQVVWSDYSILTRQR
FT                   LMTTIWDLTRNGSVEKYNHLTISEHEEKNIINKLDGLYLLNNKKILDFIRMFLGFISPL
FT                   HALHYRNEIIKILSY"
FT   CDS             complement(105936..106826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40920"
FT                   /product="ring-hydroxylating dioxygenase ferredoxin
FT                   subunit"
FT                   /note="Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00879"
FT                   /db_xref="GOA:C7JIF2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF2"
FT                   /protein_id="BAI00879.1"
FT                   /translation="MLLGKGDVHNNLITCMAHGIAFNHEGQSVAPNAQPGATCLKLKTW
FT                   ACQEKDGLLFVFMGDQTLANTIPLPDFPRISDRHYRTRRFGQVVNCHYSFMHENLMDMN
FT                   HQVLHSKLVGKMKPRFLGMESGESFVEARYTFARTGGKQPISEALIYGQRRRDGRDFAY
FT                   RDIMTIRTQYPYQTLRIETQGIDEPVMELWISYVPQDSEELTNRVFGLLSIRRLKVPLL
FT                   LDLAWPLLIAFTERVFFEDREIVELEQRAWKDLGGDHNAEVFPVILALRQLLRARGISP
FT                   DTGGLNHDTQKRASS"
FT   CDS             complement(106863..107276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40930"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00880"
FT                   /db_xref="GOA:C7JIF3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF3"
FT                   /protein_id="BAI00880.1"
FT                   /translation="MIWRTKGGMNTKLHAVTDRNGRPLDFFMTAGQISDYTGAAALLDS
FT                   LPPAEWMLADRGYDADWFREALEEKGIKPCLPGRKSRAKPVKYDKRKYKRRHRIEIMFG
FT                   RLKDWRRVATRYDRCPTVFFSAVCLAATVLFWL"
FT   CDS             complement(107273..107620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40940"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00881"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF4"
FT                   /protein_id="BAI00881.1"
FT                   /translation="MSDLYWLTEEQMDRLRPFFPKSHGKPRVDDRRVLSGIIFVNRNGL
FT                   RWRDAPREYGPHKTLYNRWKRWSAMGVFIRMMEGLATGKAEPQTIMIDATYLKAHRTAS
FT                   SLRLKKGAQAV"
FT   CDS             complement(107800..109050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40950"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00882"
FT                   /db_xref="GOA:C7JB26"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JB26"
FT                   /protein_id="BAI00882.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTQLR
FT                   TRQSLSAGPFRRSGASS"
FT   CDS             complement(109215..109883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40960"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00883"
FT                   /db_xref="GOA:C7JIF6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF6"
FT                   /protein_id="BAI00883.1"
FT                   /translation="MINAVRYLVRSGCGWRMLPIHFGHWRTVYGWFRELARRFLFQTIH
FT                   DVELMLDRERSGREASPSAGVIDSQSIKAPHAKTRGYDAGKKIVGRKRHIAVDTDGRLL
FT                   MVNLTPADISDSAGAQMILDAIRKRWPWVKHLFADGAYDRLQLMDKAAYLDFVVEVIRR
FT                   RDGAKGFEVLPRRWVVERTFGWMTRWRRLVRDYERRIDVSQAMIFVAMGANLTRRNAHP
FT                   "
FT   CDS             complement(109954..110844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40970"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00884"
FT                   /db_xref="GOA:C7JIF7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF7"
FT                   /protein_id="BAI00884.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNNNFCVYGARKVWHQLKREGVDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVGWRV
FT                   SSTAHTDFVLDALEQALCQRQPEGKVPHHSDRGCQYVSIRYTQRLAEAGLVASVGSVGD
FT                   SYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNIPPAEA
FT                   EARFYAQQKSHALAA"
FT   CDS             complement(110841..111164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40980"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00885"
FT                   /db_xref="GOA:C7JIF8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF8"
FT                   /protein_id="BAI00885.1"
FT                   /translation="MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHP
FT                   DTLSKWTRLHERANAPAVSDLPDREKIRQLERENRELRQANEILRKASAYFAQAELDRI
FT                   FKP"
FT   CDS             111532..112488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_40990"
FT                   /product="arylesterase"
FT                   /note="Lipase/thioesterase/hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_40990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00886"
FT                   /db_xref="GOA:C7JIF9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF9"
FT                   /protein_id="BAI00886.1"
FT                   /translation="MPKSVVNPEFLPILEKMPSFDGLSSLSLPEVREVFLTSVRLIEGR
FT                   PLPDVITREEYVPGLNNAPDVRVVVYTPREVQPNAPAMVYIHGGGLVSGHPEVDDPKCQ
FT                   KLASDLGFQIFSVDYRLAPEVKYPGAIEDCYAVLKWVHENARKLGISRDKVVVAGESAG
FT                   GGLSAALSLMARDKKEYKLAFQLLIYPMLDDRTAINSDPGANFGEFVWTRSANKYAWQA
FT                   YLGDKAGGPQTPPYAAAGRATDLAGLPPTFIGVGSMDLFLKEDLDYATRLMAAAVPTEV
FT                   MVVPGAYHVFDMYVPDAELSRRFMDAYCAALKRTLNL"
FT   CDS             complement(112540..112782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00887"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG0"
FT                   /protein_id="BAI00887.1"
FT                   /translation="MFQPTDLGDCEDIGSVAQNIFVDAYKDLALIAAGKSGGRLPFSAS
FT                   AQRMIISAQSCALQLRKAASEAVSTREMASCRGGG"
FT   CDS             112891..113970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41010"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00888"
FT                   /db_xref="GOA:C7JC89"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC89"
FT                   /protein_id="BAI00888.1"
FT                   /translation="MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAY
FT                   SDRSKGGRPPFDPVLMFKILVIQTLNNLSDDRTEYLINDRLSFMRFLGLGLSDRVPDAK
FT                   TIWLFRERLTEAGAIQQLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTNGEKEDL
FT                   REGRIPQDWQDKPAKLSHKDRHARWTLKFTKAKRQEDGTLPATDLAIPFFGYKSHVSID
FT                   RKFRLIRKWKTTDAAASDGARLREGLLDKTNTASTVWADTAYRSKANEDFMEKEGFVSK
FT                   IHRKKPHFKPMPRHIQKSNAGKSVIRSRVEHVFADQKSQTGLFVRTVGITRATMRIGLA
FT                   NIVYNMRRFLFLERLNAGT"
FT   CDS             113979..114314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00889"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG2"
FT                   /protein_id="BAI00889.1"
FT                   /translation="MAILPGLLKSQSKNQDKEPEITHKSTQSKVFRTLHLFSKSIFSMS
FT                   NQFLVKQDPHLLAHEALLQIRDALLPALQGVRDGKNHHVDGIILLTEGLVKDLDAACDA
FT                   LDAASRS"
FT   CDS             114611..117325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3"
FT                   /locus_tag="APA01_41030"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="CRISPR: Clustered regularly interspaced short
FT                   palindromic repeats"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00890"
FT                   /db_xref="GOA:C7JIG3"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG3"
FT                   /protein_id="BAI00890.1"
FT                   /translation="MPDTVEDNSLNFFWGKARPVAEAEEVISSMHPLIAHMLDVAAVAI
FT                   LLPESKCLGLDCRQLGMLIALHDIGKLTPAFQSKVPECWPEQAFGRCPDEVVMSRHDAD
FT                   GLFLLDHICKDQLAPLFGTNADGLDWSPTDKKQLWRAVAGHHGQPVSSDENKFQNADLK
FT                   LLAPYAHKLVRVLLDIFRPPPIPSYSFLEDLLQLEWRLAGLTVQADWIGSRQEWFPYVR
FT                   PEDVADASGYFWNHALHRAQAAIASAGLSPANISPFQGMARLFPHICNSSPIQALLEVA
FT                   SFPADPTLIVIEDMTGSGKTEAALVAAHRLMASGHASGLFVALPTMATANAMFDRLAIA
FT                   YRSLFQPSSHPSLALAHGRALLDERFVSVLAPDDALDNTTVKKGRDDAAEVCCSAWLGS
FT                   ESRRALLAQVGVGTIDQALMAVLPVRFATVRQAGLAGKVLLVDECHAYDPYMQEEMVAL
FT                   LRFHAAMGGSAILLSATLTKSVRQKLVTAFREGLRQKESVGLSCMAYPLVTLVGRDGAE
FT                   ELPCAPRPGLARNIAVRQMSDASSIMAYVSDAAAQGAAVAWVRNTVDDVITSAKALEAE
FT                   GLDVMVFHARFAMVDRLAIEREVLARFGKNGTTADRSRVLIASQVIEQSLDLDFDVLCT
FT                   DLAPMDLIIQRAGRLRRHERAQRPVDCDEICIFSPNPVADPDPQWISRVLPGTAAVYRD
FT                   PALLWRTAKVLQCKGQIRSPDMIRELIEEAADTSDVPNGLMMASDEAEGKGRAARGAAI
FT                   RNILNYDAGYTPDSALWEREVRISTRLEERPYVTVRLGVMKDGQVWPWAALQQTSLAVP
FT                   HERKRAWTLSEVSVAQHTLAACPVADTQMEAVAAARAEWSRWEREAEDQFLLLLLHETE
FT                   EGWKGFGFNGKGQDVDICYDKKYGFQISKRNLA"
FT   CDS             117387..119042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00891"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG4"
FT                   /protein_id="BAI00891.1"
FT                   /translation="MAHGSLNLISDAWLPVRHKSGASSIIRPAQIVEGFEEDPIVGFDW
FT                   PRADFRIASFEFLIGLVATACPPTNRRMLRQNWCNPPSVEKLDEAFARIADAFWLDGPG
FT                   PRFLQDYEDLQSGQELVERLLIDAPGESTVKRNADLFVHHGQVGRLGRAAAAMALFTLQ
FT                   SWAPSGGAGNMTGLRGGGPLTTLVLPSENARLWEIIWVNVPDGEAVKSNDMEKVFPWMA
FT                   PTILSGKGGTDVRPTENAHPLQCWWGMPRRIRLDFENVAEGYCDLTGQKDEVLVSGWRQ
FT                   RPYGPKYAGWIGTPYGSGAVIHPLTPRYRQKEGTEWLAVHPQPGGIGYRHWAGIVAQSA
FT                   DKNRLPASCVANWRNERAGEIGLPENARLLTAGFDMDNMKARSFVESEMPLPGSLDTEL
FT                   QKALDALALQCVSAAVHVADILRGSVREALFGKGTVSVDVTLLSNVRERFWAKTENSFF
FT                   AILQDATGTDDEGMVALRKSWLHILAQSALGEFDATVILEPDTGITEAQRSALARRRLG
FT                   AAVSGMGKEGKKIRSELGLPELVKKKQKIAEKVS"
FT   CDS             119042..119602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00892"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG5"
FT                   /protein_id="BAI00892.1"
FT                   /translation="MLLSNKEAIRQVVNWWHGLQPDPERKQFGDRATLARLRRCATVTE
FT                   ALFEPQTQALVHKCGAKKDSELSRLALVAAVLAHVRANKTGACMARLIGPSDTSDSATA
FT                   LCKPVRFRRLLDMETYDDCLRSFRRLVVMAGEPLDVADLARSVIMWPREDTWDDLAGDQ
FT                   VRRQWVYNYWNAGIPENSSEKHN"
FT   CDS             119623..120681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41060"
FT                   /product="CRISPR-associated protein Cse4"
FT                   /note="CRISPR: Clustered regularly interspaced short
FT                   palindromic repeats"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00893"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG6"
FT                   /protein_id="BAI00893.1"
FT                   /translation="MSRFLQLHLLTFYPPSNVNRDDTGNPKTATVGGVTRLRISSQALK
FT                   RAWRTSDIFSSALAGHMGQRTQRLGEEILGYLRDKNVEEKKAVAIAREVAGVYGKVKSE
FT                   KDKNPARTEQLVFISPSERDAALAMADRLAAGEKVDLKKEQDTLLHRADSAADIALFGR
FT                   MLASAPSFNREAAVQVAHAITTHRVTVEDDYYTAIDDLKQDEEDAGAGFLGEAGFGSGV
FT                   FYLYLCINRDLLKKNLGEHGETGVAEAALGALAEAAMTVSPSGKQNSFAALARAGYVLA
FT                   EKGNSQPRTLAGAFARPVGGTDLMEHSVKALKEFREELARVYGAGVDETCEMILGDKKS
FT                   ATLADIVAFCRS"
FT   CDS             120687..121466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41070"
FT                   /product="CRISPR-associated protein Cas5"
FT                   /note="CRISPR: Clustered regularly interspaced short
FT                   palindromic repeats"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00894"
FT                   /db_xref="GOA:C7JIG7"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG7"
FT                   /protein_id="BAI00894.1"
FT                   /translation="MGHFLTFAMVAPMASFGTLSVGERRDGEDRPARSAVLGLVGACLG
FT                   ITRKDVSGQNALAEEYGLAVLCHASGHVLTDYHTAQTAPSRRNWRPTTRAQELADAPGE
FT                   LATILSRRDYRIGSWYLGAIWVRGSTSHWSLAEVRDAMQHPVFTPSLGRKACPLGLPLA
FT                   PELAESECAVSALLARQTNGPESQVHNRSGLFRNQLSKRNTPTETLVVMDIADVAEQGG
FT                   GHTIIRREMRRDQPLSRARWQFGLREEALLLCKRETA"
FT   CDS             121466..122155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41080"
FT                   /product="CRISPR-associated protein Cse3"
FT                   /note="CRISPR: Clustered regularly interspaced short
FT                   palindromic repeats"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00895"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG8"
FT                   /protein_id="BAI00895.1"
FT                   /translation="MTVGFLSRVALRRDASVQALAGLLVPQGEGRQHGAAHHLLWVLFG
FT                   DDSSRIRDFLWRQTEPGHFMILSARKPVDSHRLFEIESREFTPKLREGNRLRFLLRVNA
FT                   TVDRKVPGRKRSQRHDVVMDALYKLPAKERAAARESLVPTAMEAWLARQGHRTGFELKE
FT                   GKLAIESCDVLHIPRAQGQGKATFGVVDVTGELCVRTPDLFTQALMQGFGRARAFGCGL
FT                   MLVRRTI"
FT   CDS             122168..123127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="APA01_41090"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="CRISPR: Clustered regularly interspaced short
FT                   palindromic repeats"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00896"
FT                   /db_xref="GOA:C7JIG9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIG9"
FT                   /protein_id="BAI00896.1"
FT                   /translation="MSRPLPGLPPPRPIPLKERSSILFVAMGQLDVLDGAFVLVDQNGI
FT                   RTHIPIGGLACLMLEPGTRVSHAAAALAARAGTLLIWVGEAGVRLYASGQPGGARADRL
FT                   LLQARLALDDTGRLKVVRKMYALRFGEDAPERRSVDQLRGIEGARVRETYRLLAHSHGA
FT                   DWDGRRYDPHEWDTANVVNRCLSAATAALYGITEAAILAAGYAPAIGFLHTGKPQSFVY
FT                   DIADIVKFEVVVPEAFRVAAAVQRDRPLDGQRVTDPVAAVRHRCRDQFRKTKILGRLIP
FT                   LIEDVLAAGGTEAPSVQPEAMPVAFADPKGSGDVGHRG"
FT   CDS             123108..123449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41100"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="CRISPR: Clustered regularly interspaced short
FT                   palindromic repeats"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00897"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH0"
FT                   /protein_id="BAI00897.1"
FT                   /translation="MLVIVVENAPPRLRGRLAVWLLEVRAGVYIGSYGRRVREMIWGQV
FT                   CAYIENGNAVIAWAAPNDAGFEFDTCGKNRRVPVDLDGLRLVAFGPEAALPIHPGPTTT
FT                   MLPRRRGKG"
FT   CDS             complement(123562..124392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00898"
FT                   /protein_id="BAI00898.1"
FT                   /translation="MCGEHRRDGNIANGRGGSSPRVRGTRAVLYTTRRARRFIPACAGN
FT                   TPAGSAFVTDTPVHPRVCGEHSGGQEVRRSGGGSSPRVRGTLESLSDRPDARRFIPACA
FT                   GNTRRCTRKHATRAVHPRVCGEHYLPDMEGLSTAGSSPRVRGTRSEQVLAGRGRRFIPA
FT                   CAGNTRIVCITNSRPAVHPRVCGEHTVVFADGQTLNGSSPRVRGTPENGVWRRCRYRFI
FT                   PACAGNTLTMDLRHGERAVHPRVCGEHHDTFHSSICLGGSSPRVRGTRPPPLPP"
FT   CDS             complement(124969..125943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41120"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00899"
FT                   /db_xref="GOA:C7JIH2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH2"
FT                   /protein_id="BAI00899.1"
FT                   /translation="MEGSIMGQIRHGSATTTHAVRAAIQRSQASLAALSEEFGINPKTV
FT                   AKWRKRQSVEDQKTGPKEPRSTVLSETDEAMIVAFRRHTLLPLDDCLYALQASIPYLTR
FT                   SALHRCLQRHGISRLPDIERDKAKRQRFKRYPIGFFHLDIAEVQTAEGKLYLFVAIDRT
FT                   SKFAVTQLVEKADRKTAWEFLEHLLSIIPYRIHTILTDNGIQFADQPRNRNTAWSRPMR
FT                   FDMICEAHGIEHRLTKPNHPWTNGQVERMNRTIKEATVKRFHYDSHEQLRTHLNDFMAA
FT                   YNFGRRLKTLSGLTPYEYLCKIWTSEPERFIINPTHQTPGPNT"
FT   CDS             complement(125986..126366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00900"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH3"
FT                   /protein_id="BAI00900.1"
FT                   /translation="MVEMKDVLRSQKKKEILLIGFDGLDEVGKRLAAAFEGKKQEPRHT
FT                   FITLDLMWRTLTPRRQELLQVMSGRKPMSIRGLSKLIGRDVKATHGDIQVLLAAGLLEK
FT                   IGDKVVFPYDGFHVDYELKAVA"
FT   CDS             126948..127430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00901"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH4"
FT                   /protein_id="BAI00901.1"
FT                   /translation="MTVKNFPLSEPVLQALQTSLSPERFSTYLRASGGHQEKALRLYTR
FT                   NTALSAAFYGPLQGLEIAVRNALHRELTARFGPAWYDNRLTGLNPKAQDQILRAKRDVQ
FT                   REHRQADPPHVVASLSFGFWVALLGKGGNSNYEMILWRPALAKAFPHARLGRKQAH"
FT   CDS             complement(127468..128358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41150"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00902"
FT                   /db_xref="GOA:C7JIH5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH5"
FT                   /protein_id="BAI00902.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNNNFCVYGARKVWHQLRREGLDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVGWRV
FT                   SSTAHTDFVLDALEQALCQRQPEGKVTHHSDRGCQYVSIRYTQRLAEAGLVASVGSVGD
FT                   SYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNIPPAEA
FT                   EARFYAQQKSHALAA"
FT   CDS             complement(128355..128678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41160"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00903"
FT                   /db_xref="GOA:C7JIF8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF8"
FT                   /protein_id="BAI00903.1"
FT                   /translation="MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHP
FT                   DTLSKWTRLHERANAPAVSDLPDREKIRQLERENRELRQANEILRKASAYFAQAELDRI
FT                   FKP"
FT   CDS             complement(129076..129525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00904"
FT                   /db_xref="GOA:C7JIH7"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH7"
FT                   /protein_id="BAI00904.1"
FT                   /translation="MIKNIPGFEKISSIFDLFEEIAMLVLTLCIMVVAALGLIHVLYAV
FT                   FEMLRTATLSPTNPVVLQSLFGLFFTVLIALEFKHSILVSPDTPSHSMVRMRSVLLIGM
FT                   MATVRKFIVLDLSGLDVMEVLALSVAILALGIVYWLVRGNNKITS"
FT   CDS             129662..129892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41180"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00905"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIH8"
FT                   /protein_id="BAI00905.1"
FT                   /translation="MDPKSLFSLSDHLDALSKEGDPLEVLQETVDFEYFRAWLVEGLGY
FT                   GDGSKGGRPPFDPVMMFNADFSHLRQFRVIS"
FT   CDS             complement(130035..131420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41190"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00906"
FT                   /db_xref="GOA:C7JC03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC03"
FT                   /protein_id="BAI00906.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             131486..132067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41200"
FT                   /product="Sec-independent protein translocase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00907"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII0"
FT                   /protein_id="BAI00907.1"
FT                   /translation="MYNPSVRFPRPSLLGKIAIFACLTIFLLRWGRAGFALAQPFCQSH
FT                   QIDCTQHQAVKEAHIMSRLPLNEDGLATLVDAFYTRVRADPKLGPIFEDAVTNWPEHLQ
FT                   TLTAFWSSVMLGTGRYKGQPVPVHMQHRDRITPELFDRWLALWGETTSTHMPADVAAVL
FT                   QDKAANIARSLQLALSFYAKRAMLQRNTAP"
FT   CDS             132095..132394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00908"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII1"
FT                   /protein_id="BAI00908.1"
FT                   /translation="MTEALPYRSTPVFDQDTLPAALRTRHNTKAGVWGVIRVLEGELKL
FT                   TYLAPPSELLLTPATPGLIEPQQPHFVTPMGKVAMRVDFYDQPPPPSAFSAPQS"
FT   CDS             complement(132533..133348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41220"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00909"
FT                   /db_xref="GOA:C7JII2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII2"
FT                   /protein_id="BAI00909.1"
FT                   /translation="MRFLGLGLSDRVPDAKTVWLCQKRLTQAGAIDGLFNRFDATLRNA
FT                   GYLPMSGQILDATLVAAPKQRNTNAEKADLRAGRIPEDWQDKPAKLSHKDRHARWTLKF
FT                   TKAKRQDDGTMPSSDLAIPFFGYKSHVSIDRKYRFIRKWKTTHAAASDGARLREGLLDK
FT                   TNTASSVWADTAYRSKANEDFMEKQGFVSKVHRKKPHLKPMPRHIQKSNAGKSVIRSRV
FT                   EHVFADQKSQTGLFVRTVGISRATMRIGLANIVYNMRRLLFLERLNASA"
FT   CDS             complement(133406..134233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41230"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00910"
FT                   /db_xref="GOA:C7JII3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII3"
FT                   /protein_id="BAI00910.1"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYREQELNLRIKPRRRL
FT                   VREKPEKLSVPALPNRVWSMDFMADRLMDGRAFRLLNILDDFNREGLAIEGDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVPWAEKQGITLIYTQPGNSQQNASIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT   CDS             complement(134230..134493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41240"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00911"
FT                   /db_xref="GOA:C7JC92"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC92"
FT                   /protein_id="BAI00911.1"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT   CDS             134643..135005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00912"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII5"
FT                   /protein_id="BAI00912.1"
FT                   /translation="MKKRSDTKEQFKRRVSGQQEKDTPGVQQEGAYWLLGSNATQAGSL
FT                   HCDLWRGRAIDLALHDAIGVYPVTGWWKTHPGQKRFNDKGRYALVVSISAPGHNVDMHA
FT                   EISAIVAAKIASMVTS"
FT   CDS             135192..135479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_41260"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00913"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII6"
FT                   /protein_id="BAI00913.1"
FT                   /translation="MCIHARRLCMSAVTFRVDETLKAAAVKKLSAQGISLSDALRDTLA
FT                   YIAETGRSPVKRRLVTDEDAELIEIVRERLKNPAQKHRMTFAELKNRHRE"
FT   CDS             135476..135769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relEB"
FT                   /locus_tag="APA01_41270"
FT                   /product="translation repressor RelE/RelB/StbE"
FT                   /note="Toxin-antitoxin stability DNA-damage-inducible
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00914"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035095"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII7"
FT                   /protein_id="BAI00914.1"
FT                   /translation="MKEYCLEFDDRALREWDALDGSVRKKFEKKLEKLIWNPHSPGNEL
FT                   HRDLSGFYKIKLLKDGYRLVYQVIDERIVIYVIAVGRRADNEIYELASKRTE"
FT   CDS             complement(135971..136954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abi"
FT                   /locus_tag="APA01_41280"
FT                   /product="Abortive infection bacteriophage resistance
FT                   protein Abi"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00915"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII8"
FT                   /protein_id="BAI00915.1"
FT                   /translation="MFVTLTFCMSYNKPFLSVHDQVLLLQARGMDVGTVTHAETLLTQF
FT                   GYYRLSGYWHPMRKWKIVPDGTVYEDDFQQGSTLTQAIKLAKFDEDLRALFLRAVERIE
FT                   IGLRVRVALLLGQHGAMAHRDPKNLYPKFSSTPDPTTGVPPYTTWVNRVDEHEARSKEQ
FT                   FAVHMRSKYGLPFPLWVSIEVWDFGMMSRLVSGMTISDLYALGTQLGMSRQLVIPSWLR
FT                   AINHIRNICAHYSRLWNRSPADQPMPPKLGEDPILDHLATDSFAQTKLYAVAAVMQYLL
FT                   RTIDPAFATEWSNLLKAHFLTFPTKSPFVAEQSGFPEGWNTLLLWN"
FT   CDS             complement(137212..139011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41290"
FT                   /product="hypothetical protein"
FT                   /note="Myosin-cross-reactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00916"
FT                   /db_xref="GOA:C7JII9"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C7JII9"
FT                   /protein_id="BAI00916.1"
FT                   /translation="MRYAHSNYEAFVQPPAPQDMAGWSAWIVGGGLAGMAAAAFLIRDA
FT                   GMTPSAITILEASDSDGGALDGAGNAETGWLIRGGREMEEQFQCLWDLYRSIPSLEIPG
FT                   ASVLDEVWQVNQADPSTSPIRAMCNQGQPLADRDRLTLTGKARREIITLILTDEDELAG
FT                   KTIADVLSGDFMASNFWLFWRSMFAFETWHSAIEMKRYLARFVHQILGLKDLHTLKFTR
FT                   YNQQESLSQPLATWLADQGVVFRHGVKVTNVAVDVSGGKKVATHLDWLDNGASAGVDLG
FT                   PEELVFVTNGSMVENSRWGDHHTPAPIDTAIEEGSIWQLWRNIAAQDSAFGNPDVFCGD
FT                   TTKSRWLSATVTTRDARIPELVKRITGRDPFSGKIITGGPVTIADSSWLMSWVVSRQPH
FT                   FKGQPESQVVAWLYGLFSDVPGDYVKKPMQDCTGEEITREWLFHMGVPMDQIDDMAATG
FT                   ATTRPCMMPFITAQFMPRAPADRPNVVPDGSVNLAFLGQFTETPRDTVFTTEYSVRTAM
FT                   EAVYTLCGVRRAVPEVSGGIFDVRMLLQAAAELRDGEKVPASGLIRHLTHGTEIDDLLE
FT                   RYGLVWGGNGMSAYRWRSFTSSH"
FT   CDS             139174..139917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00917"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ0"
FT                   /protein_id="BAI00917.1"
FT                   /translation="MRQRARQGKAGQKPRQNQKKQTGPPAIQKGAGHAAQREGQHDGGM
FT                   QTQAFARTGPSGRVNRMEKPFQPVRQFQPHIGEHSCHMGGADTRPGNACDRGVLEPHEE
FT                   TQPVGQHRIPWLGRKQKIHSPQKPKQAGFQQNAPCVDRRQVVATARIDQQRGQGVRRLD
FT                   LLLHRVDSRIEAIRVATAMPVRDVKRLTRLLCEKIETIDPGFGIERMVLIASLAEPMDQ
FT                   RQTVSSLIAEEEVEGSKNRLSRFPR"
FT   CDS             complement(140239..140907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41310"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00918"
FT                   /db_xref="GOA:C7JIJ1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ1"
FT                   /protein_id="BAI00918.1"
FT                   /translation="MSGQILDATLVAAPKQRNTNGEKEDLREGRIPQDWQDKPAKLSHK
FT                   DRHARWTLKFTKAKRQEDGTLPATDLAIPFFGYKSHVSIDRKFRLIRKWKTTDAAASDG
FT                   ARLREGLLDKTNTASTVWADTAYRSKANEDFMEKEGFVSKIHRKKPHFKPMPRHIQKSN
FT                   AGKSVIRSRVEHVFADQKSQTGLFVRTVGITRATMRIGLANIVYNMRRFLFLERLNAGT
FT                   "
FT   CDS             complement(141137..142522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41320"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00919"
FT                   /db_xref="GOA:C7JIJ2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ2"
FT                   /protein_id="BAI00919.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYIFCGDHLLSATLRTADRDPGNEALAD
FT                   ISRIVEQIRNRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(142580..142987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41330"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00920"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ3"
FT                   /protein_id="BAI00920.1"
FT                   /translation="MKQSGFFDVEERLARLSGLGDQLEAFSRTVDFEAFRPDLEQALAY
FT                   SDRSKGGRPPFDPVLMFKILVIQTLNNLSDDRTEYLINDRLSFMRFLGLGLSDRVPDAK
FT                   TIWLFRERLTEAGAIQQLFDAEISQKGCTSG"
FT   CDS             complement(143119..144321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41340"
FT                   /product="porin O and P phosphate-selective"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00921"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ4"
FT                   /protein_id="BAI00921.1"
FT                   /translation="MWENKKFIFCILIVSNFSDSDAFAKTVKDIVVGKVIIHPFAQDQL
FT                   EVGSNIHGNQHSSPSASGPHIRNGVRINIANQVKIGAIWDFGAAPGGQMRLFEGAASYT
FT                   GLKHFQFSVGVFNPSFGLSSMQSRGDSIFPERASVATITRGLAAGANRQAVQALFYGNY
FT                   YHLAISGTAGTAGPGKDGNQRAIVFRSVILPIHTQEFLMHVGISGEWVFRPSHKNSMEE
FT                   GVSFSDTPENDDGLNDKYIKTGNIPAKSSGAFGLEGAVAWKKLLISSEYYNLIVNENKN
FT                   SRINRQNFYGWYITAAYTLVGKPRAWKPTSASFASPSCDQKVSTLCHAMGVIELATRFS
FT                   QMDLENSDVSGGKQNIWSVNINWYPLDIIRISLDYSHTKYYEKENYHNFDSILSMFQVY
FT                   F"
FT   CDS             144946..146331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41350"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00922"
FT                   /db_xref="GOA:C7JIC6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIC6"
FT                   /protein_id="BAI00922.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASDR
FT                   LSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(147042..149264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41360"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /note="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00923"
FT                   /db_xref="GOA:C7JIJ6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ6"
FT                   /protein_id="BAI00923.1"
FT                   /translation="MITLINPRRVPTWAWVIAAVYAAPTISAAQAQTTAAQGSARQSNT
FT                   ASGSSVVTLPRLDISTDEEEETSLSDAPLTASSPDASSQRMSRLSSPDVSSLFRNQPGF
FT                   SSYGGGRLANLPVLNGMADDRVATIVDGVRISPACPNHMNPALSYIDPDSVQTATSIAG
FT                   LTPVSSGGDSLGGTIDVERADPRFARKGKILVTGRGRGTYRSNGGAYGASGSVTVANHL
FT                   LSIRYTGSYDQSGNYRGGAGMGTVHSTNYLTYNHAVTVGLHKDNHLVAITVGQQDTPRE
FT                   GFANQYMDMTNNRSTFVNGKYTGSFDWGTFEARGYWQRITHAMDMLADKGGHSATTGMP
FT                   MNNDSRLAGYSLKATIPLGRFHTLKLGSGFDHVGLNDWWPPLQGSMMMGPDTYHNINNG
FT                   HRDRLGHYAEWEAHWTPRVSTLLGFRNDLIMMNTGNVAPYSWTGMMNMTDAMAARAFNA
FT                   RNRERTDVNFDVTAMARWKVTDSFTLEGGYARKSRAPNLYERYAWGRGTMSSSMIGWFG
FT                   DGNGYVGNVDLKSEIANTASVTLDWHDPTAANRWGLTVQPYYSYVRNYINVVQLSTFSN
FT                   GHHLLQFANHNAQTYGINASGHYTLWDTAQYGKGEVTGVLNWVRGQDEVTHSGLYHMMP
FT                   LNGTVAVHETVGHWTGRVEMNFVKPKDTVDWLRGEPRTAGYALLNLGGSYTWKMLTLDA
FT                   GIDNVLNQPYYLPLGGLSLGDTRYIGTTRALPGMGRSFNISLSATF"
FT   CDS             complement(149341..149871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00924"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ7"
FT                   /protein_id="BAI00924.1"
FT                   /translation="MARPSHSLHTLLKWPLVVVTLVGFLGLLALQSFAQPDELPRTTIV
FT                   RLLGMDIAASLSVPDDVLDATPAGAVFSGSTSSHTRQKGSGLTSPESAVGRAHHMAAAM
FT                   AGKSTQSHSGHHHRADGCPLCPLLSLPAALPMAVMLVSPPVLRWMRRGSHASTPRAPPS
FT                   VLLGLPPSCGPPA"
FT   CDS             149923..150102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00925"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ8"
FT                   /protein_id="BAI00925.1"
FT                   /translation="MGWGFALFVYWGLCVKRVTAAKVIFLIEGNGQRYKTTEKAHTDHA
FT                   ENGRKTGRHACKAA"
FT   CDS             150200..151192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41390"
FT                   /product="TonB periplasmic protein"
FT                   /note="Linking inner and outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00926"
FT                   /db_xref="GOA:C7JIJ9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIJ9"
FT                   /protein_id="BAI00926.1"
FT                   /translation="MKPHGRLGQDDGALTPDVRAPEICPPLAPPEGAVFSARQSRTSRV
FT                   WSLALLAAVAGHGVITACLLVTLHPRHPPEAPGQKAVEMVFESLASRPASTANPASVTP
FT                   PQEPQSVPAPSPEQAEPLSVPPAANLTHAAQPPEMTLPDEALASPLEAPVTPADAPPVP
FT                   PMTDILPPASVPAPVAAQKAASAHEHRPSAPSSPMLHKAAVPPPPKASPTSHSPEGATP
FT                   PAAQGSAAVQSAAASVAHVAKGSGARTLTCTPPQTHYPPMARHLHEEGEGVVEVTLAAD
FT                   GGIAATRLVQSTGYDDLDAQALAAARGLHCAAPASAPMVGRIPVGFHIR"
FT   CDS             151238..152488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41400"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00927"
FT                   /db_xref="GOA:C7JB26"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JB26"
FT                   /protein_id="BAI00927.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASMMIERSIEAGVPFRWVAADSVYGVGDVERTL
FT                   RRAGIGYVLGVKGNHWFGSWATEPLIAGEAKDIAAGLPDQAWRRLSAGHGTKGERLYDW
FT                   AYLPLADLDAEEFDCPIAGPWTRGLLIRRNIADGDLAYFTTWSPKGTTTQELVNVEGTR
FT                   WRIEEGFETAKNEFGLDHNETRSWHGWHRHVSLVMLAYAVMASVRYQANSLKPKKTQLR
FT                   TRQSLSAGPFRRSGASS"
FT   CDS             152851..153930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41410"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00928"
FT                   /db_xref="GOA:C7JIK1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK1"
FT                   /protein_id="BAI00928.1"
FT                   /translation="MKQPGFFDVEERLARLSGLGDQLEAFSRTVDFEVFRPDLELALAY
FT                   SDGSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINNRLSFMRFLGLGLSDRVPDAK
FT                   TVWLFRERLTQAGAIERLFDRFDATLRNAGYLPMSGQILDATLVAAPKQRNTNAEKADL
FT                   RAGRIPEDWQDKPAKMSHKDRHARWTLKFTKAKRQDDGTIPSSDLAIPFFGYKSHVSID
FT                   RKFRFIRKWKTTDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKEGFVSK
FT                   VHRKKPHLKPMPRHIQKSNAGKSVIRSRVEHVFADQKSQTGLFIRTVGITRATMRIGLA
FT                   NIVYNMRRFLFLERLNASA"
FT   CDS             complement(154458..154736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hu"
FT                   /locus_tag="APA01_41420"
FT                   /product="histone-like bacterial DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00929"
FT                   /db_xref="GOA:C7JIK2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK2"
FT                   /protein_id="BAI00929.1"
FT                   /translation="MNSQDLIERIVAATDIQKKDAKTALETVFAAITEAAVKGDDTTIA
FT                   GFGKFVVRQTAERKGRNPQTGAELVIPASRKLAYTPAKAVKDALRVE"
FT   CDS             complement(154943..155806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41430"
FT                   /product="transposase"
FT                   /note="Integrase core domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00930"
FT                   /db_xref="GOA:C7JIK3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK3"
FT                   /protein_id="BAI00930.1"
FT                   /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQKD
FT                   KELCDDIRRVWNNNFCVYGARKVWHQLRREGLDVARCTVERLMRRMGLKGVIRGKGVRT
FT                   TRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVGWRV
FT                   SSTAHTDFVLDALEQALCQRRPEGKVTHHSDRGCQYVSIRYTQRLAEAGLVASVGSVGD
FT                   SYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNIPPAEA
FT                   EARFYA"
FT   CDS             complement(155803..156126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41440"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00931"
FT                   /db_xref="GOA:C7JIF8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIF8"
FT                   /protein_id="BAI00931.1"
FT                   /translation="MSNKSKRFPPEFRDRAARMVLEEEKNHPSRWSAVMMIAPKLDIHP
FT                   DTLSKWTRLHERANAPAVSDLPDREKIRQLERENRELRQANEILRKASAYFAQAELDRI
FT                   FKP"
FT   CDS             156448..157263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00932"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK5"
FT                   /protein_id="BAI00932.1"
FT                   /translation="MLVKKRRSTLHRWKVLPALGCSFLIYPALAQTVNVPAGLPPTVNA
FT                   TYQEVGMGGWTPPTSSTTQQISGSGSVVSTTTTSSDSGTDALQSMYSQSWGYAAAQNAS
FT                   ALGVNPDALAATCVVESGCRNVYTANSNSSITGAFQMSNGTYNEALQKALASNPSLAST
FT                   ITNTGISGQQDPATQTVAAAQYLKDAATTLQNAGISNPTALDARAYYNFGPTAGQAIAR
FT                   ATDDTPMSEFVSASHMASNGISSNETVGQWRANVASKMGSAASSPILSS"
FT   CDS             157276..157680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00933"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK6"
FT                   /protein_id="BAI00933.1"
FT                   /translation="MFFRKLSFAAFAGMSLACVSSHALAAGPKPVKPLQGYKCLAIDAP
FT                   DSVMMDFNNPIPLRSAPNDHAPVIAPASAILAVNDPEQLDNGYVKSMNFAFKPGWVPTK
FT                   WLKEYSEVHPGNTCAPYIMNDGKLGFKFGH"
FT   CDS             complement(157737..158057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00934"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK7"
FT                   /protein_id="BAI00934.1"
FT                   /translation="MDRQHPCMTTSKNALSSDRPEIRLSGRRLFQCLMVLGWSERLAAE
FT                   RCDTHHTQLRRALAGTSALPPDISAWLLDLEAAFLARPSPRRRINDPIFREFVKEKSEF
FT                   QA"
FT   CDS             complement(158087..158287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00935"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK8"
FT                   /protein_id="BAI00935.1"
FT                   /translation="MNLARAIMIRKERKRQRREGASRREKLSVSPLLWDTLAADRQLQR
FT                   TWKAEGVPFWKRLLRAFLIQG"
FT   CDS             complement(158344..158673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41490"
FT                   /product="endoribonuclease"
FT                   /note="PemK-like protein, Toxin of the ChpA-ChpR
FT                   toxin-antitoxin system, growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00936"
FT                   /db_xref="GOA:C7JIK9"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIK9"
FT                   /protein_id="BAI00936.1"
FT                   /translation="MVAYVPDAGEIVWLDFSPQIGHEQAGHRPAVVLSSAAYNRIGLML
FT                   CCPLTTKLKGYPFEVAIDTDRPSAVLADQVKSFDWRARGAKSKGRVSEVELSEIRAKAR
FT                   ALIGR"
FT   CDS             complement(158675..158929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="APA01_41500"
FT                   /product="transcriptional regulator AbrB"
FT                   /note="ppGpp-regulated growth inhibitor
FT                   ChpR/MazE/SpoVT/PemI"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00937"
FT                   /db_xref="GOA:C7JIL0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL0"
FT                   /protein_id="BAI00937.1"
FT                   /translation="MEGAMKAVVKKWGNSASIRIPASVLAAAGLTLDQPVDVREESGRI
FT                   VIEPLTVVEYDLADLLAGITPENIHPEVDFGAPVGRELL"
FT   CDS             complement(159028..159336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrR"
FT                   /locus_tag="APA01_41510"
FT                   /product="transcriptional regulator NtrR/PilT"
FT                   /note="Nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00938"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL1"
FT                   /protein_id="BAI00938.1"
FT                   /translation="MSIYLLDTNIISDLVRNPSGSCAQRIEHIDPGDLCTSIIVAAELR
FT                   YGCAKKGSEKLLNRVESVLAFIPVLPLDIPADCEYGGIRAELEAAGQTIGMLEKLFA"
FT   CDS             complement(159333..159605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrP"
FT                   /locus_tag="APA01_41520"
FT                   /product="nitrogen regulatory protein NtrP"
FT                   /note="Toxin-antitoxin (TA) module"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00939"
FT                   /db_xref="GOA:C7JIL2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL2"
FT                   /protein_id="BAI00939.1"
FT                   /translation="MPVPEVTPRPREVKLFRNNRSQAVRIPVEFEMPGDRVLIRRDGDK
FT                   LVLEPVKTPSTLKELLMAWREEPQLPPEDDFPDIQDVAARPEDIL"
FT   CDS             complement(159935..160249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41530"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00940"
FT                   /db_xref="GOA:C7JIL3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL3"
FT                   /protein_id="BAI00940.1"
FT                   /translation="MEWRGRPEAIRMDNGPEYVSHTLVPWAEKQGITLIYTQPGNPQQN
FT                   ASIERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA
FT                   "
FT   CDS             160400..161785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41540"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00941"
FT                   /db_xref="GOA:C7JI99"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JI99"
FT                   /protein_id="BAI00941.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMDLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             162213..162368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41550"
FT                   /product="DNA resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00942"
FT                   /db_xref="GOA:C7JIL5"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL5"
FT                   /protein_id="BAI00942.1"
FT                   /translation="MGRPSLVTPSQRLEIIKKRKNGEKLEQIAKAFGISSGTVYRIASQ
FT                   ALKHNS"
FT   CDS             complement(162682..163455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00943"
FT                   /db_xref="GOA:C7JIL6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL6"
FT                   /protein_id="BAI00943.1"
FT                   /translation="MQFTFDTILFLISSAFVAGGIDALAGGGGLVTIPALMAAGIPPVS
FT                   ALATNKLQSTIGTSSAFLTFLRAGHVDIRQFVLPAIGAFLGALAGATVVQFVNPIFLSA
FT                   IVPLLLIGMAAYFLLAPPLSGEDRHARLGRMGITLCMTSIGFYDGFFGPGTGSFLTTVL
FT                   VAFAGLGLVRAIANTKFINLLTNVAGLTAMIVGGKVLWMLGFGMAGANILGNQVGAWLA
FT                   IRYGGKGIRPLLVIMSLALTVKLLANPDNPLWKMF"
FT   CDS             163647..164240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41570"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00944"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C7JES3"
FT                   /protein_id="BAI00944.1"
FT                   /translation="MIQDMMSGGTSVEETLELWARSLRSAKDRMAPLFTQKRVVDSACA
FT                   FLDVLIGNEPRKTGWMRAEAAGDPGPWRQQALLGRGHWDADALRDVVRDYVIEHLGTEE
FT                   GVLVIDETGFLKKGQASCGVGRQYTGSAGKITNCQIGVFGAYVSERGHAFIDRALYLPK
FT                   DWTSKPERLKRAHVPDDVVFATKPALASTRISHT"
FT   CDS             complement(164406..165791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41580"
FT                   /product="transposase"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00945"
FT                   /db_xref="GOA:C7JC03"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC03"
FT                   /protein_id="BAI00945.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             165942..166313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41590"
FT                   /product="oxidoreductase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00946"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIL9"
FT                   /protein_id="BAI00946.1"
FT                   /translation="MPLIANGGRIVNISSGLTRFAYPGWIAYAAMKGAVEVMTHYMAKE
FT                   LGPRRIAVNTVAPGAIQTDFSGGMVRDNPEIAHHIAEVTALGRPGLPDDIGPMIASLLS
FT                   EDNRWVNAQRIEVSGGQAI"
FT   CDS             complement(166354..168126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41600"
FT                   /product="acetyl-CoA synthetase"
FT                   /note="AMP-fatty acid ligase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00947"
FT                   /db_xref="GOA:C7JIM0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM0"
FT                   /protein_id="BAI00947.1"
FT                   /translation="MLPWTTYEAMYDAALNQPEEFWLSAAQRITWKQEPAMACRERTDG
FT                   WHDWFPDGTLNTCHNAVDRHVENGRGEQVALIWHSCATKEQQVVTYRELQDRVAGFAGG
FT                   LRLLGVEKGDCVLIAMPTMIETAIAMLACARIGAVHVVVFAGYAGPELARRIDDVAPKV
FT                   IIIASCSFQGQTPIPSAPALNDALALAAYRPQACVIVQRAACRTSLMPLRDHDFHTLEQ
FT                   STSVEAVVLRSEDPLYILHTSGTTGHAKGIVRDNGGHAVALALSMDVIYGCEPGDTFFT
FT                   TSDLGWVVGHSYGVYAPLISGCTSVIVEGGASASAIRTLCHEHGVKCLFTTPTQMRLMR
FT                   QESRHLSEVILPALARVFVAGEYADPTLLEWARSYFRTPVVNHWWQTETGWSITAHFFG
FT                   LPEREPVSLMNDIGRPAPGFRPAIVPSIPGEQCGEIVLSLPLPPGCLAGIWKNGAIRVP
FT                   SAYLDETRRYYRTFDEGMIQANRAVHMLGRSDDVIKVAGRRISGVQIEKIIATHPAVHA
FT                   CAVVAIPDELRGQRPIAYVVPDSEAECMPSSEEIVARINEVLGRWVGLKEVRFVGRLPT
FT                   TVSGKITRKRLLVS"
FT   CDS             complement(168141..169439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41610"
FT                   /product="flavin-containing monooxygenase"
FT                   /note="Flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00948"
FT                   /db_xref="GOA:C7JIM1"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR024000"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM1"
FT                   /protein_id="BAI00948.1"
FT                   /translation="MRRCASCLSDTETKRTTMTQNEKSIPVIIVGGGQAGLSLSWYLCR
FT                   EKVDHIVFESKTACHSWDDERWDNFCLVTPNWQCELPGHPYKGKDPHGFMVKQEIIEYV
FT                   KGFVNSFNPPLREHTAVTSITRHEAGGYRVVAGGETWHTKHVVIASGAYQDAVIPGYAS
FT                   AIDPSIFQVHSQDYRNAAQLPEGAVLVVGSGQSGAQIVEDLFLEKRKVHLCVGSAPRVS
FT                   RFYRGRDVVDWLADMHFYDLTVDNHPLREGARDKTNHYVTGRNGGHDLDLRLFAKEGVG
FT                   LHGTLETIRDEVAHFLPDLKQHLDDADKTNADIKKSIDAYIARENINAPTEAPYVPVWQ
FT                   PDGSNTPLDLKAAGITSIVWCIGFRPNYRWIDVPVFNGANKPVWHRGVTDAPGFYFLGL
FT                   PWLHTWGSGRFSGISRDAAWLASQITGKDVPIA"
FT   CDS             complement(169680..170858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41620"
FT                   /product="glycosyl transferase"
FT                   /note="Lipopolysaccharide biosynthesis,
FT                   Alpha-L-glycero-D-manno-heptose
FT                   alpha-1,3-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00949"
FT                   /db_xref="GOA:C7JIM2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023986"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM2"
FT                   /protein_id="BAI00949.1"
FT                   /translation="MSLSIGILTHSTNPRGGVVHGMALAETLCDAGHDATLIAPDVTGS
FT                   GFFRKPRCATWCIPAASVPDLPTLVERRIGEIRDALRGQHFDVLHAQDPISANALADLV
FT                   QEGRIPGFARTVHHLDHFTHPVLAARQERGIRAAAELFTVSTMWEDVLRNGHGREAPVV
FT                   GNGVDPVHFSPVATAHDAALRARYHLPAGQHLILSVGGIEQRKNTLHLLDAFLALRREQ
FT                   PDVHLIVAGGASLLDHSAYRTRFMARLRESGAADHVTITGPVADEDMPSFYRQADVLAY
FT                   PSVTEGFGLCPLEALACGIPVVVPAAPPFTEHFSATDALWCQPAHPDTLFIALRDALRV
FT                   ESRDHFRLSGPATARRFDWDSVASRHLPAYRRLAALQHADVPASGVLSPCPK"
FT   CDS             complement(170855..171826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41630"
FT                   /product="selenophosphate synthetase"
FT                   /note="Thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00950"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR024030"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM3"
FT                   /protein_id="BAI00950.1"
FT                   /translation="MMAHELTTLLRTLRMGRSLAAKQDIAEVSAILGTGAKAIRLGDDC
FT                   AAIPDGDGYLLLASEGFQDSFVRSMPWFAGYCGAMVNVSDIAAMGGRPVAVVDALWSDT
FT                   SEAAASILTGLHDGANTYGVPVVGGHTNMRSTHNSLSVAILGRARHLLTSFDAQPGEVL
FT                   IAAIDLRGRWHDPHPFWDASSGLCGTEGAARLRGDIELLPTIAEDGLSRAAKDISMAGL
FT                   LGTALMLAECSGIGMTIMLDDIPRPEDAPMERWLSAFPSYGYLLTARPEDAHAIMARFR
FT                   GRGITASVIGRCESTQRLDVIWADEKETFWDLARSSLMGFAP"
FT   CDS             complement(171823..172386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41640"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00951"
FT                   /db_xref="GOA:C7JIM4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024035"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM4"
FT                   /protein_id="BAI00951.1"
FT                   /translation="MSTILEGMEDRPFIPTEYVVRLARTPWERAGYHALRREVFCSEQH
FT                   VFAEDDRDAIDEDAIPIIAACCMAGMPDRIVGAVRIHEAEPGVWRGSRLAVHADHRKLG
FT                   RIGAELIRMAVSTAHGLGATRFLAQVQEQNVLFFRRLHWKSLGVITLHGLPHHDMEADL
FT                   SRYPAHGLDQTWLLRPQPRIRQVA"
FT   CDS             complement(172383..173492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /locus_tag="APA01_41650"
FT                   /product="iron-molybdenum cofactorbiosynthesis nitrogenase
FT                   NifB"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00952"
FT                   /db_xref="GOA:C7JIM5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM5"
FT                   /protein_id="BAI00952.1"
FT                   /translation="MTIPTLGTLSGRKLVTDLQSFGLQIGEQTGGIARKGGAGPSDHKT
FT                   ITIAGQTVMVPVYTSGAQHSPFQASPPDQHGTSMLLRDGRAVGTIYFPAAPRFYGLSTA
FT                   DGIPYWKIALLHGRDTLATTVHQTCIRYADRRTSCQFCAIGQSLEADRTIAYKTPAQLA
FT                   EVAKAAVELDGVRDMVLTTGTPNVVDRGAAVLAESARAIKAAVDLPLQVQCEPPRDHGW
FT                   FQRLREAGADSLGMHLEAATQAVREKIMPGKATVSVDRYMDAFASAVPIFGRGQVNTYI
FT                   LAGLGDSPEDILALAERLIALGVYPFVVPFVPISGTPLENHVPPSAEFMKSVLAPLGRM
FT                   LREANMKSTDIRAGCGRCGACSSLSAYEQ"
FT   CDS             complement(173489..174463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41660"
FT                   /product="nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00953"
FT                   /db_xref="GOA:C7JIM6"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023919"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM6"
FT                   /protein_id="BAI00953.1"
FT                   /translation="MSRIVRAAAIQISPVLGDDGLGTARKVCQAIREAAEKGVKLAVFP
FT                   ETFVPYYPYFSFIQPAFRFGGEHLELYERAVIIPGPVTDMVAETARDTGMVVVLGVNER
FT                   DFGTLYNTQIVFDATGEILLKRRKITPTYHERMIWGQGDESGLKVVESAAGRIGALACW
FT                   EHYNPLARYALMTQHEEIHCAQFPGSLVGQIFADQMEVTIRHHALESGCFVVNATGWLT
FT                   EDQIKDIARDPALEGPLRGGCFTAIVSPEGKLLAPPLTEGEGMVIADLDFALITKRKRM
FT                   MDSVGHYARPELLSLLQDRRPARTVHYVGEADPVSTSTDEAAS"
FT   CDS             complement(174488..174970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00954"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM7"
FT                   /protein_id="BAI00954.1"
FT                   /translation="MPKVEHAPYQDGDCFVNYENKVFEDVKAKPGEKALITFHTVANEG
FT                   SIGFVNLLQATRLIRKGFETSVLLYGPGVTLGVQRGFPRLGDEAFPGHMNCNKQIAKII
FT                   EEGGKVYACRFALQALYGYGEQNLIPGITPINPQDVLDIILLARRDNAFILNTWTL"
FT   CDS             complement(175311..176714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR/mocR"
FT                   /locus_tag="APA01_41680"
FT                   /product="transcriptional regulator MocR/GntR"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00955"
FT                   /db_xref="GOA:C7JIM8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM8"
FT                   /protein_id="BAI00955.1"
FT                   /translation="MSAYPYLAHWKEEISQSPNAIYLTLADALALSIRRGDLREGDKLP
FT                   PQRTIADYLGTNLTTVTRAFTEARRRGLIDATVGRGTFVRVGAGESHWRHTGPAVVDLT
FT                   MNLPPIPQDPPLQRIIQSDISAILKQQDLNSLMSYRVTGGTIEERQLGAKWIAPVIGHR
FT                   RIEEVLVSPGAQSALAAIVSTHTQPGDVIVTDRIAYPGIRTIAAQFDLILVGVDSDAEG
FT                   MMPDQLDRVCSQHHPRLLYCIPTIHNPTTATMSLQRRKDILAVAQRHHLHIAEDDPYSL
FT                   LMDEPLPALAALDHSRVSYIATLAKTLSPGLRTAYVALPNADMTRRVTAAIRAIALTNA
FT                   GLLSALTARWMQTGQAETILHAIRKELRLRQSIARKVLGEGHCMNPNGPHVWLKLPDWW
FT                   GSADFVAYARRRGLALVPSTVFTISGEPPQRARIALGSAPDAASLEESLNGVVSVLQHK
FT                   RSPGFADIV"
FT   CDS             177149..177772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00956"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIM9"
FT                   /protein_id="BAI00956.1"
FT                   /translation="MFPGGSGDIGLGKNGVIRHDHNFVVRTRRLWNRQGYAVIIPDTIN
FT                   HINLRGKRSSATYASLIQSIIAFAHEEATVPVFLFGTSQGAIAAVNGTAHAASGTIAGV
FT                   VLSESVSVMGGSKETVFSATPQKVTVPVLIVANQDDRCDVAPPQAAQQIASGMTASPEV
FT                   RVFMVSGGITKSKKNCGSLTPHGYFGIENDVVDKVSAWLDAKSR"
FT   CDS             complement(177776..178654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysR"
FT                   /locus_tag="APA01_41700"
FT                   /product="transcriptional regulator LysR"
FT                   /note="Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00957"
FT                   /db_xref="GOA:C7JIN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN0"
FT                   /protein_id="BAI00957.1"
FT                   /translation="MELRHLRYFVVLAEELHFTRAAERLNISPPTLTVQIQEIERTLSA
FT                   QLLNRTKRSVTLTSAGEVFLSEARRVLKQFATAENAGRRAGRGELGRIEIGYVASAAYT
FT                   GILQDQMNQFTQNYPDVLLKVREFPMDKLPQLVADGDVDIGFVRLPMAMPQLLSHHVLI
FT                   RDHFCLALSVIPGVEEKSEGPVTPHEIANASFILPEQAFGTFQVASRGGFTPRIVSTPG
FT                   SLLAVLTQVSIGNGISVIPSALRSVVNLPGVVFRDIVGEPIVSEIAAIFRSDEVAPAVR
FT                   HLISQIQTTIA"
FT   CDS             178846..180378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB/qacA"
FT                   /locus_tag="APA01_41710"
FT                   /product="multidrug resistance transporter EmrB/QacA"
FT                   /note="Major facilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00958"
FT                   /db_xref="GOA:C7JIN1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN1"
FT                   /protein_id="BAI00958.1"
FT                   /translation="MGTSMTSSRVTNPLFVLLAASTGCALTVLDTNVVAIILPTIAREF
FT                   RASFADIEWVISTYVLCFASLLLPAGAIADRYGRRRIYLIGITTFALTSLFCGAAPSAT
FT                   ALYLARALQGVSAAFLLAPALAIIGHTFHNPDERNRAWAIWGSIMGLTMVLAPIIGGII
FT                   AYALGWRWAFYINIPICVLLAGAVFILVKESRDTDARRLDPVGIIFFAAFMFGLTWGMI
FT                   NGQASGWTSWNALNGFIGGSISLGIFIASERAQSRPMLDLGLFSNPRFLGAVWAMFAYA
FT                   ASAQVMASMLPLFLQNGLGRSALQAGFAMLPFALAMLIFPHIGRLLERHISSSGILAGG
FT                   LSCVAIGNGITAWGAYVGSWIIVMAGMVVIGSGGGLLNGETQKAIMSVVPKERSGMASG
FT                   ISTTSRFSGILLGFAMLSGILATMVRKWVAAFGCGTGCHHPSDFADAIVAGDLPSAISG
FT                   LEGSNQEIAIQHAHHAFSYGFAVALLVASIFALGSSITVFTLMQSKMKQNIT"
FT   CDS             complement(180702..180830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41720"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00959"
FT                   /db_xref="UniProtKB/TrEMBL:C7JCB1"
FT                   /protein_id="BAI00959.1"
FT                   /translation="MLAYAVMASVRYQANSLKPKKTQLRTRQSLSAGPFRRSGASS"
FT   CDS             181008..182393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41730"
FT                   /product="transposase"
FT                   /note="IS4/IS1380"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00960"
FT                   /db_xref="GOA:C7JC93"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JC93"
FT                   /protein_id="BAI00960.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             182689..184074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41740"
FT                   /product="transposase"
FT                   /note="IS4/IS1380"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00961"
FT                   /db_xref="GOA:C7JBK8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7JBK8"
FT                   /protein_id="BAI00961.1"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVIVVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT   CDS             complement(184217..184534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41750"
FT                   /product="DNA helicase II UvrD/Rep"
FT                   /note="Probably pseudogene, Middle domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00962"
FT                   /db_xref="GOA:C7JIN5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN5"
FT                   /protein_id="BAI00962.1"
FT                   /translation="MLQFSYMSEEADAIAAEIGRRAASGCAWHDIAVIYRQNRLSRAIE
FT                   EALIQARVPYEIVGDVGFYQRVAVKDALALLSLAARPDDRQSDEAFRADFSHLRQFRVI
FT                   L"
FT   CDS             complement(184771..186990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD/traA"
FT                   /locus_tag="APA01_41760"
FT                   /product="DNA helicase RecD/TraA"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00963"
FT                   /db_xref="GOA:C7JIN6"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN6"
FT                   /protein_id="BAI00963.1"
FT                   /translation="MTSAVVGEQCQTEALAGLVERVTFHNAENGFCVLRVKVRGQRDLV
FT                   TVVGHAAMISAGEFVQMSGRWFNDHTHGLQFKAEFLKASPPTTVEGIERYLGSGMIRGI
FT                   GPVYAKKLVKAFGEAVFDLIEQEPHRLREVTGIGPKRAERIVGGWADQKVIREIMLFLH
FT                   SNGVGTSRAVRIFKTYGQDAVRLISENPYRLAKDIRGIGFKTADQIARKMGIAPDAMIR
FT                   VRAGISYALGEAMDEGHCGLPVGELLTSTAELLEVAAPLIETALALELEAGDVVADSVG
FT                   ETSCIFLAGLYRAEQSIAERLRACAVGRPPWPEIDAEKAMTWVEGKTGLAMAPSQQEAV
FT                   RLALRSKVLVITGGPGVGKTTLVNAILKIVTAKGTDVQLCAPTGRAAKRLSESTGLEGK
FT                   TIHRLLETDPGNGSFKRDDTNPLTCDLLVVDEASMVDVLLMRSLLRALPDSASLLIVGD
FT                   VDQLPSVGPGQVLADIIGSDAVPVVRLTEVFRQAAQSRIITNAHRINEGKMPELSAEEG
FT                   SDFYFVEAAEPEVGLRKLLAVVKDRIPARFGLDPVRDVQVLCPMNRGGLGARSLNIELQ
FT                   QALNPAGDVKVERFGWTYGPGDKVMQIANDYDRDVFNGDLGVIDKIDVEEGELTVLFDG
FT                   REVVYGFGELDELVLAYATTIHKSQGSEYPVVVIPLVTQHYTMLARNLLYTGVTRGRKL
FT                   VVLVGQKKALAIAVRNQGGRLRWSKLRDWLVGTSGTGHLSRLKKP"
FT   CDS             complement(186987..189212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41770"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00964"
FT                   /db_xref="GOA:C7JIN7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN7"
FT                   /protein_id="BAI00964.1"
FT                   /translation="MVESQVSHIQPEYKFHINLDEYDRRATLSADELKVVRRWKEENLV
FT                   ITKRQAPRLHKPLTDILYRSNLDRANSHRALKYLLLTVAHQEKPYWGWSEDLWVEIINN
FT                   SPVLKKTGMVPQLIAVAYLLCGFRSVYKIQRNVATAVVARLVFGAEIVDTECERLFSAL
FT                   TRVGFVCQTVRPLVPSVFAAVALQGENPKLESFDRKILEHTRECYTGNHIAKRIGILSN
FT                   GLAAMGLTSKVIHFRAYPPRHGTETDNINPEWMTWCRRWLETTTLREGSRRAVYNTLTR
FT                   IGIWLGREHPEVTGPEQWTVSVCADYLAAVDRLRVGDWGGSTFDYRLIPTVGQPLQAPT
FT                   KVAYYQVMRRFLSDIQSWEWARLRCNPRYHLSTPKNIAKYLGVNPRTIDDASWLKLTWA
FT                   SLNIEPDDLSPDCFYPFALLQAIAVVWTHAGLRSNEIARLRVGCTREQSEDVVDQSGNV
FT                   VPAGQVCWLDVPEGKTSVAYTKPVGHAVHKYITAWMKKRASPRKHLDRRTGEHVHFLFQ
FT                   LRNRPIAKEVLNQTVIPLLCKKAGIPIEDSKGRITSHRGRASAVSMLASVPQGMTIFDL
FT                   AKWCGHTSVQSTMSYVRSKPTQLASAFAKADQAARMIEIVIDNEVIAAGATKDGAPWKY
FT                   YDLGDSYCSNAFWSTCPHRMACARCYFNIPKPSAKGVVLAAQQAANRLLEEVWLSPEER
FT                   DAVSGDVEALEGMLNKLRDKPALDGRTPGEISATCGSQVSSPFTESE"
FT   CDS             190209..190409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="APA01_41780"
FT                   /product="transposase"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="EnsemblGenomes-Gn:APA01_41780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI00965"
FT                   /db_xref="GOA:C7JIN8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C7JIN8"
FT                   /protein_id="BAI00965.1"
FT                   /translation="MELGITPGQDADITQAEPLLENIEPDAFLADKAYDADRLIDRLIQ
FT                   RGITPVIPPKRNRTTRRVIPP"
XX
SQ   Sequence 191799 BP; 44835 A; 51016 C; 51332 G; 44616 T; 0 other;
     cgcaggttga gttcctgttc ccgatagatc cgataaaccc gcttatgatt ccagagctgt        60
     ccctgcacat tgcgcagata caggaaacac agaccaaatc cccatctcct gtgagcctgg       120
     gtcagtccca ccagaagagc ggcaatcctg tcgttctccg ctgccagtcg cggacgatag       180
     cgaaagcagg tctcggatat cccaaaaatc cgacaggcca gcgcaatgct gaccccatga       240
     tgcgccacag cttgtgcggc cagttcccgg cgctgggctg gccgcttcat ttttttccaa       300
     gggcttcctt caggatatcc gtctgcatgc tcaaatccgc atacatgcgc ttcagccgac       360
     ggttctcctc ttccaaagcc ttcatctgac tgatcatcga agcatccatg ccgccatatt       420
     tcgcgcgcca ccggtaaaac gtggcgttgc tgatcccatg ctcccgacac aggtcaggaa       480
     ccgggacacc gccctcagcc tggcggatca cacccatgat ctgggcgtca gtaaagcgat       540
     cactcttcat cagaatctcc tcaattctta cgctgagaaa attctcattc aaaagtcact       600
     ctttttatgg ggggattacc cgctgtctgg aacaggttat ggagtggcgc ggcaggccag       660
     aagccatccg aatggataat ggccctgaat atgtcagtca tacgttggtt tcatgggccg       720
     aaaaacaggg gattaccctg atctatacgc aaccgggtaa tccgcagcag aacgcctata       780
     ttgaacgcta caacagaact gtccggcagg aatggctgga gcagtatctg tttgaaagca       840
     ttcaggacgt gcaggaggtc gcaacacaat ggctctggac atataaccat gacagaccca       900
     acatggggaa cagcgggcta acccccgccc agaaactaaa aacagctgcc tgaattctca       960
     ttcaatgccc cactaaaaat ggggggatta ccactctaaa tcaatgcatt ccaattaact      1020
     tataaaatgc tttgagagtc atcacctaca gcaaagaact ctgctgacac ctctgaaatc      1080
     attttgagcc ataaaaactg ggctcgattg acgtcctgaa actcatcagc catcacggct      1140
     gtgaaacggc gtgaccagcg gtagcgatag gcatcattgt gcagcattgc caatgtcggc      1200
     cacatcaaca gatccccaaa atctgcagca ttctgttcgc gcagcaaact ctggtaacga      1260
     ccatacaact caaccacata gcgccagccc gcatcgtcca taaaacgttt ctgggcatgt      1320
     gctcgcgcta tcatggcttc aacatgatgc cctgccatct caggcgtcac cagatcttcc      1380
     ttcaaacgag atggggtggt tgccgtcctc cccgcacggc atcgcaatgt gccagaatgg      1440
     tcgttggaag aaacgactgc gcgaaaggac ggcagatgaa ggatacagtg ataggcgttg      1500
     atctggcaaa gaacattttc caggttcatg gagcttcgcg tgcgggcgag gtgatgtttc      1560
     gcaaaaagct gcgtcgtcag cagtttatgc agttcatggc cacgcagccg cctgctctgg      1620
     tcgttcttga agcgtgcggg agcgcgcatt actgggctcg cgaactggca ggagctggtc      1680
     acgaggtcag actgatcgct ccgcagtatg tgaagccttt cgtgaagcgc cagaagaacg      1740
     atgctgctga tgcggaagcg atcgtcattg cggcccgtca gccggaaatg cgctttgtcg      1800
     aaccacgcac tgaagcgcag caggcgcgtg gcgttctttt ccgggcccgg cagcgtctgg      1860
     tgcaccagcg cacggaactg gtgaatgccc tgcgtgccgt tctgtatgaa ttcggtctcg      1920
     tcgtgccaca ggggattgcg catatcagac acattgaagc catgctggat gaggcggttc      1980
     tgccagaggc tgtgaagcag gaatgccttg atctgctgcg acagatttcg gagcagagtg      2040
     tgcggattga tgtcagaaca aagaagatca ggatgcttgc ccaggaaagt gaaaacacct      2100
     gcagattgca gagcatgcct ggagtgggtc ctctgaccgc tcttgcgatt gaagcttttg      2160
     cgcctgacct gcagagcttc cggcgcgggc gcgactttgc tgcgtggctg gggctggtgc      2220
     cccgtcagtt ctcatctggc ggaaaggaaa ggctggggaa gatatcaaaa gccgggcagg      2280
     ctgatatccg caggcttctc atcatgggcg ccatgaccca ggtgaactgg gccagccgta      2340
     aggcccctgc accgggaagc tggctggcac ggatgctggc ccgcaagccc cgtatgctgg      2400
     tagccattgc gctggccaac aggatggcac gagccatctg ggccatggca acaaaacagg      2460
     aggattatcg ggatccggcc ctgtccgtgg cagcctgagc gatggctcgg ctcccgcgga      2520
     tggaaccggt aggggtgtga gagggcgatg acctgaatgg gcgcatgatc gtctgatccg      2580
     gatcggaaaa accagtggat ttctctgtgc tttaaagcac gcctgtgaga tttggatctg      2640
     atccgctgat caccatactg gccagtggct tctgaaaggc cacatcaaca ggccttacag      2700
     aagaccgcac acgatcacac gtcaatatgg gtcagaaaac tcttgcataa cggacggcaa      2760
     ccatatgtgg acggctcccc cttgcaagag gctaggcaag aaaatgatcg gatctttgct      2820
     tccatatgtc cggcctgttg atgcggccat agggtcgctg gccaagatgg cttccgcagc      2880
     gtgagcccca aacacagaag cggtctttga tgaccactgg ttgccacggg ttttctcacg      2940
     ccatggatcg atcgatcaca ccatctgctc tattacttgc aagccacgac ctcagctcgg      3000
     cacgagagcg tcaaatgtca gcgcatcgtg ccaggctaag ctcaaacagc agctgcgccg      3060
     ggttgctgca gaaggcgctt atagtgttcg ccgctgacca tcagtttcca agcaatccgc      3120
     gcaatcttat tggcaagggc caccgctgcg agtttcggtt ttttgcgctc cagcaattca      3180
     cgtaaccaag atgaggcatt cttcccattg gtccgccggg catgcgacac gactgcggtc      3240
     gcgccaacca ccagcgtgct tcgcaagacc tcatcgccag cgcgtgtgat tctgccaagc      3300
     cttgtttttc caccggttga gtgatccctg ggcgtcaatc cgatccaggc cgcaaaggct      3360
     cgacccgatt tgaacagatg cggatcaggc gttttcatca tcagcagcgc tgcgccgatc      3420
     gggccaacgc ccggaatttt cgcaagacgc tgactgcatt cgttggcgcg gtgccatgcc      3480
     atcaccttgc cctcaagctg ttcgatttca ccttgcaatt cagcatattc ctttgcgtga      3540
     agggcaaaca actcgcgcgt caatgtgggc aggctttcgt ccgcagcgat ccgatcaagg      3600
     agtgcctcaa tccggcacat gcctttgggc gccgtgatcc caaactcggc agcatatccc      3660
     cggatcgtat tggcgagctg tgtgcggttc cggataagtc gtgcccgcat tccaatcagc      3720
     atcaacgctg cctgctcttc ctcgctcttg agcgggacga accgcattgt aggccgactc      3780
     atcgcttcac agagggcttc cgcgtcggcg gcatcgtttt tcccgcgctt gacataaggc      3840
     ttcacgagct gcggcgcgat cagcttcact gtgtgtccca gacacgagag cacccgcccc      3900
     cagtaatggg aggcgccaca ggcctcaatc gcgatttcaa tcgggggcag tttctcaaaa      3960
     aactttacca tctcccggcg ggatagcttc ctgcgcaaaa caggctgctc cttcgcgttt      4020
     acaccgtgca attggaaaac actttttgac gtgtccatgc caatacggat aatttgttcc      4080
     atgggtggcc tcctctgtga gttctgcaac gacttcacct tggcacatcg cgatgccgtt      4140
     gggagccgtc caccccatca cagaagaaat ccgcgtcgag ctgagctacg gcgccgagca      4200
     cctgcagcga gaacataccc tgcggggtcg tagtgtcgat ggggtcgtcc aaactacgga      4260
     aatgcgcgcc agcgtaatcc agttgctcga taacggcgag taggtggctg accgagcggg      4320
     ccagacgatc gagccggacc acgaccaagg tgtcaccagc gttcatatcc cttagcaggc      4380
     gtataagcac agggcggttc cggtcagcac cggaggcatg tttctcgaaa atcatcgtgc      4440
     agccagcgtc gcgtagctca ttcaactgtg cgtcggtgcc ctgatcgtct gtggagacgc      4500
     gagcgtagcc aattagacgg ccgccaacgg gtgtttttcc aggtttgggt ggcaccacgg      4560
     cgacgaagct ccttctgagt ccatttttac aattcaagaa gacattcgta aacgatcgtt      4620
     tgcaaaggtg gccaagccac ctgcgcgtgc caacggtcgt tcgtatagat tcaagtgcaa      4680
     tcaaccaggg tattttttgt caggaatgag ggaacatttt gcagtcaatt aggcttcaaa      4740
     aaacggcccg aagcagcgtc aatgtgatct ttgtcatcat ctagggaaac gcgacatccg      4800
     aggtctgggc agacagtgcc tatcgatcca ggcgcaacga gaagtggctg tcggaccaga      4860
     tgctcacgtc ccgtattcat cggcgcaaac ccatgggcaa gccgatgtcg aaggcaaccg      4920
     cgagggccaa tgccgccaaa tcctcgatcc gtgcgcatgt tgagcatgtc ttcgcgcatc      4980
     agaagaaccg gttcaacctg ttcatccgca ccatcggcct cgcccgcgct gaggcgaaac      5040
     tgaccctttg caacctagcc tacaacttta atcggctgat cttccacgag cgtctggaaa      5100
     ccgcaggctg actctgtcgg caagtcggca aaaccggcgg aatcaactcc gggcatcgtg      5160
     gaaatcggtc cgaacgatac ctttggtgcg ccccgcaaca cctcaacgtc atcaagccag      5220
     cccgcttcgc cagaaattac ccggtttttg cgggtctcca gctttcatta aatcgtaaga      5280
     tttaagtttt tcgtcgaaat ttaaaatgta tatgtcataa ttggctcagc gacttaactg      5340
     atggaggcgc atagttttga atttaaaccg caacgccata tcccatgtgc ctgataccgt      5400
     ttacacgcca cgctacgatc cggcgctact gcggcccggt atcgtacacc tgggatgtgg      5460
     taattttcat cgcggacacc aggttgtagc aacacaggcg gcgatagatg ccgagggcag      5520
     ggatggactg agatggggta tcgtctcggc gacgatgcgg cgcccggatt tggcgacggt      5580
     acttcagtct caggataatt tatatacgct gctgacgcgc gagcccgcca atacggtcgc      5640
     gtctgtgatg gccgcgatta ccgaggccgt atatgcaggt gatgataatg ccaatctcgc      5700
     agcacgtatc gctgacccgg cgacggctat tgtcacactt actgtcaccg caagcggata      5760
     ttacctgagt gccgatggaa gactcgatcc tacgttcgag gctattcagg ctgatcttac      5820
     ggcgataacg cctcgcaccg ccccggggat cattgccgct gggttggcac aggtcaggca      5880
     gcgcggcggt gtccccccgg ttattctgtg ctgtgataat gtgaatagta acggtgccac      5940
     gctgcgtcag gccgtgattg atctggctgc cctgaaaggg gatgaccttc tggcggcatg      6000
     gatcgaaacg aatgtgcagt ttccggatac gatggttgat cgtatagtgc cgaccgcgac      6060
     gcctgacgac attgcggatg cctgcagact tttgggtggc attgaagacc gggccccaat      6120
     ttcggctgaa ccctggttcc aatgggtgat tggtgaattt gatgggccgc gcccgagatg      6180
     ggttgcgcat ccggggacaa aatttgtttc tgatgtcggg gtttttgagc gggcaaagct      6240
     gcagatgctg aatggcacgc acatgctgct ggcttatgtt ggtgctctgg ctaacctcaa      6300
     tacggtctct gaagcggcta gtgacgacgc gcttggacgt attgcagcgc gtttcatgcg      6360
     caacgagcag acggctgacg tatcgcttga tactgatgaa cttgaccgct acaccgttga      6420
     tcttatgcaa cgtttccgca atcctggtat cgtccatgaa gtgacaagga ttggacggaa      6480
     tgggtcagcc aagatggcga gccgaattgt ccagccgatg cgctccaata tcgaagctgg      6540
     gcgcccggtt gatggtgctg tcttgcttat tgcgagctgg attcgctggt ttgcgcttca      6600
     tgagcaggat gaattcgata tcgccctgac agatccaagg gcggagactc ttcgcgggct      6660
     gtgtgccgat gctcgtgacg atcataaagc acaggctgag gcatttttgg ctatggaaga      6720
     agtatttggg gctcctttgc ccgaccatgg caagcaggtg gaggccattg cctccatgtt      6780
     gcgccgcctg acggaagaga gtgtgccaga gttacttcga acaatcgctc actaaaatta      6840
     cacgctgtag actttacata accaaaatcc aggggggggc tttattgagt gcaccccgcg      6900
     tggatcgtca ggcttgtcca gttatggcgt gtttgagata tgcttccaca atcgaaaggt      6960
     cctgaacgat cgccagggcc tttccacgga tttcatctgt cgcttcgaga agatcgggta      7020
     cgacaatgac gcggatccct gcagcatgcg cggcacgggc gccagagtgg gaatcttcca      7080
     gtgctagtgc atgggcagga ttaaccccaa tttttttagc cgctgtcaga tatggttccg      7140
     gatcaggctt tccttttgaa acatcatcac gtgtcacgat ggcattgaag cggtgaaaca      7200
     gattaaccag ttttagatgg tggtcagtgc gaactcgact ggaagaggtg gcaatggcgc      7260
     ggggaatttt gtaagtgtcc agtaaatcaa gaaggggcag gacgcccttt tttagagcta      7320
     attttcctgt atctacgaaa ttacgaagat gaacttcctg aagttcaaaa aaacgctcaa      7380
     gcgggaagtc ttgaccatag gtttttcgta ccatggtacg gcaaccgtcg gctggtacac      7440
     cgatcattgt tcggcaaaat gacattggaa tgtcatagtt cagatcacgt gcagcaaata      7500
     ccagagcttc catcgcaaga gattcactat cgagcaacaa gccatccatg tcgaagacga      7560
     ccccgtggac gggttcctgt ttgtgcttca gaagatgtgc gggaaacacg gtatctgtca      7620
     tgagtatgtc ctcgtgcagt tgatcctgaa gtaagaacta tgtgtcatcg tgtcgagaaa      7680
     tgcacgcttt tggcgttcac actatcgcta tgtccatcgc tgtgtgggtg aacgtggagg      7740
     gattgaaaaa tccttcttgc gcaactttgg tccataacaa tatcaaccat ttatggttat      7800
     agatcgacac aaaaagaggg tatttcgagc cctccaggtt gcctgtgaac cactcacgcc      7860
     agagacttat gtgatgtggc tgcatccgaa agtaagatca tggggacgac agatcatcag      7920
     tgcaccattt ggtgtgtaac ctaattaagg aattttttca cctaattaag gttgcttttt      7980
     cggtgctcaa ccggcgcgga aacggggatt ctcctaatta agggttttcg atgtcgaaaa      8040
     atagaggata atgataatca aagttattat ttatcagcgg tttatgaatc catttaatca      8100
     gaataatgtt ctaccgaggc aataaaaatc cacttattaa tggtaaaaat agcaggctaa      8160
     tttcgtaaga atttaactgc gtattctggc ggaagttacg tcagcaatgg gggggggact      8220
     acggaccatc cgtttcggag cgtggatcag atatttttaa ttattgtctc actactaaag      8280
     gaatgtcagg ctcatcaaat atggagcgtc aacgtagggg aaagaaatga gacgcgatat      8340
     ggatttggtt cgccaattac ttctgaagct ggaaggtatt gagaaggggc ctcacgatgt      8400
     tctccttatc ggtggaaact ctgaagaggt cgccgtcgac ggtcggacat ctgatgagat      8460
     ttacttccat ctcaccaaaa ttgaagaagc tggtttttta gagcgtgttg gaggcggagc      8520
     gatgacggca gtcacgttcc gagccctgtc gtggaaaggg caagagtttc tagataccat      8580
     tcgggacgat agcatctgga aaaaaacgaa agagaaagcc ggtagcgcct ccttcgatat      8640
     cctcgccgcc gttgcaaagg cagttatcaa agacagaata aagtctctta caggattgga      8700
     tataggctga aaggtcgtgc aaccgataag taactgttta gggcgtgtcg gctttcgggt      8760
     aactgtgaca accgcttcca tgtctggaga gaggcgactg cggcctgtct actcctgcat      8820
     cactaagcag acaggcagat cagggggggg aaaaccggtc ggtccggttt tgggtggaat      8880
     ttctttggaa acggacgtct ccgccaatcc ctaggcggtt cactcatgga attgctgttc      8940
     gcccggacat ccttctggtc tgatgcattg acactggatg accttcttcc gcagctgacc      9000
     tcaggccgga tgatccaggt tcatgacgaa taccggaagg caggtctgcc actcaatgtg      9060
     attgcagaac acgttctctt ctataaaaga ccaatccgat ccgatgagca gtgcgatgtt      9120
     gcttgcgctt tgagggatct tggttggaca cagcatcgca cggctaaggc ccgactttgg      9180
     atagcacccc ttgattttcc atcgcgagat cgaaacaagc cccgatggca tcacaggtga      9240
     agacatctcg taaagcgcta cgatttctcc agtgtctttc tttgcccagc cgtcgttttc      9300
     ttggtcatct gcctcactgc aaccatatgt tctgacgcta agtcctgagc ctaggggacg      9360
     catatgttta cataccaaag ggcatttcgt aacaaaaagc gtcactacat aggattctaa      9420
     agcggatgtc gtcgaagcca agccatcatt cggtcctttc ttactggcat tccgctcttc      9480
     ttgatgatgc ccagatgaag atctccttta gccgggataa tctggttgct cttgacgaag      9540
     agggttttga aaaaggcaag ctgccgcctg acaaaaccca ggcactgaga aagatgcatc      9600
     ctgcctcccg tgacctggct cccgacgatt ccattatcgc gatggccggt atccgcattc      9660
     ttctcgggca ggtcagtcat tccaccgagc attcgaaaca gcctgccctt ttctgtatgg      9720
     ccatgctcgt caacgtcagt ccggaaggca ccatccagcc gctcaaggat gccccgccct      9780
     ggataaatcg agagcttctc gaaccgtcgg atggtgatgt cctgattggt gatttggcca      9840
     ccatggacac ctggctccag ctcaatccgt ttgaaggagg cagtctcggc aagaccctgg      9900
     agtgggcgga aaagctttgg aacgcagtga ccggagaaga cggattaccc gacggctacg      9960
     aactctggga gcgcgtggcc cttcagcctg cggaggccag catcgggatg attgcgaccc     10020
     tccatcagcg acggttttac gataccgttc tggctgacac cggtctcgta acacctctgc     10080
     tcgcacggta tatcgatggt ggaccggaac cggctgtcgt ggatgagtcc cagaagtggg     10140
     ctgcagcggg ccgagccagg ggaacgatga ctttcgccta tggaatgtca tccagccagt     10200
     ctgaagccat gacggcgttc tgctcggtga aagatggtga cattctcgcc gtgaacggcc     10260
     ccccgggcac cggcaagacg acacttctgc aaggtatcgt cgcaacggag ctggtgacac     10320
     gtgccctcga gggtggtgat ccggctgtca tcgtcgggac ctcgaccaac aaccaggctg     10380
     tcaccaacat cattgatgcc atgaaaaaag ccatggcttc caaggacagc cggccatggg     10440
     cgagaagatg gattgagggt gccgatgcgc tgggtctgta tttcccgtcc ggagagaaag     10500
     aaaaggaggc tctgaaagcc ggctacctga tcgcgtctcc gggaagaggc ctgggcacga     10560
     tggagtggaa aggcttcccc gaacgtgaac gggacacggt cgatgcctgg gcctcccgtg     10620
     acgcttggat caacggctac tacggttctt tctatccggg cgtcactccg ccactccgca     10680
     aggagcacct ttcaggtcac ggtcctcagg gggcgcgtca cgacatcagc cttgttgaag     10740
     atggcatcgc gaaaatccgc gcccggatga aggtgcttgt cgaaacaggg cgggtctgtg     10800
     ctggagaagc cagaaagctg aatcagcttt acgtggcctc gggctatgga acatatcccg     10860
     atatcacaaa ggccatcgcc cagcgggaag cccttcttca ggagcgcagg ccaagggaag     10920
     acgctctcaa atccgacctc aaggaaaaag aggccgctgc cgccgttccg cgcgccagga     10980
     tcaatgagga gaaccggaag acccgggacc tcctgaagca gcgtgatgat gccgtgcatg     11040
     ctgccgggca gaaagtcgaa gaggtgggag cacatgccgt cgcgctcatt gctgcattgc     11100
     cggggggcgg tttcttttcg aacctgatga gtggacgcaa ctgggcgaat gttgaaaggc     11160
     ttgtcgccga gggtagacag ggcagcttct ttcggtcact catgcaggct caggtcaagt     11220
     ccaagcgcga atggatggat gccatcaatg agatgacggc atcagccgag agggagctcg     11280
     caacagtccg agaatctcgg gaagagacgc gtcaggctcg agataccctg atccagaagt     11340
     tggaacgcga ggttgccgct gccgacctgg tgagcaagac cgcccgagca gagtacgatc     11400
     actatgtggg aggctcctat gttctggccg gtcgcgagct tgaaaagctc gtcaccctca     11460
     agcatcagat actccagcaa cttcaggatt gctgcacggc cattgaaacg gttctggcac     11520
     cgtccgactg ggccgcgatg ttcgacatgc cggaagaaaa acttccttgg cgccagagca     11580
     actggacagg aaggctagat gtcatcgagg atttcctgga ccggacaata cgctacgctc     11640
     tgttccagta tgctttgcgc tactgggaag gtcggtgggt ccttgaagtt caggctcttc     11700
     aggatgcgct cgagcagaac gacaacaagg tctatccgtt caaggttggc ggcagagcca     11760
     tggaggccat gtatcgtcga tgggcgatgc tgacaccgct cttcatcgtg acggcagcca     11820
     gccttccgaa gtttcccaaa tgcacgatga tggaaaaggg caaattcgtc gaacgtttca     11880
     tggcaggctt tttcgacctg ctcattgttg acgaagccgg acagatagcc ccctaccaaa     11940
     tggtcccggc catggccttc tcaaagaaag ccgttgtggt cggggatgtc ttccagattg     12000
     agccggtcgt caccagttcc catgcaacgg atactggcaa tgcccgaaag gccggcgttc     12060
     aggaatactt ctgggatgac gacggaccgg ttgatccccg cgtcgtcacg gccgccccgg     12120
     gaaacaataa catcatgggc tccgtgatgc gcgtggtcca gacgggcacc agtcactcct     12180
     caccggacag ccctgttccc ggcatcttcc tgaccgagca ccgccgttgc cgacgggaca     12240
     tcatcgagat ctgcaacgaa ctcgtttata acggccgcct gaaacccatg accgcagaac     12300
     cggacaggga accttctctg ccgcctcttg cttgggccaa tgtcaatgga acgtcggagc     12360
     gtctggggcg cagtcagcgc aatccccgtg aagcggaggc catcgcgcgg tggattgtca     12420
     gtaaagcgga tgaatggaag gacttctacg acaagccggt gaacgagatt gtcgcggtga     12480
     ttgcccccta tggaccgcag agagacgcca tccggcgggc cttacgcaag ttcagcacgg     12540
     cccatacgga caagaacatc tcgaaaatca aggtcggcac ggtcaacgcc atgcagggcg     12600
     cggaacggga catcatcatc ttctcgccaa catgcgaccg caaggcgagc acgggattct     12660
     tggatggcaa gcgcagtctt ctcaacgtcg ccatctcacg agccgtccat tcgttcgtcg     12720
     tcattggcac gatggaaatc ttcgagcgga atcctgcgtc ggccctggga attctgggga     12780
     gagccctgtt ttccaagggc tatgaactcg gggatgtgac tggcaactgg gcggcagata     12840
     cgtctctcat cctccgtggc aagaggctgt catccgtaag cgagcaccac gcgcaactgg     12900
     ataaagccct cgcggacctg aaagacggcg aggaaattgt cattgtctcc cccttcctgt     12960
     ccctgtccgg tgtcaacgca cctgaactcc aggacagcat ccgcgaggcc gttggcagag     13020
     gggccgtggt caatatcgtg acgcgcgctc ccaacgctcc cggttattcc aacggaacat     13080
     cacctgcgtg cagaaaagca ctcgaggaga cgggagcaag gctgcacgac atcaagctct     13140
     tgcattcgaa gacgctgatg acgcagagct ttattgcaga agggtccttc aactggctga     13200
     gcgtcatgcg cgacaaacct gagggcgcca acctggatac gtcatgggtg ctgaccgggg     13260
     aggatgccca taaagccgcc cgagaagcca ttgatgagct caaccttctt ctgaaagaga     13320
     gcaagccccc gtccgaaata gggcatggaa taatggcggc ctttgtcagt caggggaaag     13380
     actgacagat cttcccggag taatgccagc agtcatgatg ccgtttttcg atgataaatt     13440
     tcagcgttat tcagttttgt gttcggtaag cgctcgtcca cgaatacaag gtggtcgtgg     13500
     ataagaaatt cgtaagcgtt cggatgtcgc acattcgtat ttaatttgag agcgactacg     13560
     gacatgatct agccgttcgg tccaccctac cgattggcca ggtcagcaca gttgcttgcc     13620
     agcttctccg tagagatcgt atcagccagt cgggggggaa agctgcttgt ccactttcag     13680
     gcggaataaa ccagaaagca gacttatagc atgccaagcg gtgtttggca tggcgtcggt     13740
     gagaccgatc gattccattc gcattgcgag gccactggcc cgtggcaccc acgaaatctg     13800
     cgttcaactg aggggatcat tgcatctctg caatccacca gtaatctatg actttccgcg     13860
     actgactgga ggccgcagtg ccctcgccaa taccacgcgc acctgccctc cttgaagccc     13920
     tccttcacga ggcgctggac cccgccactg aaaccctgga agccgccgaa tgacgcttgc     13980
     ccccgccgag gccgaacgcc tcctccgttc ccgttacggc gaacctgcaa aggcaccgac     14040
     agactacgtc atcggattcc gaaacccgat cggccgtgtc cttgcaattc atcgcatcaa     14100
     caagaccacc tgcgtctggt tccagccgcc cgcaccccca cctctggccg gcgtcgcgct     14160
     tctggctgca cccaagaacg gcaactcgaa catcaacgga ccccttgcac cgttgaaacg     14220
     tccagacacg cagcgggccg aaatcgacag tccaacagct ctgcagcgct tcctcgacgc     14280
     ggaaatctca cagaagggtt gtacatcggg ttagattatg aaaaagtctg ttttgcacaa     14340
     aagaaatttc cataatcatc aagaaaaccc gatgcagaca gagtgtagcg caggcgcgta     14400
     tgagtttcca gcctcctgtg gacggcgtgt tgtggcccgt tttgacgggg gtcgcatgag     14460
     ttcggatggg ggcgtaattc tggtgaagca ggctgatgac attctgggtc tcagccgccg     14520
     ctttgctgcc tgttttcgcg ataagcggca tcccggcttt gtggaatacc gggttgaaga     14580
     ccttgtccgt cagcggatca tgggcctggc actgggctat gaagatctca atgatcacga     14640
     tgccctgcgg catgacctga tctttggtct ggcctcgggt cgtctgtcag gaggccgggc     14700
     aaactgcgca gcattggctg gcaaatctac actgaaccgg ttggagcgca gtgggcacaa     14760
     ggcagatcgt tactgtcgga tcattgctga tcatgaggcc ctggctaccc tgttcgtcac     14820
     gctcttcctt gaccagcatg agcacgcacc cgcccggatc gttctggatg tggatgccac     14880
     cgatgaccgt atccatggcc atcaggaagg ccgcgccttt catggatatt acggccataa     14940
     ctgctatctt cccctgtatg tcttctgcgg ggaccatctc ctcagcgcta ccctgcgcac     15000
     gacagacagg gacccgggga aggaagcact ggcagacatc cgccggatcg tggagcagat     15060
     caggagccgt tggccccggg tgcgtatcct ggtgcgtggg gacagcggtt tcgcccggga     15120
     cagtctgatg acatggtgcg aagacaacca cgttgacttc ctgttcgggc ttgcaggcaa     15180
     cacccgcctg tatgaccgga ttgcctcttt gtccgctgag gttcgtgacg aagccgccac     15240
     gacaggcaga gctgcgcgcg gtttcgcctc ctttgactgg atcacaaagg acagctggac     15300
     gcgccgcagg cgggtcgtgg ccaaggccga atggcgccac ggcaaccgct atcatcgctt     15360
     cattgtcacc acgctaccgc agggaatgtc cgacccccgc catctctacg aacagattta     15420
     ctgcgcacgc ggggatatgg aaaaccgcat caaggaatgc cagatggatc tgttctcaga     15480
     caggacctcg tcccacacca tccgggccaa ccagctccgg ctgtggttct cggccgcagc     15540
     ctatgtcctg ctgaccgctc tgcaaagact ggcccttggc cagaccagcc tggagacggc     15600
     gacctgtggc accatacgcg cacgactgct caaaatcgcg acacgtgtaa cgctcagcgt     15660
     ccgtcggatt gtcctgttca tgccggacat gttcccctgt cagcacgaat tcgccctcgc     15720
     tcatgcacga ttgcgaaggc tccggcaggc catctgaaga aacagacagt gcacagacca     15780
     catagcttcc accaacactg ccttctcagg ccgtgacacc ctcactgcgt tcagaacccg     15840
     ccgccagaag cagaatatcg tcaatattcc agatcgggct cctgtgggat gactgaattc     15900
     tacaaaataa cccgaaattg cctcaagtgt gagaaatccg cgtcgaatgg tacgacggcg     15960
     cgcccgtcga ggcattaaaa acgcctgatc ctctcgacgg cattgattcc accagcgcct     16020
     tctcgaccct gttgcaaaag gaagccaagg gcgacttggc caaagatgaa aaagccgacg     16080
     cgcggtatct tgaggcaaag gagaaatcaa ttctggacat caaggtttcg gtcggcaaga     16140
     ccgtcttcaa ctccaacggt caggtggtcc cgactaccgt caagaacaag gaactccaca     16200
     tgtccgaggc cgagttggac aagctgatcc gggatctcct caatacccaa gaagaccgat     16260
     gcgccatcac tggcctgccg ttccagttct tgggggtaaa gaaggacgac aacatgctgc     16320
     cctccttaga ccggatcgac agcgacgggc actatgcgaa ggggaacctg cagctcgtct     16380
     gccgtttcat caacttctgg aaacaggctt cggatgacaa agagttccgt agattgcttg     16440
     ccatccttcg taaatcttaa acagacgaca gatagcctct aaaggaggag tgcgctcctt     16500
     aaactttact cgcaatatcg caacgtgacg actgcccgca aatcacgcct aatgatcgct     16560
     catgctccag ttcttcagtg ctctgccgca agtcggctga taggctttga atcagttatg     16620
     tccgctatcg ggatgaagac gggagcactc tatgtccgac atgaggcgtg agcggactat     16680
     ttcctaagcc tgatgattcc gagttcgtgc cacatccacc caaaatcgta ggcagccatg     16740
     gcaccgccac tcccttgggc gcggaccgta gtgttttcga tatccttcaa ccagatggcc     16800
     acctttttac gtcctgaggc tgtctggacg gcctggcgcg gcgtcaaatc ccccagggcc     16860
     gggactggct catcaagcac ctgccgatag tgccgctcca gcatctgccc gataatccgg     16920
     gcttcctcct cgggcgggat ctgcagttct ggcgagacct cccgtccatg cgtcccccgg     16980
     tcttccatcg cctgcgccgg cgtcatgatc tgcgtgaacg gagcgtgcac gagatctccc     17040
     agaccaacct gcagcatggc acgaccacgt tcggcacgct ctttcgagtt cacctgcagc     17100
     cgcaactgcc gccccttcag atccagcgtg cccagcacga tcgcaccatc atccatctcc     17160
     gtgcgcagga accgcccgtt ttcatctcgt ccagccttgc gcacgggatc gctcatcggc     17220
     tctttcagcc agttccagaa tgaccggttt tccggtcgca gggccatgat cccgtcaagc     17280
     acgtccgcca ctgtcttctg cgtcacgccc tttgccagcg gaaaacacac ttcatggaag     17340
     accagatcct ctccgtcccc attgaacaaa gctggcccct ccatctgccg ggccatgtcc     17400
     tccagtgtcc ggaacagcca ggtcagcgtg aacatcggcg caagctcacg cagggtctgc     17460
     gtatcgactt tcggaaactc ggccttgccc cggcgcttcc gaagcacctt gtaaaggtgc     17520
     gtcgccagat cttcgcaggc accccgtgaa taggcgagca gcccgcctgc cagaatggtc     17580
     tttccatcgg acagcacgag acgtgctgca atccggtccc actgttccag tgtccgggtt     17640
     gccgtgcctt catgcaccag aaccggatca ccaccccgca gcaggtcacg cgccatcagg     17700
     ctctggccgg gtttgatgtc cgagacttca tacaggctca tgaccgaagc cttgagggca     17760
     cgcatatagg cgctgttacg cggcccttcc ttccagcccc gacgcttgag gtaaacgtcc     17820
     acgaagttcc ggctatcgtc ccagtcctgc ccgagaaaat cctcgaaggc gcagccccat     17880
     agcgtcatgg cgacgtcggg accgatcatc tccgccagat cctcgaacgt gatgtcgccc     17940
     gcttccagcg ccggaccgat gtgatcgccg agcacttcgc caaaacactc ctgccagtcc     18000
     tcctgaccga gataacggat cagtcccgtg agttcgtctg cggccatggc tgctcctgcg     18060
     tctcctgata cggacagcag aggggcagac tgtcctgact cgacaagcct agaatgatac     18120
     cccaaaacag gcgacagggt gcctcactct tcaatcacgc atttgtgaaa gtggacaaaa     18180
     atgcgccccg gtaccttttc gtctgtttcc tatgtgtttc ctgcggggaa ttttaggcaa     18240
     caaaaaaccc gcctgtttag ggcgggttta tcgtgtccga tcaaggactt acgcttggtt     18300
     acgggggcac acaaccaaag aaaactgctg cttgtcagcg gcttcgttga acggttgtga     18360
     gcacatttaa ctaactgaaa aaataaaata tttttctcta cttttgtttg atcctttatc     18420
     atccttgctc cgaaagaact gggtgccccc tgccctacgg ccagtctgtt actatgtcag     18480
     agactatgga ttgcctttcc cgcgatccag aagacaccaa aagcattgag tgcaaatccg     18540
     tggctcacga ttcaggggaa aaacagcatg tagccgctgc ttcttactcc cgtaccctcc     18600
     ccaaccagaa tatcgcgtat cacgagatca ttgatatctc gcatgactgt acccgcctcg     18660
     cattattccg acagttatgg ggggggaacg gaaggtcggc cattgggcgg aaaattagac     18720
     aagtagccat tcgtgccttt aacgtccatg ataactttgc gcccaatttc gacgctgatt     18780
     tctcacactt gaggcaattt cgggttattt tgtagaattc agtcatccca caggagcccg     18840
     atctggaata ttgacgatat tgtgcttctg gcggcgggtt ctgaacgcag tgagggtgtc     18900
     acggcctgag aaggcagtgt tggtggaagc tatgtggtct gtgcactgtc tgtttcttca     18960
     gatggcctgc cggagccttc gcaatcgtgc atgagcgagg gcgaattcat gctgacaggg     19020
     gaacatgtcc ggcatggaca ggacaatccg acggacgctg agcgttacac gtgtcgcgat     19080
     tttgagcagt cgtgcgcgta tggtgccaca ggtcgccgtc tccaggctgg tctggccaag     19140
     ggccagtctt tgcagagcgg tcagcaggac ataggctgcg gccgagaacc acagccggag     19200
     ctggttggcc cggatggtgt gggacgaggt cctgtctgag aacagatcca tctggcattc     19260
     cttgatgcgg ttttccatat ccccgcgtgc gcagtaaatc tgttcgtaga gatggcgggg     19320
     gtcggacatt ccctgcggta gggtggtgac aatgaagcga tgatagcggt tgccgtggcg     19380
     ccattcggcc ttggccacga cccgcctgcg gcgcgtccag ctgtcctttg tgatccagtc     19440
     aaaggaggcg aaaccgcgcg cagctctgcc tgtcgtggcg gcttcgtcac gaacctcagc     19500
     ggacaaagag gcaatccggt catacaggcg ggtgttgcct gcaagcccga acaggaagtc     19560
     aacgtggttg tcttcgcacc atgtcatcag actgtcccgg gcgaaaccgc tgtccccacg     19620
     caccaggata cgcacccggg gccagcggtt cctaatctgc tccacgatcc ggctgatgtc     19680
     tgccagtgct tcgttccccg ggtcccggtc tgccgtgcgc agggtggcgc tcaggagatg     19740
     atccccgcaa aagatgtata gcggcagata gcagttatgg ccgtaatacc catgaaaggc     19800
     acggccttcc tgatggccat ggatacggtc atcggtggca tccacatcca gaacgatgcg     19860
     ggcgggtgcg cgctcatgct ggtccagaaa gagcgtgacg aacagggtcg ccagggcctc     19920
     atgatcagca atgatccggc agtaacgatc tgccttgtgc ccactgcgct ccaaccggtt     19980
     cagtgtagat ttgccagcca atgctgcgca gtttgcccgg cctcctgaca gacggcccga     20040
     ggccagacca aagatcaggt catgccgcag ggcatcgtga tcattgagat cttcatagcc     20100
     cagtgccagg cccatgatcc gctgacggac aaggtcttca acccggtatt ccacaaaggc     20160
     aggatgccgc ttatcgcgaa aacaggcagc aaagcggcgg ctgagaccca gaatgtcatc     20220
     agcctgcttc accagaatga cgcccccatc cgaactcatg cgacccccgt caaaacgggc     20280
     cacaacacgc cgtccacagg aggctggaaa ctcatacgcg cctgcgctac actctgtctg     20340
     catcgggttt tcttgatgat tatggaaatt tcttttctac aaaacagact ttttcataat     20400
     ctaacccgat gtacaaccct tctgtgagat ttccgcgtcg agagcacctg aagatgatct     20460
     atttctccgg acagagattg cctactcagt acaggatttt tcgcgggtag ctggccccgt     20520
     tcttcctgat acgcacccct tagcggcgga aatgaaagag agagccacat ctgcaccaga     20580
     aataaactct gaggaagtcc agcatctcct tgccagcacc gtctctctga cagaccaaag     20640
     actggtcaac cagatcaggg gaatggttga ggatatgagg tcaggcgtgg cagatccaga     20700
     gcaccctgat tttctgtttt cgatcgaaca gttagagcga gctgtcagcg gcgctcaaaa     20760
     tgtaaatgag ccacaaagtt cttcggacac acgcccaact gatgagacca gacctggtct     20820
     acatccttct ccgggaggcg ggcacgcgga agaaaacaat ccatctgcag atcagaccac     20880
     accacagaag gaagggagcc gaacagaacc tcagaatgcc gaacaagcca agaaagagcc     20940
     tgcaggaact gacaaagcac aaagcacgga caaaaaagaa ccggaagcac aaaaggagcc     21000
     tgaagggtaa tccccccata aaaagagtga cttttgaatg agaattttct cagcgtaaga     21060
     attgaggaga ttctgatgaa gagtgatcgc tttagtgacg cccagatcat gggtgtgatc     21120
     cgccaggctg agggcggtgt cccggttcct gacctgtgcc gggagcatgg gatcagcaac     21180
     gccacgtttt accggtggcg cgcgaaatat ggcggcatgg atgcttcgat gatcagtcag     21240
     atgaaggctt tggaagagga gaaccgtcgg ctgaagcgca tgtatgcgga tttgagcatg     21300
     cagacggata tcctgaagga agcccttgga aaaaaatgaa gcggccagcc cagcgccggg     21360
     aactggccgc acaggctgtg gcgcatcatg gggtcagcat tgcgctggcc tgtcggattt     21420
     ttgggatatc cgagacctgc tttcgctatc gtccgcgact ggcagcggag aatgacagga     21480
     ttgccgatct tcttgtggga ctgacccagg ctcacaggag atggggattt ggtctgtgtt     21540
     tcctgtatct gcgcaatgtg cagggacatg tctggaatca taagcgggtt tatcggatct     21600
     atcgggaact ggaactcaac ctgcggatta aaccccgcag gcgtcttgtt cgcgaaaagc     21660
     ctgaaaagct gtcggttccg gcccttccca acacggtctg gtccatggac ttcatggcgg     21720
     acaggctttt ggatggacgt gcttttcggc tcctgaacat cctggatgag ttcaatcgtg     21780
     aaggactggc gatcgaggtt gatttttccc tgccggcctg tcgggttgtc cgctgtctgg     21840
     aacaggttat ggagtggcgc ggcaggccag aagccatccg aatggataat ggccctgaat     21900
     atgtcagtca tacgttggtt tcatgggccg aaaaacaggg gattaccctg atctatacgc     21960
     aaccgggtaa tccgcagcag aacgcctata ttgaacgcta caacagaact gtccggcagg     22020
     aatggctgga gcagtatctg tttgaaagca ttcaggacgt gcaggaggtc gcaacacaat     22080
     ggctctggac atataaccat gacagaccca acatggggaa cagcgggcta acccccgccc     22140
     agaaactaaa aacagctgcc tgaattctca ttcaatgccc cactaaaaat ggggggatta     22200
     ccgaagctcc ggttgttcag aagatgagca tgggggctgc gcttgtcggc ggcttctctc     22260
     gtttggcagg tgccttggcg acaaaacttg aagcagagcc cggcaagctt tcacccggat     22320
     ggctcgatag ggcgagagag aaaagccaaa ggcatgatgc tgctcaggct gagaagaaca     22380
     tggaccacac cgcccattta ggttcagaag ccgttgaggc catgcaagct cttcgacagg     22440
     gaccgggatc cagtatcctt gctgcgattg cagaggccgc cgccagtgat ccgggcggca     22500
     tgtcagctgt gttatccgaa atgaaacccg gtggaaaata tgcgtctctg catggtcagt     22560
     ttgaggccga aaagcagaac aatcaggcat tcgcaagcag ccttgagaac gctgccagta     22620
     aacttgacgc ctacgggaag gggcgggaag ccgcccagaa gctcggtgaa accatgagca     22680
     cttcaacgcg ggtggagcaa cgttttgcac agatagatgc gcagatcggt aaggaggccg     22740
     aaagtctccc tggcagcaac cctgggacgt cgatgatgga ggaactcggg gaaaaaacca     22800
     aagagttggt caaaaaagcc gttgaaactc tcgcacgtct cttccgtgcc gcaccgtcca     22860
     gcggcccgac aatgtcaccg ggctgaggga gcaacggcca tgacagttag aggatttctg     22920
     gcatcggtgt ttatggtgtt ggggctggca ctatatgttt catccgcgat ggcgcagtct     22980
     ggttcagtaa ctggaagcac tacacaaagc acaatgtcgg gctcatcatc tgaggcttcc     23040
     agttctcaca ccgtaacatg ggatctgctt gatcctggag acgattggac tgcggtggtg     23100
     gttcgctcga tctttcccgt gttttcgtca ggagattcct ccatagggtc tgaaaatacg     23160
     gttattggta ccatgctggc ctggctgtcc gcttttgccg gggtcattgc gtcaggttgg     23220
     gtgacttatc tgtggttcaa taccaatttc cgtggtgccg aaacagccaa gcttcttggt     23280
     gacaatcagt cccagatgtc gatcgtcaag atcggtctgg cggcattgat gatgtttccc     23340
     acgatatccg gtttcaatgg tgggcaggcg gtcgttgtcc aaggctcgct ctggggcatt     23400
     ggaatggcaa agactatcta tcattacgca gtaaaagcca ttggtccgga tggtaaagtc     23460
     attgcgacac cgatcgtgcc aggaaccaaa ggtatcgtcc ttaatctggt caaggacgaa     23520
     ttctgccgat cactgctgaa cgttgcgtca aataacccga acctgattcc tgcgcctacg     23580
     ggacgcacaa tacagggcat ttcaggacaa tccataggtc tggtggtgaa ctatgcctac     23640
     aatatgacac tgggggatgg cacaccgact tgtggcgcta tcaatctgga aacgccagca     23700
     atgggcaaaa ccaatcttgc gggagtttct gttgatacgg ctgcaatgca aaaaaatgtg     23760
     cttgatgccg tacttgccgc agacatccgt gggcccgtgg aaacggtcgc tcgtaatttc     23820
     tggatgtcaa agaagacaca ggatcttgcg cctctgatgc agattgtgat gactgccaca     23880
     aatgactata cttccagact gaccgaacag gcggctcaga tgcgctccca actcgaaaag     23940
     gctatcagtg atcgctcaac aaccttaaac caatggggtc tcggtacaaa cggagatgca     24000
     acaaataccg ccaaccgtct ggatagcctc ggctggtctg gtgctggcgc gtattatctc     24060
     gaatttgccc gactgaacgg gcagacgctc tctctgatga ctgccacccc taacgtcaca     24120
     acgccgagtt acagtggtat tggttctgct cttgcgtcgg atgtcgctcc tctcatccag     24180
     tcagcgcata cctttctagg caatattgac gccatggttg caacgactga tggcatgagc     24240
     gcgccggggg ggaatggtga cctctattca ggtgccatgc ccggtggcga tgggtccagt     24300
     gttgtgacac aactctttcg tgccttgcac ctcaacgatt atgcgttgca aatgctggtc     24360
     gggtttatgg aaccttctgg cacaggggga tattggattg atccctttgg aaaccttatg     24420
     tctcttgggc actggcttat tactctttct gtcacgacca tgggcacagc gtcagttctg     24480
     tcttcaaatg ctggaacgat cagcacgggt attctttcct tgctggctgg tcagcccgaa     24540
     ggggccgttg cggctgggct tggccatatg gcgatgcaat ttttctctac accgatcatg     24600
     gcaggatgta tggccatgct catgctcatg ccaggactta ccatcgcgtt tgttcttccc     24660
     atggtcccgt atgtcatgtg gatagcaggt atcgccagct ggttgatcct tgtctgtgag     24720
     gcggttgtgg cagcacctct atggatgctt gcgcatatga cgctgaatgg tgaagggctg     24780
     catggcaacg cccggcaggg ttatgcgtta ttgtttgacg tgttgtttcg gccaacactc     24840
     atgctgtttg gtcttttttt cgggtatttc gtgtttgatg caatgtcttg gcttgtgcac     24900
     cagacatttg gggtcgcggc cggatttgct ctttcacatg gttggctggt cagcaatttt     24960
     ctgggcatgt tgcttctggt atggatgttt gtgttgctcc atatgattct cgcacttgca     25020
     tcgttcaggt tgattgcgat tgtgccaaac cgtgtcccgc agatacttgg tttcggcggt     25080
     ggagaacgga ttgatgtcga tgcatttagt agagatgtgg ctgttatcgg gatggctggt     25140
     gcgatgcaga acatgcaaaa ggcactggca ccgccagaac gccagcaagg taatggaaat     25200
     gggatatccg ctcctcagaa agaaattgag aaggggacag gtttgataga tactacattg     25260
     aagaaaaatt cttgactgta aggaatgacg tgatgtctga cagtggtctt ggagcatttg     25320
     cagcatacat gctgggtcat aatgctggca gtgctgctga acggaacagc cgttttatcc     25380
     gctcaatatt tgatcgtagc aatgcggctg attacgatga agtccttaaa cttgcgcgta     25440
     aaggggtaag tgccgtaaag acgcttggtg agcgtttaga tactttgaat gctgaacttg     25500
     ccgcagaacg tgagaaatct gccactcttg aagagcagtt ggcagcggcc aacgcagcca     25560
     atgcggaact tcagagacgc ctggaagctg agaaggccca tgccgtcatg cttgatgatc     25620
     gcctgttcga cctcacgaga agacatgtaa ggctttgcaa acaaaccggc atgacggaaa     25680
     cgtcttcgac ataaacgttt ttgatcgcat gatgcagccg cattgtttga tccatcacaa     25740
     tggagatgac aatgcggtct ttcttttatc ttccgctcgc cctcatgttg gctttgtcag     25800
     cctgcgatgg gggtaatgtt gagtcagcgt cccatgctca tggaccgaaa ccacctcgcc     25860
     tgcacaatct gtattatgaa cccaatggag cttatggttc tgcgcgagcc atatgggccc     25920
     ccccccgtct acaatcgtga gggtaccatc gtaaaaccca cagactcacg caacgatacg     25980
     ggtcgtgaag attatgagca ttcaccgtgg gcaacgggag cgagtggcgg ggatcagaac     26040
     gcgccgcccg gcacctggtg aaataaagaa tgggccgcct tttactgggc ggcccattct     26100
     ttagggcaga cggggaagca ggctatccgc tctgtccaga aattctcgga aagtcgcgat     26160
     ctggcgtgtc ctaagctgcc agtttacaga gcagttccat aaggatacgg aacccagaag     26220
     agccagaaaa ggcagaaatg ccacggatga aagcaggcgg ctgcttgtcc agggaaagaa     26280
     tatcatttct gttgaccaca ttataaacaa gacaatggtc agaagacccg cacataaagc     26340
     gcggaaaaaa gtctcacgct ggcgttttct gatcacatta tacaaatcat catctgtcag     26400
     ataacgatag ggaatagcac ttcgaatggc aggcaatggc ttctttccaa caatgtcatt     26460
     gcgtgcgtct tcgatgagtt catgatcatc gtcttgtaag gaaggtggat ttggcacttt     26520
     accctcatcc ttatgtggct caggctttgc tgagagttta aggatggtcc agagcagacg     26580
     gatgacattg aaattcccgc taatttgacg ccaacctacg gcgtcacttg gcgagcctgt     26640
     cacgtgcttt gccagtttgg ccgtcgtttt tatgacgcct tttttctgag atgcttggaa     26700
     agaattgtcg tgttcgctca tcgcgccaac tcccccagaa aagaagacac atctgtcgga     26760
     tttccctcta accttcccaa tgaaccgtct gtgcggatcc agaggaacgt cggcgtgccc     26820
     ttgagtgcaa tgcttttagc aaacgttcca ttttctgcga gttgactggc agcgttagag     26880
     gctggtgtgt cggcccgttc atgaaggtgt cccccaagcc atgcccgcac catatctgtt     26940
     tcaggatatg ataacatggc ttgcgcattg cgcgtgcttt ctccgcgatc ttcgtaatcc     27000
     agaactgaaa gtggaaccac tttcaggcga agttttccag cttgtacaag cggcatcaga     27060
     ttttgagccg ccttgatgga atacatgcac tgcggatcta tcagcatgac ggccgacggc     27120
     gcagaaagag agcctactgt cccaccatgc agagatgcca gaacagtttt tgtgatctgg     27180
     gcaccatcca tccgaacaga tggaacagct ccaggaatat gctggatttg ctggcgggtg     27240
     acatctcgac cagatgcgtc ccaaagagat cctgctaccg cggcttgtcc atctggcgtt     27300
     gcgtagatta cctgaaaatg ggaaccattt tgcaaaaaca tccctcgaat accatgccac     27360
     tgggcaagat cagttgcgcg tttaccagaa agcgaacgca gagtgtcata gggaacgggg     27420
     attgctgttc caccaagcac tccacgatga tctttgagca agaaatagat aaacacgcga     27480
     tctggcgtat aggctgctcc ggtttcaaag ccatgaaact gacctgggct tgcgagatgg     27540
     gcaccagaac cagtcagacg attcagagca tcatatgagt cagacgggtt tgactggcgc     27600
     ttaggtggta aggatggaga aggagcggat gatgttccgt tactagcaat agagcattgt     27660
     tgagcctgag tgaccgtcgg ttcgagcagg ataagggtaa gggccagcgg ataaaaacgt     27720
     aacacggttt tctccctaca taatgttggg agaaaattta tcgggtcagg atgcgacaga     27780
     ctgttttttt ttgttactac tgcaatttat caaagatgct ggcggtatcc aatggaaagg     27840
     ttctggggtc gcctctggaa gaatgggtct tacgattttc aaaaatcgac taataagacg     27900
     tcgctctgat ggcgttgccc tgcgcctgta ccattttatc acctcaataa gatgaaccca     27960
     ttgctctctt ggaaaagaca aagttaacac gagagacgat cttaatatgg gatgcgggca     28020
     atcagggata acgcggcaaa tatgtttctc caaaaaaaca attgcctctc gaacacatgt     28080
     cggcaaatct tcttttgcca gcaatgcaag ggaagaaaaa ccccgataga attcctcgtg     28140
     cattcaaata atccctttat gccaccagag gttgctgacc acctctattt ccgtattttc     28200
     ttgttggtta agttattacg gatagttact gactgtgtct tcaaataaac catttcacgg     28260
     aaccgggaga aacccctgta cacgcatccg tgaagaacaa atgttcctca atcttggcta     28320
     tgtgtcattt tggtcgcatg acgccatatt aaagtcctta ttcagacctg ttcggtcgca     28380
     tcatcactca gcattttcgt cctaggcttt tgaaggaggc atcatgctcg ctacgattga     28440
     aactcaagaa actgaaacag aggctcaggt cggtggtatt gccgctgatc gcttgcgctc     28500
     gattattgag agggtcgacg cggaaatctc acagaagggt tgtacatcgg gttagattat     28560
     gaaaaagtct gttttgtaga aaagaaattt ccataatcat caagaaaacc cgatgcagac     28620
     agagtgtagc gcaggcgcgt atgagtttcc agcctcctgt ggacggcgtg ttgtggcccg     28680
     ttttgacggg ggtcgcatga gttcggatgg gggcgtaatt ctggtgaagc aggctgatga     28740
     cattctgggt ctcagccgcc gctttgctgc ctgttttcgc gataagcggc atcccggctt     28800
     tgtggaatac cgggttgaag accttgtccg tcagcggatc atgggcctgg cactgggcta     28860
     tgaagatctc aatgatcacg atgccctgcg gcatgacctg atctttggtc tggcctcggg     28920
     tcgtctgtca ggaggccggg caaactgcgc agcattggct ggcaaatcta cactgaaccg     28980
     gttggagcgc agtgggcaca aggcagatcg ttactgtcgg atcattgctg atcatgaggc     29040
     cctggctacc ctgttcgtca cgctcttcct tgaccagcat gagcacgcac ccgcccggat     29100
     cgttctggat gtggatgcca ccgatgaccg tatccatggc catcaggaag gccgcgcctt     29160
     tcatggatat tacggccata actgctatct tcccctgtat gtcttctgcg gggaccatct     29220
     cctcagcgct accctgcgca cggcagacag ggacccgggg aaggaagcac tggcagacat     29280
     ccgccggatc gtggagcaga tcaggagccg ttggccccgg gtgcgtatcc tggtgcgtgg     29340
     ggacagcggt ttcgcccggg acagtctgat gacatggtgc gaagacaacc acgttgactt     29400
     cctgttcggg cttgcaggca acacccgcct gtatgaccgg attgcctctt tgtccgctga     29460
     ggttcgtgac gaagccgcca cgacaggcag agctgcgcgc ggtttcgcct cctttgactg     29520
     gatcacaaag gacagctgga cgcgccgcag gcgggtcgtg gccaaggccg aatggcgcca     29580
     cggcaaccgc tatcatcgct tcattgtcac caccctaccg cagggaatgt ccgacccccg     29640
     ccatctctac gaacagattt actgcgcacg cggggatatg gaaaaccgca tcaaggaatg     29700
     ccagatggat ctgttctcag acaggacctc gtcccacacc atccgggcca accagctccg     29760
     gctgtggttc tcggccgcag cctatgtcct gctgaccgct ctgcaaagac tggcccttgg     29820
     ccagaccagc ctggagacgg cgacctgtgg caccatacgc gcacgactgc tcaaaatcgc     29880
     gacacgtgta acgctcagcg tccgtcggat tgtcctgtcc atgccggaca tgttcccctg     29940
     tcagcatgaa ttcgccctcg ctcatgcacg attgcgaagg ctccggcagg ccatctgaag     30000
     aaacagacag tgcacagacc acatagcttc caccaacact gccttctcag gccgtgacac     30060
     cctcactgcg ttcagaaccc gccgccagaa gcacaatatc gtcaatattc cagatcgggc     30120
     tcctgtggga tgactgaatt ctacaaaata acccgaaatt gcctcaagtg tgagaaatcc     30180
     gcgtcgaaca cgtcacgctt gatgaagact gcatgcggat caccctgcct cactccaaag     30240
     gcgacaagaa gcatcagggc accacgattg ttatcccacg cgggataacc agacattgtc     30300
     cggtacgggc atgggagacg tggctacgac agtcaaaatt gacgccacga aacaagaaca     30360
     aggatactaa accagagaac gtaaacgaga cgactgccgc cttcccaaga atatggttgc     30420
     ctgctgcagc gaaaaataac gagcctcccc ctgcccctaa aattggcatg aagagtcttt     30480
     cagactggtc ggttgccaag attatcaagc agcgctgtca gtcagccggc atcgagggtg     30540
     atttcagcgg ccacagtctg cgccggggtg ctatcacgac cggtgctcag gatggcctcg     30600
     atctgatcag gctcaaacgc ttttcccgtc atcgcgatta ccgcgtcttg gaggcttaca     30660
     ttgaggagga tcaagctctt tcaaaacatc caggaaagac gcgtttttag agaaatttag     30720
     actgatagat gaatgccatg cgattcttaa tgaaagccga ccatatctat cacatcaggg     30780
     aatctatcac atcagggaat cagactgact ctatgcaacg ttgcatagag tcgggattta     30840
     ttggacttta ctcacggcta gtccattgga aaagctccca acaaaatttg gtaagaccaa     30900
     actttcaggg ggaattggac tttactcacg gtaaaattgg acccttctca cacgactctg     30960
     gttaatccac tggactctac tcacacagca aataatataa atctaataat cttcaatttg     31020
     ctgcgtgaga gaagtccaaa atccgtgagt aacgtccaac ctaatcacgt ggaaaacttc     31080
     tgtgagtaaa gtccaacttg accaaagccc acctgctacg tcagggtcag ggtaatggca     31140
     gacgttcatc accttttgtt gcagcatggt cttgatgaag cccggcgatt gcaaaacatc     31200
     gacaagaact ctcgtgcttg tgtcgacgct gcccacgaag tgctgtgcga cgaacaacaa     31260
     gctatcggta tagcacatgc aggcttcgca atggccgccc ttccacacaa aaaacccaac     31320
     tctcctgttt gggaacgcga cggtgggcca gtaaaattac tcattgaaag cggtcttgat     31380
     gccaataaag agcctgtagg cattccttat ggttcagtag cacgactgat acttttatat     31440
     cttcaaacgc aagcagtcag aaataaaagc agacaaattg aacttggggc gtcaatgaac     31500
     gcttggcttt cagcaatgaa tctatctatt ggaggaaaaa cctacaattt agtaagagag     31560
     caaagtcgaa gaattagtcg ctgccgacta acctttttcc gatcagatgc cgggaatcag     31620
     tatgtcagta acggcgcatt cgtacgagac gctatatttc ctctggatcc atcaaactca     31680
     gatcagcagt cactgtggct agaagtagta actctcgatg agtccttcta taacagtctg     31740
     attcagcatc cactaccttt acgtgaagtg gcaattcgcc aaatctcagg taggtcaatg     31800
     gctattgacc tttatatttg gcttgcctac cgtctccaca ttctgccagg gcctgttaaa     31860
     gtgagttggg cagcccttaa aagtcaattt ggtcccgatt atagagaact tcgttttttc     31920
     agacgggaca tcatcccatc tttaaatctt gctttgtccg tttaccctga ggccgtagta     31980
     actatagacg accgtcaagg tctaacccta tttccttccc cggcaccagt aaaagagcgt     32040
     aaccggtatt tgccttaaga aacgtctttg gattggactt ctctcacggt ctggtttact     32100
     cggttttaaa atcacataat cagaaaaaat attttccaat tacatcagtt gtttacgcaa     32160
     aaaaaaagtg tgtgagttta gtccaatatc ctctctgttg atgttgagtg ttgacagggg     32220
     agtgttgatt gctcaacact cactgttgca gatgacagga gagtggtgat gacggaaaat     32280
     aatgcaggca atactcttaa aaaaattagg acgaacttag gtctttcaca ggccgagtta     32340
     aaatccttat taaacgaacg gctttctaga aactatgatc gacacacgat ctcacgttgg     32400
     gaaaacggac gccagcctat cccgtctgag gtgttgaacg aactacagca gctaatcgag     32460
     cgcagacctc agccgttgca agtcatagtc tttgccaacc aaaaaggtgg agttggtaaa     32520
     acgacaagcg ccttaaatgt tgcatatgct ttaagtcgcc ttaactatcg cgtgctgcta     32580
     atagatgcag atccacaagc cagtgcaacc tcagcgctcg ttggcgatgc tttagtagaa     32640
     ctatatcgca atggcagaac actcgatgcg gcgttgctca agggaatccc ctttgcagac     32700
     gtgatactcg acaaatcaac ggaacttgga aacggacgaa ttctaccgtt ctcatttata     32760
     ccaagtcata ttgatctggc cgaagtagat gttcgcaggg aacctggtac agaaggtctg     32820
     cttcgtgagg ccattcaagg cgtacagaat gattttgact acattataat cgatagtcca     32880
     cctcacctag gctttctaac gtggatggca ttaacagccg gaaatcaggt tttcattcct     32940
     gttcgtacag aaccatatga cgttatgggg gtgaacctga tcctagacac gatctccaaa     33000
     gtaaaccgtc ggtccaaccc acgtctgaga attggtggag taattcccac tcaattttcg     33060
     tctaaccaat acgttgatgt tggaataata gagcatctaa taacaacgct tgcggggaag     33120
     gctgacgttt tggaaccggt gccaagtagt actgctttta gtaatgcagc ttgggaagga     33180
     aagatctccg tggaagtatc accgaccaac cctgctgtgc gcccttacgt gagacttgcc     33240
     gaagctatca gcaagggaaa tcagcctacg ctggccaccg atgctttgga cttaaaccaa     33300
     acagaggaag atgtccgtgg ctagaacatt caagaagaga aacccctcgg cctttctaga     33360
     agcacaaaag ggtataacaa cgtctttctc aactccattt ctcggtaagg gaagatttaa     33420
     tcatagcttc gaggtgcagc tttctgaatt agttcctgac cctgatcaac ctcgcaagtt     33480
     tttcaattcg gaagatatta aagcgttagc ttcttctctt tcagaacggg gaattctgca     33540
     gccaatcctt gttagagaag cagaagaagg ttctgcaaaa tggattatcg ttgcaggtga     33600
     aagacggtgg agagcagctg ccagtcttgg ctgggagaag cttccagcta ttgaatatga     33660
     aggtgattat agagcggcaa gcttggttga aaatttactc cgaactgatc tgtcagcagt     33720
     ggaagaggcg cgtgggctac gcaatataat ggacttaaat aactggtcac aaagcgaagc     33780
     aggccgccag ctagggttaa gtcaatctag ggtaaatcgc acgctgcgga ttctcgatct     33840
     cccttgtgct tttttagatt tcgcatcggc tcacgcagtt cctattaacg tactagttca     33900
     aatagtgcgt gaagaggatc caactcagca gcaggtcttg atggatcgag tgatgaccgg     33960
     ctccgcgaca gtggccgaag tgcaggattt acgcaaaaag actgatacga aatcgcagaa     34020
     catagcggac aaaaaaacag gatccgagct gaaggctttt aaaactattc gtagatttat     34080
     aaaggaaacc acaagcatag gtggcaagaa gatagctttg tcagaggaag agaaaaatga     34140
     tctccgacag gctcgcgata tgattgatca attgctgggc tagtagaggt aaacaatctg     34200
     acagttccaa ggctatgcaa cgttgcatag cctttttttt tatttgtgtt cctttctcct     34260
     atgcaacgtt gcataggaca gaaggacaga aggacagaag gacagaagga cagaaggaca     34320
     gaaggacaga aggacagaag gacagaagga cagaaggaca gaaggacaga aggacagaag     34380
     gacagaagat ccaccagtcc tgagcgtgtg gcgcaagtgg ttggtgctcg ccatgctcac     34440
     ccgctacgcg gcctgtgcgt ggctccgctc ccggcgctgc gcaccgcact tgcgccaccc     34500
     actccggccc ggtcgacggg aaggtatcaa ggagaaggaa tagggagaga gtaaacgctc     34560
     ttctcccaac gccttgcacc tgatcccgac caacccagca atcaggcccc cgaacctcag     34620
     aagaggtgtc gggcgaagcc gtttggacgg agtgtgccat catgtccatg tctgcctcgc     34680
     aactcaatct gttcgatact acagtgctgt caggtgaact tgcagccctc tggtctctgg     34740
     aggatgacca gcccataccg gaagtctcac tcccctctcc tcagaccttc cgcatcccgc     34800
     agcgggattt tcgtctgaag ggcgtgcgtg gtctggctca aggctggaaa gcgcttgccg     34860
     aggccaacct cgcagcaatt gccctgctcg gaacacttga gcgcgaggat cggaacgcca     34920
     cagaggcaga gcaggaggtg ctcgcccgtt ttacaggttt tggtgcgggt gaactggcca     34980
     acaacctctt cccgccaaca ggcagagagg tacgcaaggg atgggaaagt cttgcttcag     35040
     aacttgaaca acttacgacg gagactgaaa gggctggcct gcagcgcgcc acgcaatatg     35100
     cccactacac accggaactg attgttcact cgatgtggga tatggccctg cgtatggggt     35160
     ttcggggcgg ttcggtgctt gaaccgggat gtggcacggg gctcttcatt gccgcacgac     35220
     ctgaaaaact ggaaggcaag atcgctttta ccggcattga gaacgatccc atctctgccc     35280
     gtatcgcgcg caagctctat ccgaaccaat ggatccgcag tgaggacttc acgcgtgccc     35340
     agctcccaca gggctatgat ctggcgattg gtaacccacc ctttagcaat cgcacggtgc     35400
     acggtcgtga tgggttagag aagctgggac taagtcttca tgacttcttc attgcccgct     35460
     caattgatgc tttacgacca ggcggtatcg ccctgttcgt gacctcccga tacacattgg     35520
     acaagacgga tccgaatgcc cgacggatca ttggcgagag cgctgacctt cttggcgctg     35580
     tacgtttacc tgaaggcgca atgcgggacg atgccggaac tgatgtcgtg gtcgatgtac     35640
     tggcattccg caaacgagaa atgggggaag agccgtcaaa cgagagctgg gttgaaactg     35700
     cagacatccc agactcagat gaggggaatg gtccgctcgt cataaaccgg tatttccatg     35760
     accatcccga acaggtgctc ggcagtcata tctggacgac aacgcagttt ggtcccggtt     35820
     acacatgctc tgccaccgcc ggcgctgaac tagaccttct tcttccgcaa gccctgaacc     35880
     ggatagcacc caacacgcat ttcctccccc cacgcgaggc ccgcattgtc cgaccagccg     35940
     gtgagggcgt cactattgga actgcagcaa gtggggcgga cctcaaggag ggaagctact     36000
     ttgttgatcg gagtgtgctg caccagatca ttgagggaca ggcgcagatc gtgccgatcc     36060
     gcaaggcagg acagacagaa gggatttttg ccaaacatgc gcggatcatt cgtgcgctgg     36120
     tgcccatccg tgatgccgcg cgaagtgtgt tgcgggcgca gatgcagaac ctgccttatg     36180
     gagcgcagca gcgcactctg aaaacggcct atcagagctt cgtgcgtgaa tttggcccca     36240
     tcaatcatac ccgcaccacg ctacgcgaga accctgaaac tgggaaaaca cgcgaaaccc     36300
     agcggcgccc gaacctgcag ccttttatgg atgatcctga cgtctggctg gtggcttcga     36360
     ttgaggagta tgacgaacgc acggacacgg gccgcatggg gccgatattc tctgagcgtg     36420
     tcattcatgc cccaacagag ccggaaatcc acggagccca tgacgcactg gctgtatcgc     36480
     tacatgaaac gggtcgtgtg gatctgcctc tcattgccga actgctggga cggagtgaag     36540
     ccgatacttt ggctgaacta ggcgaaagtg tttaccttga tccagaacgc agcgtgcagg     36600
     gcagggacgt ctgggttacg gctgatgaga tgctctcagg cgccgtgcgt accaagctgg     36660
     ctttgtcacg tgatgccaca caacttgatc cacggttcgc acgcaatgtc agcgccctgg     36720
     aaggcgtgca gcccccggat ctgcgaccct ctgaaattac agcccgtctg ggagcgcctt     36780
     ggttgcccgt cacggacatt caggacttcg tacaagaggt catggggatt gaaacaaccg     36840
     tccgtcatac cccggaagtg gcatgctgga gtatcaaccg tgcgccgttt ctgtctcgtg     36900
     ctgaagcaac atccgtctgg ggcacggaac gacgcaatgc cgctgaactt ctggaagacg     36960
     cgctgtccca gtccattccc aagatctggg atcactggcg cgatgagaat ggcaatgacc     37020
     ggcgcgaact caatacgcag gaaaccgagg cagccaagga aaaactggcg gctatcaaga     37080
     gcgcgttcga aaaatgggtc tggggggatc ccgagcgctc ggaccgtctc gtaaagctct     37140
     ataacgagac ctacaataac cttgtgccgc gtgcctttga tggcagtcat ctgtgtctgc     37200
     ctggagcgag cagtgtgatt accctgcgtg ctcatcagaa gcgcgtggtt tggcggatta     37260
     tcgcttcagg acgcacctac atggcgcatg ccgtgggagc ggggaaaaca ttctccatgg     37320
     ccgcggccag gctttgttgc gtaaatgctc ggagtggatt cacggaatga atccagactg     37380
     gtagctggga gtgatgagca agccgaaagc cacgcgatac cgtacgacga actggtcctc     37440
     ctacaacgcc gcgctgaaga agcgcggctc tctgacggta tggtttgacc catccatgaa     37500
     ttgggagggc cttccgacgg gacgtcgagg acggcggcag aattacagcg atgccgcgat     37560
     ccagagttgc ctgacgctga aagtgtcctg tttggctttg cgctgcgaca gacgacgggc     37620
     tttgtcgaaa gtctccttcg tctggctgtg ctgtcgtggt ccgtgccgga tttcagcacg     37680
     ctgagccgtc ggcagaaatc cctgacggtc gatattccgt atcgtagttc gggcggtccg     37740
     ctccatctcc tgatcgacag caccggcatc aaggtcgagg gagaaggcga atggcacacc     37800
     cgcaaacacg gggcgtcaaa gcacaggatc tggcgcaaac ttcatatcgc gatcgatgaa     37860
     ggatcactgg aaatcagggc tgttgagatc acgaaaaacg atgtcggtga tgccccagtc     37920
     ctaccggcgc ttctggaaca gatccccgat gaagaggaca tcgcctgcgt cactgctgat     37980
     ggcgcgtatg atacaagaaa atgccacgaa accatcgcca accgtggcgc acaggctgtc     38040
     ataccgcctc gaaaaaacgc aaaaccatgg tgtcccacat caccaggagc catcgcccgc     38100
     aatgaagccc tgcggacgtg cgggcatctc gggcgggcta tctggagacg gtggagtggt     38160
     taccatcggc gaagccgcgt cgagacaaag atgcactgca tcaagctgct gggccagcgt     38220
     ctgacagcac gcgatttcga ccgccagatc accgaagttc acatccgtgt ggctatcctc     38280
     aatcgcttca cagcgctcgg aatccctctc acacacgcgg tcgcgtaatg gaaaactcta     38340
     tagcggcctc gtcacgccaa tagaccgaat tgtgcaacag agccggttac agggcaaaac     38400
     ctattacctt ccattactaa ctgatgaggt tgaaagataa aatgaataat cacgatttga     38460
     ttgagcgtat tgttgctacc actgacattt ccaagaagga tgcaaaaaca gcactcgaca     38520
     cagttttcgc cgcgattatc gaagcagcag ccgagggcga tgacacagcc attcctggct     38580
     ttggcaaatt tgttgtgcga cagacttcgg aacgtaaggg tcgtaatcct cacacaggag     38640
     cagaactggt gatccctgca tcccgtaaac tcgcctttac accagctaag gccgtcaagg     38700
     atgctctaac gggaaaataa gaccgtccgt ggcacctcag aagcggcgga atgatcaggc     38760
     gttgtccgat ggaaagttcc tgcaacttcc tctttttccg gacgccgttt ctctggtgcg     38820
     catatcccca ccttgcaaca tgtggcgcta ttatgatcta tccatccaac aggatttgtt     38880
     cggtggcgcg ttgcttatcc gccgatgggg caggataggg gcacctggaa aggtaagaca     38940
     tgaccttttc ccagatgccg gagccgcagc caatcagctt gcggttatat tccggaaaaa     39000
     actcaagcgc ggttatatcg ttagaccttg aacgtcgtct ttttctatcc atcctttttc     39060
     gtcgcatgat cattgatgat cctgttcatc cgttttgagg aacaggacat actggaatga     39120
     caggctctga cgaacccacc catgccgcgt ggcgtgctca tgtggatgag cagtttgatg     39180
     caatccatga atcacttcgc gcacttcatc aacgccagac acttattctc gaattactga     39240
     ccccagaaga gcgggaaggc ccaactctgg atgacctgct cgcacgcatt gtcaccttga     39300
     ttgccgatca aaggcccgtt ctgcgtcgca ttgaccacac tacaggcacg gctctggatc     39360
     ttcttgaagg acgttcatct cgcacacccc cggatacaaa tgcggatgag gtccccgaag     39420
     aatgatgaca ttccggaaaa tctctgcggg ctgtagaggt caggttatct cgaactatta     39480
     cctgcaggac attcctgatc ctgatattga ttttcgtttg gatccgacca aagcaccaga     39540
     tagcgatggc gcacgtctga caaattatta tacaggccgc gacgggcgtg catcatggcg     39600
     tccggatatg tcgtggcgtg cggctgaggc cctaggcatt gaccgtttca agccaccaac     39660
     ccgagagcag ctttcccatc tctatgaagc tagacgggcc gataatgggg aggaatggtc     39720
     agcacaccag cgtaaaatca gcgcatatga tctgacattg gctcctcata agtctgtaac     39780
     tctggctgca gagtttgcgg aaacagacgc agagcgtgcc gctatctggc atgccatgca     39840
     ggtcgcgaac gacgagacta tgcgttatgt cgcccgtgaa ctggggctag ccagacgggg     39900
     ccggggaggg aaggacggtg ccgaagaagg acatgttgcg tgggtaactt accgccatac     39960
     cacagcaaga ccaacagtcg acgcggaaat ctcacagaag ggttgtacat cgggttagat     40020
     tatgaaaaag tctgttttgc acaaaagaaa tttccataat catcaagaaa acccgatgca     40080
     gacagagtgt agcgcaggcg cgtatgagtt tccagcctcc tgtggacggc gtgttgtggc     40140
     ccgttttgac gggggtcgca tgagttcgga tgggggcgta attctggtga agcaggctga     40200
     tgacattctg ggtctcagcc gccgctttgc tgcctgtttt cgcgataagc ggcatcccgg     40260
     ctttgtggaa taccgggttg aagaccttgt ccgtcagcgg atcatgggcc tggcactggg     40320
     ctatgaagat ctcaatgatc acgatgccct gcggcatgac ctgatctttg gtctggcctc     40380
     gggtcgtctg tcaggaggcc gggcaaactg cgcagcattg gctggcaaat ctacactgaa     40440
     ccggttggag cgcagtgggc acaaggcaga tcgttactgt cggatcattg ctgatcatga     40500
     cgcggaaatc tcacagaagg gttgtacatc gggttagatt atgaaaaagt ctgttttgta     40560
     gaaaagaaat ttccataatc atcaagaaaa cccgatgcag acagagtgta gcgcaggcgc     40620
     gtatgagttt ccagcctcct gtggacggcg tgttgtggcc cgttttgacg ggggtcgcat     40680
     gagttcggat gggggcgtaa ttctggtgaa gcaggctgat gacattctgg gtctcagccg     40740
     ccgctttgct gcctgttttc gcgataagcg gcatcccggc tttgtggaat accgggttga     40800
     agaccttgtc cgtcagcgga tcatggacct ggcactgggc tatgaagatc tcaatgatca     40860
     cgatgccctg cggcatgacc tgatctttgg tctggcctcg ggtcgtctgt caggaggccg     40920
     ggcaaactgc gcagcattgg ctggcaaatc tacactgaac cggttggagc gcagtgggca     40980
     caaggcagat cgttactgtc ggatcattgc tgatcatgag gccctggcta ccctgttcgt     41040
     cacgctcttc cttgaccagc atgagcacgc acccgcccgg atcgttctgg atgtggatgc     41100
     caccgatgac cgtatccatg gccatcagga aggccgcgcc tttcatggat attacggcca     41160
     taactgctat cttcccctgt atgtcttctg cggggaccat ctcctcagcg ctaccctgcg     41220
     cacggcagac agggacccgg ggaaggaagc actggcagac atccgccgga tcgtggagca     41280
     gatcaggagc cgttggcccc gggtgcgtat cctggtgcgt ggggacagcg gtttcgcccg     41340
     ggacagtctg atgacatggt gcgaagacaa ccacgttgac ttcctgttcg ggcttgcagg     41400
     caacacccgc ctgtatgacc ggattgcctc tttgtccgct gaggttcgtg acgaagccgc     41460
     cacgacaggc agagctgcgc gcggtttcgc ctcctttgac tggatcacaa aggacagctg     41520
     gacgcgccgc aggcgggtcg tggccaaggc cgaatggcgc cacggcaacc gctatcatcg     41580
     cttcattgtc accaccctac cgcagggaat gtccgacccc cgccatctct acgaacagat     41640
     ttactgcgca cgcggggata tggaaaaccg catcaaggaa tgccagatgg atctgttctc     41700
     agacaggacc tcgtcccaca ccatccgggc caaccagctc cggctgtggt tctcggccgc     41760
     agcctatgtc ctgctgaccg ctctgcaaag actggccctt ggccagacca gcctggagac     41820
     ggcgacctgt ggcaccatac gcgcacggct gctcaaaatc gcgacacgtg taacgctcag     41880
     cgtccgtcgg attgtcctgt ccatgccgga catgttcccc tgtcagcatg aattcgccct     41940
     cgctcatgca cgattgcgaa ggctccggca ggccatctga agaaacagac agtgcacaga     42000
     ccacatagct tccaccaaca ctgccttctc aggccgtgac accctcactg cgttcagaac     42060
     ccgccgccag aagcagaata tcgtcaatat tccagatcgg gctcctgtgg gatgactgaa     42120
     ttctacaaaa tgacccgaaa ttgcctcaag tgtgagaaat ccgcgtcgac gcggaaatct     42180
     cacagaaggg ttgtacatcg ggttagatta tgaaaaagtc tgttttgtag aaaagaaatt     42240
     tccataatca tcaagaaaac ccgatgcaga cagagtgtag cgcaggcgcg tatgagtttc     42300
     cagcctcctg tggacggcgt gttgtggccc gttttgacgg gggtcgcatg agttcggatg     42360
     ggggcgtaat tctggtgaag caggctgatg acattctggg tctcagccgc cgctttgctg     42420
     cctgttttcg cgataagcgg catcccggct ttgtggaata ccgggttgaa gaccttgtcc     42480
     gtcagcggat catgggcctg gcactgggct atgaagatct caatgatcac gatgccctgc     42540
     ggcatgacct gatctttggt ctggcctcgg gtcgtctgtc aggaggccgg gcaaactgcg     42600
     cagcattggc tggcaaatct acactgaacc ggttggagcg cagtgggcac aaggcagatc     42660
     gttactgtcg gatcattgct gatcatgagg ccctggctac cctgttcgtc acgctcttcc     42720
     ttgaccagca tgagcacgca cccgcccgga tcgttctgga tgtggatgcc accgatgacc     42780
     gtatccatgg ccatcaggaa ggccgcgcct ttcatggata ttacggccat aactgctatc     42840
     ttcccctgta tgtcttctgc ggggaccatc tcctcagcgc taccctgcgc acggcagaca     42900
     gggacccggg gaaggaagca ctggcagaca tccgccggat cgtggagcag atcaggagcc     42960
     gttggccccg ggtgcgtatc ctggtgcgtg gggacagcgg tttcgcccgg gacagtctga     43020
     tgacatggtg cgaagacaac cacgttgact tcctgttcgg gcttgcaggc aacacccgcc     43080
     tgtatgaccg gattgcctct ttgtccgctg aggttcgtga cgaagccgcc acgacaggca     43140
     gagctgcgcg cggtttcgcc tcctttgact ggatcacaaa ggacagctgg acgcgccgca     43200
     ggcgggtcgt ggccaaggcc gaatggcgcc acggcaaccg ctatcatcgc ttcattgtca     43260
     ccaccctacc gcagggaatg tccgaccccc gccatctcta cgaacagatt tactgcgcac     43320
     gcggggatat ggaaaaccgc atcaaggaat gccagatgga tctgttctca gacaggacct     43380
     cgtcccacac catccgggcc aaccagctcc ggctgtggtt ctcggccgca gcctatgtcc     43440
     tgctgaccgc tctgcaaaga ctggcccttg gccagaccag cctggagacg gcgacctgtg     43500
     gcaccatacg cgcacgactg ctcaaaatcg cgacacgtgt aacgctcagc gtccgtcgga     43560
     ttgtcctgtc catgccggac atgttcccct gtcagcatga attcgccctc gctcatgcac     43620
     gattgcgaag gctccggcag gccatctgaa gaaacagaca gtgcacagac cacatagctt     43680
     ccaccaacac tgccttctca ggccgtgaca ccctcactgc gttcagaacc cgccgccaga     43740
     agcacaatat cgtcaatatt ccagatcggg ctcctgtggg atgactgaat tctacaaaat     43800
     aacccgaaat tgcctcaagt gtgagaaatc agcgtcgatc tcgcggatcg gaagatgatc     43860
     tcggcagtgc caccggcgga tcacactcag aagctccatg tcaatcactc caaaaacccc     43920
     cagcagatga tgccggggag tgtgaaggca tgggtcaaat ctcgatgaaa atttccgccc     43980
     tacccgggtc agttctcagt gaaaatcaac accatcgtcc tgccgcttcg ccttcgtgaa     44040
     cttaagtgtc catcgtgcat gacgatcctt atgcgacatc tttgcgggct tgtcctgcca     44100
     gtcttctgga atacgtcctg cccggagatc cgctttctca gcgttcgtat tgcgctgctt     44160
     tggagcagcc accagtgttg catccaggat ctggccggac atcgggagat aaccggcgtt     44220
     ccgcagggtc gcgtcaaatc ggtcaaacag cctttcaatg gcacccgcct gtgtcaaacg     44280
     ctcacgaaac agccagaccg ttttggcatc cggcacgcgg tccgacagcc ccaatcccag     44340
     aaagcgcatg aacgacaggc ggttgttgat cagatactct gtccgttcat cagacaaatt     44400
     gttcaacgtc tggatgacca gaattttgaa catcagcacc ggatcaaacg gcggacgtcc     44460
     gcctttactt ccgtccgaat aggctagagc cagctccaga tcagggcgga acacctcaaa     44520
     atccacagtc cgggaaaagg cctccagctg atcgccaagc ccgctcagcc gagcaaggcg     44580
     ctcttcaaca tcaaagaaac caggctgctt catcttccac catccccaat caacgccgaa     44640
     gaaatggaat cacacagaac agctcagaga caaagggttt ttcgaaccct ccaggttatg     44700
     gcgctgattg cacagcgcag cacagtgaac gtcaaggggc agtaacctgc acagatacat     44760
     gcactggtag aaaaatgctg gggttgaggc ggttcggaac aatcggacac aaaatgagtt     44820
     tcaggcatcc attcttatat aatctatttg ctacctatta ttttgcttaa cgtatggcat     44880
     gggaaaggag ggaatataaa aaatagaaga ccggtctatt ttttatatgg acaggcaatg     44940
     tattcgtcca tatataagct cctatgaaga ttgcagagaa acatcacgct gctcggcagc     45000
     acatcctgaa agcggctaaa ccgcttatcg gccagcgtgg tttttcggct gttggtctga     45060
     cacaaatatt ggatgttgcg ggagttccca agggctcttt ctaccattac ttcgaatcaa     45120
     aagaagtatt tggggaagag cttcttagaa cttatattga agattatctg gtaaaaatgg     45180
     atgatctttt tgaaaatgca gatggtaatg cagccgaaaa aatagcgcgt tactgtcagt     45240
     tctggcgcga tacgcatctt agtaagcaga ttgggaataa atgcctgatt gttaaacttg     45300
     cagcggaagt ctgcgacctt tcggaacgga tgcgggccat tctggaaggt ggcaccaaga     45360
     gtgttattga ccggcttagc gcacttatca cggcggggca gggagaaggc tcaataggca     45420
     accggcagga gccggaaatg cttgcggcct cactttacca gctctggctg ggttcgaccc     45480
     tgatagtgaa aattacacac agttctcagc cgtttgacca agcatggcag gcaaccaaac     45540
     ggcttctgga aatctagaaa gcagggaaag cgcacagcgt tttactttgc gcaataaata     45600
     gacgaccggt ctactataaa gaccgatctt aataaggtgt ctcaatgcag aactttgaat     45660
     tctataaccc tacacgcatc ctgtttggca aaggcatgat agctcggctt gatgaacagc     45720
     tatcgcccga agcccgcgtg cttgtgcttt atggtggtgc aagtgccgaa cgtagtggca     45780
     cgttggctga agttcgggca gcgctgggga accgcacttt ccgtgagttt ggcggtattg     45840
     aagccaaccc tacatatgaa acccttatga aggccgtggc tctggtgcgg gaggaaaagc     45900
     tcgacttcct tttggctgtt ggtggcggct ctgtcatgga tggcaccaag tttgtcgcgg     45960
     ctgctgtgcc gtatgaaggc gagccgtggg atattcttgt cagcaagggt aaagccgcaa     46020
     caaaagcgct tccgctgggc acggttgtca ccttgcctgc cacgggttca gaaatgaact     46080
     gcctaagcgt tatttctcgc cagtctacgg gtgacaagtt gttgttctcc aacccgttgg     46140
     tctatccgcg tttttctgtg ctggacccca tgcgcaccat gagtttgccc atgaagcagg     46200
     tgattaatgg ggtggtggat tcctttgtcc atgtgatgga acagtacatg acctatccgg     46260
     tcgatggcat ggcgcaagat cgcttctcag aagggctgct gtccagcctg gttgagatcg     46320
     ggccgcgtat tgtcgcgaca ccagatgatt atgatctgcg ctccaacctc atgtgggttg     46380
     caacgcttgc cctgaatggc ttgatcggcg cgggtgtgcc ccatgattgg agcacgcaca     46440
     tgattggtca tgaaattacg gcaaaatacc acattgatca tgcccgcacg ttggccatcg     46500
     tattccctgc gttaatcaag gttcgtcgtg ccgaaaagcg cgccaagttg ctgcaatatg     46560
     caacgcgggt atggaacctg accgatggta cggaagatca gcggattgat gttgccattc     46620
     gtaaaactga ggaatttttc gaaggtttgg gcgtaccaac ccgtctgtct gcctatgaga     46680
     ttggtgctga aggcatcaac gatctggttg gtcagcttga agatcatggc atgacgcatc     46740
     tgggtgaaaa cggtgatgtt accctagatg taagccgcaa aattctggaa gccgctgcct     46800
     gacctgaagt gccgctatcg ccggggtgaa ggggaacagc ccgttatccc ggcaaccaat     46860
     aaattaatga gaaacgagac ttaaaaatgg cttacgccac aaccaatcct tatactaacg     46920
     aagttgttgc aactttccca gaggctactg atgcggaagt tcagaccgca ttggccgagg     46980
     cgcatgctgc tttcgaagct tggcgcgata catcctttgc agagcgagca aaggtaatga     47040
     atgccgctgc tgccattctg cgtcgtgatg ttgataagta tgcccgtttg ggcacgctgg     47100
     aaatgggcaa gctgtttgaa gaatctaaag cagaaattat tctttctgct gaaatttttg     47160
     aatactatgc aaaacatgca gaagcacttc tgaagccgga attgttgcct gtagcagacc     47220
     cggcagaagg caaagccatg ctggtgcatg agccgcttgg tatcgtgctg gcaattgagc     47280
     cgtggaactt ccccttctat caggtcgtgc gtattattgc gccgcagctt tccgctggta     47340
     acgccgtgct gctcaagcat gcttccaacc tgccgcagtg cgctgctgcc tttgatacac     47400
     ttatggcaga agccgggctg cccaaagggt tgttccgcaa cctgtatgca gcacgcccgc     47460
     acacagccat gattttgaat gaccctcgcg tatgcggtat cgcactcacg gggtcagaag     47520
     gcgcaggcac ggttattgct ggtattgctg gcaaggcact gaagaaggcc accatggaac     47580
     tcggtggagc agatgctttc attgtgcttg atgatgctga cgttgaaaaa gcagcgcgtt     47640
     gggcggtcat cggtcgccac tggaatgctg gccaagtttg tgtttctgca aagcgcctga     47700
     ttgtagctga tgctatttat gatcagttcg ttgctcttta caaagaaggt gtcgcagctc     47760
     tcaaagcagg tgacccgatg gaccccaaaa ccacgctggc tccgttgtca tctcaggctg     47820
     ctgctgatga cttgcgcgat caggtcacgc gggcgatgga tcttggtgcc aaagttgagg     47880
     taattggggc gccagttccc gaacagggtg ctttcttcca gccgttgctt atgtccaatc     47940
     tggatcagaa aaaccctgca cgccattggg aattttttgg acctgttacc cagatctacc     48000
     gcgcgaagga tgaggccgac gccatccgca ttgccaatga ttcgccctac ggtctaggcg     48060
     gcagcgtatt cacaaaggat gaagcccgag gcacccgtgt agcacgggcc atccgtaccg     48120
     gtatggtggt gattaaccat ccactatcgc ccaaggcaga cctacctttt ggtgggatta     48180
     aaaactcagg ctatggccgt gaattgattg gcctcggcat taaggagttc atcaaccaca     48240
     agctcatcaa tgtagtggat atcgacgcag cgttctgatt tgtatgattg gaagtggcca     48300
     acatttctgg atgattttcc aaagatgatg cctgcaccgt atagtgtgaa agccgcatag     48360
     gccgtaacag acaacctaaa aaggggcttc cattgtggag gtcccttttt tgtatggggt     48420
     ttggttgcgc taaaatggga ttacggactt catctcttac gcaacatgtc ggctttattc     48480
     agaggcaggc tgatgacgat tgccatcatg atttgtgatg aacattaggt gtttggtccc     48540
     ggggtttgat gggttggatt gatgatgaat ctttctggct ctgaagtcca tattttgcag     48600
     aggtattcgt aaggcgtgag gccactcagc gtcttgagcc ttcgcccgaa attataagct     48660
     gccatgaagt cgttgaggtg tgtcctcaac tgctcatgac tgtcgtaatg gaagcgtttg     48720
     acggttgcct ctttgattgt ccggttcatc cgttcaacct gaccattggt ccagggatga     48780
     ttgggtttcg tcagacgatg ttcgatcccg tgggcttcgc agatcatgtc gaagcgcatg     48840
     ggacgcgact aggccgtatt gcgattacgg ggttggtcag cgaactggat cccattgtcg     48900
     gtcaggatgg tgtggatccg gtaagggatg atgctcagga gatgttcgag gaattcccag     48960
     gccgtcttcc gatcagcttt ctcgaccagt tgtgtgacag cgaatttgct tgtccggtca     49020
     atggcaacga agaggtacag cttgccttca gcggtctgga cttccgctat gtcgagatga     49080
     aagaacccga tcgggtagcg tttgaagcgc tggcgtttgg ctttgtccct ctctatgtcc     49140
     ggcagtcgtg aaatcccgtg acgctgaagg cagcgatgca gggccgagcg tgtcagatag     49200
     ggaatgctgg cctgcagggc ataaaggcag tcatccagcg gcagcaacgt atgccggcga     49260
     aaggccacga tcatcgcttc gtccgtctcg gacaggaccg ttgagcgcgg ctctttagga     49320
     cctgtcttct gatcttcgac actctgtcgc ttccgccatt tagccactgt cttcgggttg     49380
     atcccgaact cctcgctcag cgccgcgagc gaagcctgcg atcgctgtat tgctgctcgc     49440
     acggcgtgcg tggtcgtggc gctcccatga cgtatctgtc ccataatgct tccttccact     49500
     ctcgtgaaaa tatcacacca tcaaaccccg ggactaaaca cctaactgac gacacgccgt     49560
     agcactacag ttgcattttg tgtcgtgagt gagcgcggat agcactggcc tgatgcgttc     49620
     gtcgaaagac ggaccatctg aggatgtgag agacgggtag tctgcgttgt gcaagtttta     49680
     cgacgaggcg cctgatctcc tgaatggacc agcggacaag gactgtcgtg ttctgagttg     49740
     tgtttttttc ggtttcagtg agtttgcctg gtaacggaca ctggccatga cggcataggc     49800
     cagcatgacc agagagacat gccgatgcca accatgccag gagcgggtct cgttatgatc     49860
     aagaccaaat tcgtttttgg ccgtctcgaa cccttcttcg atcctccagc gcgtcccttc     49920
     aacgttcacc agttcctgcg tggttgtccc tttcgggctc caggtcgtaa aataggcaag     49980
     gtccccgtca gcgatgtttc ggcggatcaa caggccacgt gtccatggtc cggctatagg     50040
     gcagtcaaat tcttcagcat ccagatcagc aagcggaaga tacgcccagt cataaagtcg     50100
     ctcacctttt gtgccgtgcc ccgctgacag acgacgccag gcctggtctg gcagtcctgc     50160
     tgcaatatct ttcgcctctc cggcaatcag cggttccgtt gcccatgatc cgaaccagtg     50220
     attgcccttg accccaagca catatccaat tcctgcccgg cgaagcgtgc gttctacgtc     50280
     gcccacgcca tacacgctgt ctgctgcaac ccagcggaac ggcacaccgg cctcaatact     50340
     tcgctcaatc atcatcgagg ctaacgccgg tttggttgca aacaccacgt catcgggaac     50400
     gtgggcccgc ttcagacgct caggctttga tgtccagtct ttcgggagat acagggcgcg     50460
     gtcaataaag gcatgccccc gttccgaaac ataagcgcca aacacaccaa tctggcagtt     50520
     cgtgatcttg ccggcagatc ccgtatactg ccgccccaca ccgcaggacg cctgaccctt     50580
     cttcagaaaa ccggtctcat caatgaccag cacgccctct tcagtgccca gatgctcaat     50640
     cacataatcc ctgacgacgt cacgaagggc atcggcatcc cagtgcccgc gtcccagaag     50700
     cgcctgctgc cgccatggac caggatctcc tgcggcttcc gctcgcatcc atcccgtctt     50760
     gcgtggttca ttgccaatca aaacatcaag aaaagcacag gccgaatcta cgacacgttt     50820
     ttgcgtgaac agcggcgcca tccgatcctt ggcggaccga agcgagcgcg cccataattc     50880
     cagcgtctct tcaacagacg taccgccact catcatatcc tgaatcatgg ttacccatag     50940
     attcagaact caacacaaaa tgcaactgta gtggtaggta gcttttccag atgtacgaaa     51000
     attccggtaa ctggcggttc tgaggacgaa gcagccgtga aaagccgttt aggtgaatgt     51060
     ccgatgccgt ggttacggat ctcaataacc gaccttctgc attccccccc gatctgcctg     51120
     tctgctcagc gatacaggag cagacaggca gcagtcgcct acatgtcaga catagaaaag     51180
     agccaaacaa tgctccgaaa gcggacgtta tctctagaat taaaatgctg agatctccga     51240
     gttaactcgt tattttatta ttgccacgaa cgagccaata gacgatcccc aaggccagga     51300
     ttgccgccga gagtgccaga acctccatga cgtcgaggcc gctgagatcc aggacaataa     51360
     atttgcgaac ggtcgccatc ataccgatga gaaggacgga ccgcattctg accatgctgt     51420
     gcgagggtgt gtcgggcgag acaagaatag agtgtttgaa ttccagtgca atcaggactg     51480
     taaaaaacag accaaaaagg ctctgtagaa ccacaggatt ggtcggggaa agggttgctg     51540
     ttcggagcat ttcaaaaacg gcgtatagca catgtatgag accaagggcc gcgacgacca     51600
     tgatgcagag cgtaagaacc agcatagcga tctcttcaaa aagatcgaaa atagaagaaa     51660
     tcttctcaaa tcctggtatg tttttaatca tagcctttgc cgtccttttt agcctatgtc     51720
     tgcgtagtta gaaacctaat accgcatcag ctccgaaagt gaactgacca acatttctaa     51780
     ggtcattaaa tggcctcgtt ccgttcagtg agcgatcaaa ccggacttca ggacggatct     51840
     cgaacaactt gacggaatga ccgagcacgg gacgccaggt agcacccagt gtcagggcac     51900
     cgtacgtcgt cggcggtgct gattgcgtga cggtgggttt accgagcgtc gcttgcatgt     51960
     aggcattatt tgcgatgaag gatgttacaa acagaccggt atcatcacga tagatctcgc     52020
     cgcggtaatt tagaagaagt gtgggagtta attgatagga aaggtagctt acgaagctgt     52080
     aggtgttggc atgaagccct tcatcgtgca ggaagttcag ctcaccggtg aaggtcagtc     52140
     ggtctgaaat cttgtaactt ccgctaagat cattccagta acgttgagcc gagtttgcac     52200
     gctgtccgag ggaccgagta gagttttcag gaccgacgcg accgaggtat gtcagagaca     52260
     gtttgccatt tgccagactg gacgctgtca gaccgaaata tcccgcagca gtatgattgt     52320
     tgtcacctcc cccgaacgag acctgattgc ccgtgtccac tccgaataat gcgtcgatat     52380
     ggtcggtcag gtgccattga aacattgcgc ccacatgctc gaacggcgtg gaatactcag     52440
     tcgtatagga cagggtatag aaaggacgga gtgaggggtc gagggattcc acgcccatag     52500
     gggaggccag tatgccagcc tgcatgtcca gaccatggcg ggttaaccaa ggcaggtgaa     52560
     cgtcgagatg ggcctgaggc acaatgaact ggtaacgact ggtcattaac cggtctgtga     52620
     tgcctgcaat attaaagtac cgcccgtcgg caccgtagag cccccggacc atgaagccca     52680
     cgtcgtaaga cgatgctgtc gtatcgactg cacgcgcagc cgtcagcgtc agctggtcga     52740
     gttgcgcctg attggccctg tcaccgaaga actgtccgaa attaatccca tttgcagggc     52800
     gagaaacgtt tgcgtttatt cctccctcga tctgccctgc aagggtgatg tcatcgagcc     52860
     actccgtggc aggcttcgcg atcgcatcgt tcatgtccag aagaaccatc gtaatggctg     52920
     ctgtcaggaa aaaacctaca tttccagatc ggggcgtcca tttcaggaat gcagatttgt     52980
     ccagataaac tcttgtcatc attgtcgtgc tctcgccgga aagaaacgcc gcataaaacg     53040
     gatctgacat cagaagtccg gtcgagcgac atttcggagc tagtctccga agacagggcg     53100
     cgacaagtcg ggaaagggat agaaccagcg ttttagggca aattcctatg actttcctat     53160
     aaagatcgta gacttcttat ctgtcattcc tatgcggtcc agctggatat ttagagatgc     53220
     acacaaggag cattctcgca tgctggatat tctgtatctc acacttgggg tgttcggctt     53280
     cggcgtctgc gtcgcctaca tctccatttg cacgagggtc tgatcatgac ctttgaactc     53340
     atcatggcca gcgtcgtcac gctcggcctc ctaggctaca tgacggcggt tctcctgcgt     53400
     ccggagaaat tctgacaatg tcattttatg gctgggtcgc catcatggcc ttcctcatct     53460
     gcgttattgc gatgacgaga ccgcttggtg gtttcctcaa acgtgttctc gaaggagaac     53520
     agcatgttct cgggcggatc ttcggtccgg tcgagcgcgg catctatcgc attgcgggca     53580
     ttcacaagga tcgggaacaa tcctggtcgc aatatgcgat cgcggtcatc gtcttcaagg     53640
     ttatttgctt tattgcagtt tacacgcttt tgcgtgttca gggcgtcttg ccgctcaatc     53700
     caaatggcat gggcggcgtt gcgcccgatc ttgcctataa taccgccata agtttcctga     53760
     caaatacaaa ctggcagagc tatggcggcg aaacgaccat gagtcatctc acccagatgc     53820
     ttgggttgac ggtccagaat ttcgtctcgg cggcggcggg tattgcgatc gccgcagcgg     53880
     tcattcgtgg atttgcgcgt cgtagtgcaa cgtcaattgg caatttctgg gctgatctcg     53940
     tacggacgac gctctatgtc ctgctaccga tttgtgtcgt cttagcgttg tttttcgtgc     54000
     ttgaaggcgt gcctcagact cttctgggtt ctgtcactgt ctccacattg gaaggtgcgc     54060
     gtcaaacgat agcctttggt cctgtagcat ctcaggaagc aatcaaaatg ctcgggacta     54120
     atgggggcgg tttcttcaac gtaaactctg cccatccgtt tgaaaatccg aatgcattaa     54180
     ccaatttcgt gcaaatgctc gccattttcg ctttgggtgc cggactgacc aatatgttcg     54240
     ggcgcatggt cggcagagag cggcaaggat gggcgatctt ctccgctatg gccttgcttt     54300
     ttcttattgg tacaggagtt gcctactggt cggaagccca cgccaatcct ttgatcactg     54360
     cgctcggcgc cgatccatct gcgggaaata tggagggcaa ggaaacgcgc tttgggatta     54420
     ttggctccgc attgtttgcg actgtcacga cagacgcatc ttgcggtgct gtcaactcaa     54480
     tgcatgaaag tttcttgccc ttaggcggta tggtgccgtt actcaacata atgcttgggg     54540
     aaattatatt cggcggcgtc ggatcgggtc tttatggctt cctgctgttt gccatcattg     54600
     ccgttttcat ggcgggcttg atggtcggac gcacaccgga atatctcgga aaaaaaattg     54660
     aggcgcgtga gattaaaatg acgatgttgg cagttctttg cctgccgctc gttatgctgg     54720
     gtttcaccgc gcttgctgtt gtcgtgtcac ccgggttatc ggctttatct gcgagcgggc     54780
     ctcatggttt tactgaagca ctttatgcat atacttctgc ggcagggaac aatggtagcg     54840
     cttttggtgg gctgaccgcg aacacgttct ggaacgtgac gctcggtatt ggcatgatgg     54900
     caggccgttt cttcgtcatc attccggtac tggccatcgc aggggcgatg gcagctaaga     54960
     aaacagccac tcccacgcct ggcacattcc ctaccgatac gggtctcttc atcgccctcg     55020
     tgacaggcgt gatccttatc gtgggtggac tcaccttcct tcctgcactc gctctcgggc     55080
     cgatcgtcga gcatcttgcg atgctgggcg gcaccctgtt ttaagaggcg catcgttcat     55140
     ggcactccat ttacctcatt ccgaagcccc tcatggaggg cggcattcgg aacatcgcag     55200
     tcagagcagt ctgatgcagg cgtcgctttt gctgcctgcg atcagggaga gcttccgcaa     55260
     gctcgatccg cgcatcatgt ggcgcaaccc ggtcatgttt gtcgtggagg tcgtgaccat     55320
     tctgacgacc gtcctgctca tacgcgacat agtcgccggg ggaacacatc ttggctttgc     55380
     gatccagatc aatctctggc tctggtttac actccttttc gccaatttcg ctgaagccgt     55440
     cgcggaagga cgtggcaagg cgcaggccga cagtctgcgt cgcacccgga ctgaaacact     55500
     tggcaagcgt ctcttgatga atgacgaggg cggctattcg catctcgggt tgtatgagga     55560
     agtgccagct cccgaactcg tagtggggga cgtcgtgctg gttcaagctg gcgacttcat     55620
     tccaagcgac ggcgaagtcg tcgacggcat tgcgtcggtt gatgaatctg ccatcaccgg     55680
     tgaatccgct ccagtaatcc gcgaaagcgg tggtgatcgc tccgcagtga caggcggcac     55740
     gcgcgtcctg tcagactggg tcattgtgag gattacagca gcccagggtt ccaccttcct     55800
     tgatcggatg atttcgcttg tcgaaggcgc acaacgccag aaaacgccta acgagattgc     55860
     actgacgatc ctgctggcgg gcatgacgct gatctttatc ttcgcggtcg cgacgatccc     55920
     gagcttcgtg cattacgcgg gcggccatat ttcggttctg atcctcgtcg cgctgttcgt     55980
     gacgctgatc ccgacgacca tcggtgctct gctttcggca atcggtatcg cgggtatgga     56040
     tcggctgatc cgcttcaatg ttctcgccat gtcgggtcgc gcggtagaag cagcagggga     56100
     tgtcgatacg ctgctactcg acaagactgg tacgattact attggagaca ggcaggctac     56160
     agcgtttgtt cctgtttctg gcgtaacgga acacgaactt gcggatgccg cacaacttgc     56220
     atctttggct gatgaaacgc cggaagggcg ttcgatcgtg gtgctggcca aggagaaatt     56280
     tggtatccgg gggcgtgata tgcgtgacct cggtgcgcat tttgtcccat ttacggcgca     56340
     aacccgcata agcggggtag acgttgggga caggcagatc cgtaagggtg cggtggatag     56400
     tgtaatcgca agcctcgggg aaaccctgcc atctgtcgaa cagatccgtc agattgccga     56460
     cgacatcgct cgtcagggtg gcacgccgct ggcagtcgcg gataatacgc gcctgcttgg     56520
     cgtagtacat ctgaaagacg ttgtaaaagg aggaattcgc gaacgctttg cggaactacg     56580
     ccggatgggg atccggaccg tcatgatcac cggggataat cccatgacgg ccgcagccat     56640
     cgcagcggag agcggcgtgg acgatttcct ggctcaggca acgccagaag cgaagcttgc     56700
     actgatccgt tcggaacagg catcaggcaa attggtggca atgtgcggag atggtaccaa     56760
     cgatgctcca gcgctagccc aggccgatgt tggcgtggcc atgaatactg ggactgttgc     56820
     cgcgcgtgag gccggcaaca tggttgatct ggacagtgat ccgacgaaac tcattgagat     56880
     cgtggggatt ggtaagcagc tgctcatgac gcgtggtgcc ctgacgacgt tttcgatcgc     56940
     caacgacgtc gccaaatatt tcgccatcat tcccgccatg tttgttggct tctatccagc     57000
     actttccgcg ttgaacatca tgcatcttgc tacaccagaa agtgcggtgc tctcggcgat     57060
     catctttaac gccctgatta tcatcgcgct cattcctctg gcgctgaagg gggttcgtta     57120
     tcgtccggtc ggcgcggcat cgcttctgcg gcgtaatctt ctggtttacg gtattggcgg     57180
     ccttatcgtc ccgtttatcg gaatcaaact catcgacatg ctcgtgacga gcatcggtct     57240
     ggcctgagga cactggcatg actcttatcc gtcaacttcg tcccgcgctg gtgattttcg     57300
     ggtttctttc cgttctcacc ggtctgctct atcccctcgg catcactgcc atttcgcatc     57360
     tcttactgcc agaaaaagcg ggcggcagtt tggtccatga aaatgcccaa acggttggtt     57420
     ccgcgctgat cggtcagaat tttacgcaac cgcgctattt tcatggccgt ccctcggcaa     57480
     cgacaggtgc tgacccgaat gatccgacga aaaccgtccc gacaccctat aacgccgcgg     57540
     cttcgatggg gtccaacgcc agcccgacgt ccagggcgct catcgaacgt gtcaggattg     57600
     ctgtggcgca attgaagaca gagaatccgg acgccattgc ggcgggctgg tcgattccca     57660
     tggatcttgt gaccacgtcc gccagtgggc tggatcctga tatttcgccg caggccgctc     57720
     tttttcaagt caagcgtgtt gcacatgcac gtaaccttcc cgagcagacg gtcaggcaac     57780
     tggtggaaca catgattgca catcccctaa tggggtggct tggcgaaccg catgttaatg     57840
     tgctggaact caacatggct ctggacgccc tgcacaggta atggaggcac atctcattcg     57900
     cccggatcct gacgcccttc ttcggcagac tgtgttggac ggtgaaagcc gcaaacgagg     57960
     tcgtctcaag gtatttcttg gggcggctcc cggtgtaggt aagacattcg aaatgctgac     58020
     tgttgcgcat cagttgcagc gcgatggtgt ggacgtcgtg attggggtgg tcgaaacgca     58080
     tggccgtgct gagacagctg cgctggtgaa tgggctggaa ctggtgccac tacgtaccat     58140
     gacttaccgg gaccggatgg cgcaagagat ggatcttgac gcggtgctca ggcgagctcc     58200
     gtgcgtcgcg gccgtcgatg aactggcgca tacgaacgtg ccaggttcac gccatccgaa     58260
     acgctggatg gatgtcgaag agctgctcgc tgccggaatt gacgttctga cgaccgtcaa     58320
     tatccagcat cttgaaagcc tcaacgatat tgttgcgtct attacgcgga tccgcgtgcg     58380
     ggaaacagtt cccgaccacg tgatcggaga tgcagatgag gtcgaactta tcgacctcac     58440
     tccgaacgat ttgctacagc ggatgcgaga cggcaaaatc tatgccgagc atactgccgg     58500
     acgggcgatg ctccattatt tttcaccagg caatctgacg gcgctgcgtg agctggcgct     58560
     gcgccaaacc gcgcagcagg tggacgcaca gctcgttgac cacatgaagg ccaatgcgat     58620
     tgttggccca tgggcggcag gtgaacgaat aatggtctgc ctgactcttc aggacgggga     58680
     tgccagtctc ttacgttatg gtaagcgtct ggcagatcat cttcacgctc cctggatcgt     58740
     gctgcatgtc gagacgaacc gtgatctgag cgatgccgct cgcgcaacaa tggcctcaca     58800
     gatgcatctg gcgcaatcgc tcggcgcgga gcttgtcacg ataccaggac aggacgtggc     58860
     acttgatgct gtcgcctatg cgcggacgca aaatgtgacg cagatcgtag ccgcgcatcc     58920
     ggttgggcgg ggctggagcg cccgagttcg gcaatggctc ggcaggtcga cgacggaacg     58980
     cctgatacag tttgcgcagg gctttcctgt ccacgttgta ccgcgctctc caggcgagaa     59040
     tgccccaacc gaacaactac ttaatatcgc tcctttcacg gcacgccctt atgtcgtcgg     59100
     gaccctgatt gtgctcggtg cattagtcgt ggcacttctc ctgcgtcaga gcttcgaggt     59160
     cagcaacgtg tcgctggcct ttctgaccgc gatcctcggt gtggcggtcg cctatggtct     59220
     ttggccctcg ctatgggctt ctctgatggc gatgctctgc ttcaactttt tttttctccc     59280
     tcctttttat acgctgacaa ttgcggctcc agacaatgtg gtggccctat tttttttctt     59340
     ggtaacggca ctcattgcta gcaatttagg tgcgcgtgtt cgcaatcagg ccgtcgtggc     59400
     acggcatcgg gcggacatca cacagtcatt gtatcatttc agccgtacga tcaccgggat     59460
     cctccaactc gaagatttgc tgtggtcggc aagccatcaa attgcgacaa tgcttgactg     59520
     tgatgtggcc atgttgctcc ctgacggtga gattctgaaa gtcaaggcat cctacaatgg     59580
     cggaaaagcc gttggggctg ccgatctggc ggcggcaaca tgggcctgga agaacaataa     59640
     agtagctggc cgaggatcgg ataatctgcc gggtgggcga tggcttttca ttcctctgcg     59700
     gaccggacgt ggaccagtcg ccgtgatcgg tcttcatgca gaaagaacag gacccattct     59760
     cgaccttgaa caacaggggc tgctggatgc attggccgat cagaccgcct ccgccattga     59820
     gagtatcctt ctggccggcg aactggatca ggcacgcctt gatgtcgaaa ccgataaatt     59880
     acggggggca ttactgacgt cgatttccca cgatttgaga acgcctctgg cctctattct     59940
     gggcgcaacg tccagcctcg aaagttatgg cgaggagctc gacgaaaatg cgcgcaagga     60000
     actgctctcg accattcatg acgaagccga ccggctcaat cggtttgtcg ccaatctgct     60060
     cgacatgacc cgtcttgaag ccggggcgct ccagcctcgt aaggaacgtg tggatattgg     60120
     cgaagtgatc gccagtgctc tttgccgtgc agctcgtttg ctctctgatc acgagacaga     60180
     aatggtcatc gagcctgatc tgccgatgct acttctggat gatgtccttc tagaacaggc     60240
     actcttcaat atcctcgaca acgctgggaa atatacgcct gttgggacga aaatagttgt     60300
     cacggcgtcc gtcgctgctg atactctgct tattcgtgtg acagatgagg gcgagggatt     60360
     tgcggctcac gatcccgaaa ccgctttcag taagttcaaa cgttttaaat ctgctgatcg     60420
     gtctcgtcct ggaactggtt tagggcttgc tatctctcgg ggtttcattg aagccctggg     60480
     aggaaagatt gtgtcacgca atcgaaagga ctgctctgga gcagagttgg ttatgacgtt     60540
     tcctttggac gagaaaaata caaaatgagc aatccatcgg tcttggtcgt ggacgacgag     60600
     cctgccattc ggcgcctcct cagaacagcc ctcggcagtc aggcatggcg tgtgatcgaa     60660
     gcccggacgg gggaaatggc cctgaacatg gccatggagg ttgtgccgga tattgttgtg     60720
     cttgatctgg ggcttcctga catggatggc gtggacgttc ttcgacgcct gagaagcgct     60780
     catccaactt tgcctgtcgt gatcctctcg gttcgagatg acgaacgggg caaggtcgcg     60840
     gcacttgaag ccggtgctga tgactatgtg accaaaccat tcagcatggc tgaacttgtc     60900
     gcgcgcatgc gcaacgcagt gcgacacgca ctccagcagg aaggtaccat tccgctcttc     60960
     gtgtcaggcg atttgagtat tgatctcgtg cgccgccaga tatctcgtgg cgaaagtgaa     61020
     atccgacttt caccgcgtga atgggatatt ctgcgcatgc tggttcgtta tgcggggcgt     61080
     gtcctgaccc atcagaccat catgagtcag ttgtggggtg caacaggaga tgtacagcaa     61140
     cttcgtgtct atatcaggca gatacgtcag aagatcgaaa tcgatccgga gaggccacgt     61200
     catatcatca ctgaaacggg agttggatac cggatggttc aattgtaaaa attttctgac     61260
     catctcttca cacatcaaca ttattttatg aattgaaata aattgagcct aattcaagcg     61320
     aatgttatgt ggaaactgaa attcttgctt cccccttatg ctgcctgtcc attcaaggaa     61380
     tatgaagtag ataggcggta gccaccctca tctttatcac agaagaaaac atatcggttc     61440
     cgggaagcac acactgccgt tttttcttga cgtggggaac ggcagcggcg gccagcggtg     61500
     aaggcatgga taccatcagc ctcttcgctc tgcttctgac cctctcggca ggattcagca     61560
     ttctcaatca ccacacgttt cgccttcctg tgacgatcgg tgtgctggtc ttctcattgc     61620
     tggcttcctt gctggtcatg atcctgaatc cgctgatacc ggcctatgac cttcaggctc     61680
     tcccgcgatc tgtgctcgga gccatcaatc ttcccacggc ccttctgaat ggcgcgctgt     61740
     ccctgcttct gtttgccggg gccacacagg tagatgtcag acatctgcgc gcaaagcttg     61800
     cctccgtggc cgctctctct gttctgggaa ccgttctggc tgttgccttt ctggcaatcg     61860
     cggcgtggta tgtcttcccc ctgttgggtc atgctattcc tttcacgtgg tgcatcgtcc     61920
     ttggggccat cctcgcgccg actgatcccg tttcagttgt cggtatgctg aaacgtctcg     61980
     gaccgcccgg cccccttcag gccgttttcg caggggagag cctgttcaat gacggcgtgg     62040
     gcgtggtaat ttttggcgtc acgatcggac tggcgaccgg gaacagtcag ggagtgaccg     62100
     cttccgggat tgctctcagc ttctgccgcg aggcgattgg tggcggcctg ctgggcgcac     62160
     tgaccggatg gattgcactc cgtgtgctta aaggacagcg cgacccgcac attgacttgc     62220
     tgacatcatt ggccttggtg actggaacct tcagtattgc caaccagctt ggcatgtcgg     62280
     gggcgattgc cgtcgtggtg gcgggactgt gctttgggac aagctacagc cattccgttt     62340
     tcgatgaggt atcccgcaaa gaactcgacg tcgcatggac acttattgac gaggtgctga     62400
     acgtcctgct gttcatgctg atcggctttg aaatcctgga gatcacgcct catctgttta     62460
     cggtgctggc aacacttgcc gtgatcccgc tctccactgc cgtgcgagca ttgagcgtgc     62520
     tgttttcaac gcttccggtt cacctcaggc aatgggaacg aggtcgtgtt cttggtatcc     62580
     tgacctgggg cggtctgcgt ggcggcattt cggtttcgct ggcgcttgga ctcccgcccg     62640
     gaaacttgcg cgacctgctg ctgcctgtct gttacggcgt cgtcgtgttc accatcatcg     62700
     tgcagggact aacgatggag cgggttgccc gcagacttta tccgccctct acgcttaggt     62760
     ctcaataata cggctctgat tatttgaagg gcggttccgt aagaaggaaa ataatgacag     62820
     attgatcatg ttttttaaca aatagcggac cttccgcttt cccccccccc tgatccgcct     62880
     gtctgctcct gtatcactga gcagacaggc ggcattcgct ctcatgtcag acatagaaaa     62940
     gagccaaaca atgctccgaa agcggacgtt atctctagtg tcgaaaaccc ttaattagga     63000
     gaatccccgt ttccgcgccg gttgagcacc gaaaaaacaa ccttaattag gtgaaaaaat     63060
     tccttaatta ggttacacac caaatggtgc actgatgatc tgtcgtcccc atgatcttac     63120
     tttcggatgc agccacatca cataagtctc tggcgtgagc ggttcattcg gaatctggga     63180
     ttctagagga tcccagaaaa caagctcttc aaaaaactgc tcatcggaca atactaccga     63240
     agccagcatg atgatgccgg ttgccagcga agttggcagc atggccggcg tataatggaa     63300
     agcggctttc cagtctgact gctccagcat ccagtaaagc ggcggttgag gtctcgggag     63360
     ataatcaatc gtgatcaggg taatcagcgt aagctcttca ataattgtcg tcagacgacg     63420
     ttccctgctg actccacgcc attgtgcgcg aagtgtctgc ccgacaagac tgcgacagag     63480
     atcaatgctt agagcgttca cgcaccggga gattgttctg tctatcgtca gaccccaggg     63540
     aagctgatca tctaatgcat ccccccacaa attgatttta tcacctttga cggcgcacag     63600
     cggctgtacc cgacctttgt cactgagaaa aagacacccc ttgcctattt tattgcaccg     63660
     tggacaggct tcttccagaa ctcgccgatg acgttcacag gtcaccgtcg ctcccgttcg     63720
     ccatgatcgc cgctcccaag gctcatctcc ctctagcaga gcttcccgta cacactctcg     63780
     acgcggattt ctcacacttg aggcaatttc gggtcatttt gtagaattca gtcatcccac     63840
     aggagcccga tctggaatat tgacgatatt ctgcttctgg cggcgggttc tgaacgcagt     63900
     gagggtgtca cggcctgaga aggcagtgtt ggtggaagct atgtggtctg tgcactgtct     63960
     gtttcttcag atggcctgcc ggagccttcg caatcgtgca tgagcgaggg cgaattcgtg     64020
     ctgacagggg aacatgtccg gcatgaacag gacaatccga cggacgctga gcgttacacg     64080
     tgtcgcgatt ttgagcagtc gtgcgcgtat ggtgccacag gtcgccgtct ccaggctggt     64140
     ctggccaagg gccagtcttt gcagagcggt cagcaggaca taggctgcgg ccgagaacca     64200
     cagccggagc tggttggccc ggatggtgtg ggacgaggtc ctgtctgaga acagatccat     64260
     ctggcattcc ttgatgcggt tttccatatc cccgcgtgcg cagtaaatct gttcgtagag     64320
     atggcggggg tcggtcattc cctgcggtag cgtggtgaca ataaagcgat gatagcggtt     64380
     gccgtggcgc cattcggcct tggccacgac ccgcctgcgg cgcgtccagc tgtcctttgt     64440
     gatccagtca aaggaggcga aaccgcgcgc agctctgcct gtcgtggcgg cttcgtcacg     64500
     aacctcagcg gacaaagagg caatccggtc atacaggcgg gtgttgcctg caagcccgaa     64560
     caggaagtca acgtggttgt cttcgcacca tgtcatcaga ctgtcccggg cgaaaccgct     64620
     gtccccacgc accaggatac gcacccgggg ccaacggctc ctgatctgct ccacgatccg     64680
     gcggatgtct gccagtgctt ccttccccgg gtccctgtct gccgtgcgca gggtagcgct     64740
     gaggagatgg tccccgcaga agacatacag gggaagatag cagttatggc cgtaatatcc     64800
     atgaaaggcg cggccttcct gatggccatg gatacggtca tcggtggcat ccacatccag     64860
     aacgatccgg gcgggtgcgt gctcatgctg gtcaaggaag agcgtgacga acagggtagc     64920
     cagggcctca tgatcagcaa tgatccgaca gtaacgatct gccttgtgcc cactgcgctc     64980
     caaccggttc agtgtagatt tgccagccaa tgctgcgcag tttgcccggc ctcctgacag     65040
     acgacccgag gccagaccaa agatcaggtc atgccgcagg gcatcgtgat cattgagatc     65100
     ttcatagccc agtgccaggc ccatgatccg ctgacggaca aggtcttcaa cccggtattc     65160
     cacaaagccg ggatgccgct tatcgcgaaa acaggcagca aagcggcggc tgagacccag     65220
     aatgtcatca gcctgcttca ccacaatgac gcccccatcc gaactcatgc gacccccgtc     65280
     aaaacgggcc acaacacgcc gtccacagga ggctggaaat tcatacgcgc ctgcgctaca     65340
     ctctgtctgc atcgggtttt cttgatgatt atggaaattt cttttgtgca aaacagactt     65400
     tttcataatc taacccgatg tacaaccctt ctgtgagatt tccgcgttga acctctgcgc     65460
     cagatcgtct gactgccctc ccaaaagacc acaacctgga aggaaacggg ggcgaccgag     65520
     aaaaaacgat actcaaagta gagcccccgc agaagacaat gtggacgtcc aacctttcgg     65580
     gcctggaccc gcatttcctc ctctaaatta tgaggaactg aaatatatga ttgcacaggt     65640
     agaaaatgtc atgcaacgtt atcgagatag ttaaagagga aagataacat ctagagacgt     65700
     gtcatctatc caatcttaag atatacttcg aaattctgtc atttttttgt aaatttgaat     65760
     acttggttga gttagtgaac gatattttct atcggcataa agctatcatc tctacatcaa     65820
     aggaggcgcc gtcacgatgg cagaaaaaag cacgcaaacc gttgcctcat cagatgtacc     65880
     ggaaagtcgc caaacagaca caacacagtc ttccatgata agactcaacg cctatacgcg     65940
     cttgattgcc cttcagagcg gtctgcatat cctgtattgg gatgcgcgga ccaaacacga     66000
     tttcagttat tcagcctacc atgatgatga tctgatctat tttggagctt acacaggcgg     66060
     aaattctcat atggaaaccc ggtgttggga tgggctgaca acttacgata ctctcagcaa     66120
     accagatgat gcctatgttg catatcgtcc tggatgtcgt attgatttca caaaaacagc     66180
     tggagcaggc gctggcgtaa caatcacgct cagccccaca actctggcca gtctgtcagc     66240
     tgaggatgca acgtgtcttg atcagaaatt gcgctctggt cattatttta atcaggttcg     66300
     tggcggacgg cagcttctct ctttcgcaaa tgcattacga agcgtgggca caagtcctaa     66360
     acgaccaggc agccagttac agatgctcgg acaaagtctg tcatttatgg gctcgctcat     66420
     tgaacaagtc tgtcatattg cgcctcccaa catctcgtta tcggagcgcg aaatacgcag     66480
     attaaacgat acccgtgata tgttgcttgc agatcttgca tcgccacccc gtctggatca     66540
     acttgcccgt cacgcaggaa tgagcgtctc acgtttgcaa cgacattttc gaatgctgtt     66600
     tggtagtacc atttacgcac tttttcaaaa agaacgcatg catgaagctt accgccagct     66660
     tgttaaagat gatgaatcca tactgaccat tgcaacactc atgggttatg caaatcctgg     66720
     acatttttcg gcagcatttc gcaagcaatt cggtataaac ccatccgaac tccgacaaat     66780
     acctcgtctt aggcgataac cacggcgcca ccggaattta aatcgggttt tcgccaaaac     66840
     atctggtgtg ccatgcgctc cacgatgtaa ggtggcaaaa tcaatcgttt tcgactggcc     66900
     gccacacttt ggcgcaggta atgcaaccca ggagtgccaa gtgcagcatc aaatgcatca     66960
     acatccggtg tttcaatgtg ctcaaaattg taggcaaagg gctgaatatt cagaagttga     67020
     gtaaggcgtt ccatgacaaa tacaggttcc ctgactagct tgtcatagtc tataataata     67080
     actttatcag caaatggacc gaagaatact tcagtcagta agcgccaagc ataaccgaag     67140
     gccccttcac gcgatgcaag gtagtcaata cgatcatgct gcgttcctcg atgcgtaatt     67200
     ggcaccaacc gtgatcccaa caaaggatcc cgtatgataa gatgctcaaa cgagttaagt     67260
     atccagacag gatcacgcac acagcagata atctttgcct tcggataaag atgacctagc     67320
     aatccggcat gcgcacacca ctcccgatta atgtctagca tgacatgttt ctgggcatcg     67380
     ggattcagat aagattgaag aatgccccgc atcaatcgct gccattggcc attcttgaat     67440
     tctgtccggt attctccttc actcataaga gacattatcc ggataagcat cggcattacg     67500
     ggcgtattgt gagatgctgc aatgatctga ggattttgcc gcaacagtgc ggctaagaga     67560
     gtcgatccag atctagggag acctgaaatg acgtgaacag aatatgacga atcagacata     67620
     ccgcttaaat ggatgaatat gtctgtgtaa gtctccccga aaagaggatt ttagtacccc     67680
     tgaaaattta acctcaataa agattcaaga tttttaaaag actattgtct cattaaccat     67740
     gactttgaca cgttgaagtt cattaaagtt tgcatttatg tgatcatgaa agaatataat     67800
     gaatatataa gcatagtagt cagtgctgac tgaaggcagt ccgagccttt tcctttacca     67860
     gatgcctgcg aaatttttgt tttttggctt atggaacgtg tttattaaac tgaaagatgg     67920
     ataatcaaat atcagtcttt atttattttc atgatctgta gaagcattca aatataaact     67980
     atagactcat aaaatagata acatttccct atatataaaa aatattttaa gaaattatga     68040
     acaaccatca ataataaatg aattatatat taaatattta cgagagatag acttgtttta     68100
     aaacacacgc ccttataaga gttggacgaa actattatat tttaatttta acatgtagaa     68160
     ataatgaata ttggcagcat atctttttca gaaaccgtga aaaaattctc gtatagaaaa     68220
     gacattgatg ggatacgagc tatcgccatc ctcatggtca tcatcaatca tctgaatacc     68280
     aaatggcttc caggtggata tctgggtgta gatatattct tcgtcatatc aggatttgtg     68340
     attaccggaa gcttatttaa ttatgggcac gggaaaggtt taccctctct cctatatgat     68400
     ttttacgcca aacgactacg tcgcatcaca ccagcactgt taacgaatat tgtcatttgc     68460
     agtgctgcag tctggataat tgatccccag ccacagattt cacttcaaac cggttttctc     68520
     gcgctattcg gtttctccaa tttttactta tggaaaatat cccaggatta tttttctccc     68580
     tctacaaaac tgaatgcctt tacccatacc tggtcgttag gcgtagaaga gcagatatac     68640
     ttgctctacc catgtatctt gaaaataacc ggatttttta acgaaaagac ttccagactt     68700
     tttccattga ccgctatatg cgcactttca atagtctcgg ccatcgtttt gatgatcctg     68760
     ccaggacata caacgggagg cgctgcctac ctgcttcctt ttggtcgttt ttgggagttt     68820
     ggcatcggat gtattgcatg cctcttgtcc cttcatttcg aaaatcgtga tcagaaaaat     68880
     attaaaagcg ttatttgtta cctgtctttt ctatgcgtta ttttttctgc cgttctaccg     68940
     caatatcaga atgtgctgtg gagctttctg gcagccccgg caacagctgc actgatcctg     69000
     tttctacctc atacaaacaa ggcacgtctt ttcctgagtg gcaacatatt acagttttta     69060
     gggaaaatat cgtattcgtt atacttatgg cattggccca ttctctcttt actcaatctg     69120
     tatatgaaat ctaacacgtc gtatctttat aacttccttt tattgacatt ctttacgtcc     69180
     atatcgtcat atttcattct ggaaaagcgc ctgaagacat ttttacaaaa taaaggaaat     69240
     gtattttcat atttattatc attgcctctc attttattct cgtctttgta tgtatttaca     69300
     ttacacaaat ctcataatcc ccatcctctt gctataaatg ggtttcgtta tcttcctgat     69360
     tcatatgaga attttcctgt aaaacatacc aacttttttt actgtactgt agaactcccc     69420
     aaacgccctc tacatagtaa cacgatggag aaatgtacaa ttccaccggc gaataaaaac     69480
     cttcccactc tttgggtcat gggagatagt cacgcaggtc atttgatggg actactttcc     69540
     caactgcaac agaagtctgg ttacggcatt catcttgtcg aaacggttgg tgagcccttc     69600
     ccagcctcag gtggtatttc ttctccagag cgtcaaaagc tttggaatgc agctcttgca     69660
     cggatgaaaa gtggcgattt cgttgttctg ggacgaattt ttctaacccg agacggcgag     69720
     atcaaacctt tgccggatat cgagaactgg ctgcagcaag tcggaaagat cgcatcatat     69780
     ctggaggcca aaaatgtctc cattatcatt atgtctccca tcccgatgtt cagatttgat     69840
     tcattatata actgcgctcc atcccaatcg aataatacga cgtgcgacat caagcgaaag     69900
     gacgaagcaa aacctctgaa tgacatcatg cacgctatga tagatgttca ggaaaaccac     69960
     aaaaatcttt atgtgtttga tgcattctca gaaatatgtc cggaagaatt aacctcttgt     70020
     tctcccgtca gaaatggaat tcccttgtat cgcgacaagg atcatctgaa tgtttacggt     70080
     tctgaaatcc tttataaaaa cttttccggt ttcctgaaaa atatctcgaa accctgacgg     70140
     tcacaatttt tcatgatacc aacagtttga tctgattgtg aaagacaagg agtttgaagc     70200
     aactctcaag aatattttct actttatcat catatgatag tgcatatttg cggtcagtca     70260
     taataccccc agataaattt catgctggat aatctgtgag ttgatacata tgttttgtca     70320
     gccgaattat ccgatgactt acggagctgt tacaaaatca ggcttcgccc atctgggtat     70380
     cgtctggtgc accaggtgga cgatggtaaa actcattgta ttagtcatcg ctcttggccg     70440
     cagggatgcc aatgaggttt atgacgatac aaaccgctgt gtctgagcat gtttggatcg     70500
     gaaacactca aacattcaga tggatacctg cataaaaacc tcacccagac ggcgattgca     70560
     ttcggccgca ttgatcagcg gctccgtcat caccctcttc tcccagccat cctctttcgg     70620
     gaacggctag aagccgcacg tgcctgtgca gctgtcgatg gccacctcat agatccctgg     70680
     cgacttgccg ccgaacttga gggcttgaga gtggtacctc tcggctctga tgtctttgag     70740
     cgggggtcct ctgttgatgc ggcacatgct gcttttgcac aataccaatg gctcgttaag     70800
     ccagatgaag cacaacgcaa cgcgatagag agcgccctgg ggtggctttc tgaacacagc     70860
     aaggcatcag gccctcttct tggcgctgct actgcatttc atgcctgggt agaaactggt     70920
     catgcccgtg ccccgatgcg cgcagccttg atccgacatt ggcgacgtac ggatatcctt     70980
     cattttccgc ttccccttgt tggcgccaga gcttttatag cggatgcacc ttgggaacca     71040
     tcagaatgga tcccgtgctt cctcaactgt ctgtatgatg aaatgacggc cgtagaaaac     71100
     cgtacgcgta aactcgaacg aagctggcgt cacgcacgca tgcaatcagg tgcccagaga     71160
     agcacatcgc gtgccgataa ggtcatagat atccttgccg catacccact gatatctgca     71220
     acgcgcctct cggacgaact ggggttatct ctaaaagcgg cttacatcta tctggaacga     71280
     tttctgtcag acggtctgat tgttgaagtc acgcatcgca ccgcaaggcg attattcgcc     71340
     ctgaaagaac ttgaaccact ccgcgagatc gtgcgccctc ccaaaagacc cctacctggc     71400
     aggaaacgcg ggcggccgag aaaaagcgaa agtctggaga ccactcctcc agaggaggac     71460
     gtggacatcc ggcccttgga gccagtgccc acgtttgcac ccataaatta tgaggagctg     71520
     gagcgcgcga tagagaacgc agaacgcatc atacgccgct atcgtgctga ttaggcacag     71580
     agtgttctat ccaatctgtg ggcctcgcga ttttggccca tttgattgcg gggcaggtcc     71640
     ttctgacgca gacagtttct ggctggcccg agtaaaccag gaagaaggta agtgtgcctg     71700
     ttcagctttc atcccctgcg ccgcacgctg atcctcacgc agatcaagac tgcgaacagc     71760
     tgcccgaccg atggcataga tggcgtcacg cgccgatccg tcccgtccgg gcagaacggt     71820
     cagcttttca atgccggcct tttgagcctg atcaatatga cgcagaactg tgccaacctg     71880
     tgtgtcactc tcaagagctt tcagttctcc ccgtaagccc ctcagttctt tcaacgtggt     71940
     gccgtcagcc cggcctgcat caagtattct ggtggccccc tcaatccggg actgtatttc     72000
     atggcgtgct ggatcacgca gcgagagagc ttcacggcgt gcctggtcag gcgttatggt     72060
     acgaccagac ttaaacaatg aggcgatggc atgcgtcatg agacgctcgt cattgactgc     72120
     cgcctggctg ctggccctgt tccattggtc gtgatccagt tggctaagat caaatgtatg     72180
     ccccgcattt ctggcaaggt gggcaagatg caacagcgtg acctgctggt tcccatgccg     72240
     gaagggcagg attttatcca aagaggcaat atgcgtggct gctgcccgtg caaaacgatc     72300
     ggatgacaga tcctgcaggc cattattcgc attcaggttt tggaaaacag cattaacgga     72360
     ttgatgaata ctctgtgggt gaagaccttt ccggccgtca actgacaggt tgcatgtcct     72420
     gtattgtcct gcccagtcgt agacgtcctg gaacagatga tgatgcagat tcttcaatgc     72480
     agatggtgag ctggttgctg tcggcatggt gatcgcccgg ctcagataac gggttgtttc     72540
     aaaaacgcgc aggcgatctg cgttctgata gcccttcttg ttcacgagaa catcggtgtc     72600
     tggatagaga taggggtcag tgacaggcat cattcatctc cttccattgg acggatcggt     72660
     tcatccagtt cctcatgaag gcgttcaaga taatccatga gaatttcagc cggcacacgc     72720
     gcctcaatca gtaatgttgt gatggagcaa atttcagcca tcaggttacg ttctggcctg     72780
     tcatgttcgg tcatggcgct catcgcgtcc tgaatcagca ccttgtagaa agacgtcatc     72840
     tccggagata cgggctcaaa cgtcagtttg gccaattcct ttcgatagcg ctcgacccgt     72900
     ggaaagcgcg ttggttcatt catgttgccc tcagtcctcc cggttgtgcc gagcgaatgg     72960
     ggatacgtat cccttatcgt ctgcatcgta tgacctccta caatcaggag tcagccagac     73020
     cattatgcga ccagaaagca tttccgattt ccactgaccc gagacccgct cccgtgatta     73080
     ctgcactata gtcggtccgc gtttcagctt ttccgccagc ccataaaggg tgcgatccag     73140
     tgcgagttgc cccgcaagga accgtgcgat catggcgcgc aacaggcctc ctggtgagcg     73200
     cacttcacct gcgtccgtcc gtgcagcaat tgccgcaatc accacagcat tcgggtaatc     73260
     cccaaaaacc gcctgccctt gcgcccaggc atgtcgggat attccaagct gctcgcacgc     73320
     aaagagtgcg gcctgtatga tttcggtttc tgccggtttg tcggaactgc aatattgccg     73380
     gaaaatcggg gcgatatgca ggacaaaaga tggcttagcc cggaaaccac gaagcggatc     73440
     tgtaacagcc gaggggacag gttgggtttg agcggcacgg gaggacgagg acgaccgact     73500
     acgcgaagct tcattgcaat tttcggcgaa gccggccgct tctacagcag ctttagctaa     73560
     gctggttgat tttgtataag tatagtgggg gcgttctggt gtccccatgg ggtcactttc     73620
     cacagataaa ggaactgaat cagaggtatc tgaagagacg gtcatctcct tggcaaaagc     73680
     gatctcccgc tcaacctgct catgaatctg acgaagttcc tggcagatgg ggtcaagcca     73740
     tttcggatca cgttcactcc cccgctgact gacaagagca gaggtacggg cgagtatctg     73800
     ttttccgtct ttcaccgtga cccctgcttc ttctgcagtt tgaaacaggg cgtagatggt     73860
     gcgggagagt gttgtaacct cccgatggag gcgacgacct tcctgttggc gccaaagagc     73920
     cgtttcagcc gcacgtttga gatcatcaaa tcggcgggca agcggagaaa gatcaaaacc     73980
     gtaggcctgc tggcttcgcg gagtaaaagg gttggaacga cggtaacgct gtccgttggg     74040
     actatcccgg tgaaggagcc accctgcttc ggccagctcg cgcaacaggt ttttaacgcg     74100
     ggttcgccct agatcaaagc gttgctggat atccagattg gatgcggtgg agaccggcag     74160
     gacatcgtct tcacccgacc agtcagctgg ttgggtgaat gcgatcagat agcagagcag     74220
     ttccgtctgc tggcatgtca ggccgagaat cgaccgcccc tggcgtagat agcgatagag     74280
     gtcgctcatt tccacggcct ggagaggcag agcctcagct gttgttcgcg ccgcaaccat     74340
     ggcaggcgtg attttcctta tgcccgcaga gcgggaataa ccttctgata acattattct     74400
     ttttgtccga cgaatgggaa taccttcccc gtcgcgatgc tgacccgcag gacaaacgcc     74460
     ccctgtggca agaaaagact tgcaatttta cgggatatgt cggagaaaaa ttgtcgccaa     74520
     actctttttc atccgacatc cccatcaggg aatgtatttt gtgtctgcag gcctcgcgaa     74580
     agcggggcct cagtcgtttt agggggaaac tatgtcatgg ctctctcttc cttctcgctc     74640
     ttaccgacgg atcacgccgc acttggggca tggccatcgt cattcttggg tctctcaacg     74700
     ctccgtatct tcctttcata ggaaaattcg atgcgaacga gtgtctctgg ttggcgctcc     74760
     tgaaacgtgc tcgtcatgcg acagaatgca cactcatgat gcgaccaacc acaagggctt     74820
     aaatgcttga gactgattcc acaatgaacg accctattat ttctgcaaaa acaggcgttt     74880
     aagctgccta agaaggtcat gttgtcccat gggaaacgag tcgaatcagg acatcttact     74940
     tagtcattta agcttgtcat cttctcgctc tgaaatccta tgatctccat attatcctcg     75000
     cctgatatgc cttggaaatg gcggttttcc gcttgttgtc tgccgaatgc cttctcctta     75060
     tcctgcaggt ttgatctcct ttacgatcca attaaacggt accagggggc aggttgctat     75120
     gtcttgcgag atagacagca ggcaccagcc aggttgcgtt cttacattcc gagcgcacgc     75180
     cgatagatat ccagcagtgt ttcctgctct tctatctctg cgggctcctg cttgcgcaag     75240
     cgaatgatct gcttgatggt tcggacatca aacccggccg atttggcttc agtgaaaata     75300
     tccttgatgt ccgaggcgag cgctttgcgc tcttcttcga gacgttcgac gcggatttct     75360
     cacacttgag gcaatttcgg gtcatttcgt agaattcagt catcccacag gagcccgatc     75420
     tggaatattg acgatattgt gcttctggcg gcgggttctg aacgcagtga gggtgtcacg     75480
     gcctgagaag gcagtgttgg tggaagctat gtggtctgtg cactgtctgt ttcttcagat     75540
     ggcctgccgg agccttcgca atcgtgcatg agcgagggcg aattcatgct gacaggggaa     75600
     catgtccggc atggacagga caatccgacg gacgctgagc gttacacgtg tcgcgatttt     75660
     gagcagtcgt gcgcgtatgg tgccacaggt cgccgtctcc aggctggtct ggccaagggc     75720
     cagtctttgc agagcggtca gcaggacata ggctgcggcc gagaaccaca gccggagctg     75780
     gttggcccgg atggtgtggg acgaggtcct gtctgagaac agatccatct ggcattcctt     75840
     gatgcggttt tccatatccc cgcgtgcgca gtaaatctgt tcgtagagat ggcgggggtc     75900
     ggacattccc tgcggtaggg tggtgacaat gaagcgatga tagcggttgc cgtggcgcca     75960
     ttcggccttg gccacgaccc gcctgcggcg cgtccagctg tcctttgtga tccagtcaaa     76020
     ggaggcgaaa ccgcgcgcag ctctgcctgt cgtggcggct tcgtcacgaa cctcagcgga     76080
     caaagaggca atccggtcat acaggcgggt gttgcctgca agcccgaaca ggaagtcaac     76140
     gtggttgtct tcgcaccatg tcatcagact gtcccgggcg aaaccgctgt ccccacgcac     76200
     caggatacgc acccggggcc aacggctcct gatctgctcc acgatccggc ggatgtctgc     76260
     cagtgcttcc ttccccgggt ccctgtctgc cgtgcgcagg gtagcgctga ggagatggtc     76320
     cccgcagaag acatacaggg gaagatagca gttatggccg taatatccat gaaaggcgcg     76380
     gccttcctga tggccatgga tacggtcatc ggtggcatcc acatccagaa cgatccgggc     76440
     gggtgcgtgc tcatgctggt caaggaagag cgtgacgaac agggtagcca gggcctcatg     76500
     atcagcaatg atccgacagt aacgatctgc ctgctgccca ctgcgctcca accggttcag     76560
     tgtagatttg ccagccaatg ctgcgcagtt tgcccggcct cctgacagac gatccgaggc     76620
     cagaccaaag atcaggtcat gccgcagggc atcgtgatca ttgagatctt catagcccag     76680
     tgccaggccc atgatccgct gacggacaag gtcttcaacc cggtattcca caaagccggg     76740
     atgccgctta tcgcgaaaac aggcagcaaa gcggcggctg agacccagaa tgtcatcagc     76800
     ctgcttcacc agaattacgc ccccatccga actcatgcga cccccgtcaa aacgggccac     76860
     aacacgccgt ccacaggagg ctggaaactc atacgcgcct gcgctacact ctgtctgcat     76920
     cgggttttct taatgattat ggaaatttct tttacacaaa atagactttt tcataatcta     76980
     acccgatgta caacccttct gtgagatttc cgcgtcgagc gccacacccc ggatatggcc     77040
     catcttacgg tcccctttat tgggtgtgat tcaggcaccc tctgcctgtt ctcaaggcag     77100
     agcgaggggt cacggtcgtc tcgcgggaat gacataaacg ggccataaag cagaacgttg     77160
     tgtgtcaatt aaaaaacaca ccgatcaaaa ctttcttaag cgagtgttgc aacaacactt     77220
     caaacccgca ttaatcagcc attataataa aactgtcact cttattcaga acgtttcatt     77280
     tttaagaagc aggggaattt ttcactggct cagggcacag cacccccatg catcttctgt     77340
     ctttttcccg ccgcaaggct ttatggctgt tctgctcccc tctggctttt tccgtggccc     77400
     acgccgcaac cacggccaaa ccgcatcaca ccacacaccg ggcccatgta gcgccgcgca     77460
     ccaccgcgcc gggcataaca cccgttgcag ccccagtggc gaccgtgcca catgccgccg     77520
     tgcgccgcac gtcaacccag cgtgcggccc atgcggctga atcggaacag attattgcaa     77580
     caggccgtca cagccggtcc gaacagacgg ttggccatat tcagatgcag cgcactctgc     77640
     ccggcatcaa ccctatcaag tcccttcaga ttcttcccgg cgtggtgttc aacaacgctg     77700
     atccgtgggg caataacgaa cagaactcat cgctggtaat tcacggcttc aaccagaacc     77760
     agcttggcta cacgctggat ggtatcccgc tgggggatca gtcttacggt aactataacg     77820
     gcctctcccc gcagcgtgcg gctattagtg aaaactttgc ctcggcttca gtggcaacgg     77880
     gtgcaggtgc gctgggcacg gcttcgacca gtaacctggg cggcacattg cagtttacca     77940
     cgcaggaccc cctgcaccgc gccggtggcc agttgagcca gactttcggc agctggtcta     78000
     ccttccgcac ctttgcccgg attgatacgg gtgattttgg caacggcaat tccgcctacg     78060
     tgtcatgggg ccgacaggac gcccgcgcat gggattttgc aggccatcag ggcgggaatc     78120
     aggtcaacgc caagtttgtg catgaagatt caaaaaacaa ggtcagcgtt ttctttgatt     78180
     ggtccgaaaa ggttgaaccc aacgaagacg gcattgtcat gcccaacggt gggtcactat     78240
     atgtgcgtcc gttcatgtat cccaacctga acgaagccgt taactactac aaaaattcgc     78300
     aggcctatac gtcggcaggc ctgaactacc gcaactatta ctccgccgcg cagcgtcagg     78360
     attatctgat gtatgcaagc tggcagcatg agttcagcaa aaatctgaaa tgggacacca     78420
     agatctatta tcatcacgat attggtgaag gtgtggtggc tggccccatt acggctgcgg     78480
     gtctgcccac actgttttcg tcctacttcc ccaatcagtc ttcatcacag ttgtctgacg     78540
     tgtttggcgg gtctggcatg gccacccgca caaccgaata ctgggacaac cgtggcggga     78600
     tcatgagcaa tctgacctac catctgggcc agcacaccat tgaactgggc ggatggtatg     78660
     aacgcaacaa caatacgcag gcacgccggt ggtatccgtt tgatatcaac aaccccacca     78720
     ccccgtatga acgccagcag aacgcgctga ttaaccagta caccaactat ttctacacca     78780
     acacctggac aacgcacctg caggattcct ggaaaatctc caagaatttc tccttgaatg     78840
     ccgggttcaa gtctgaactg gtttacacca acggcacgtt gcccgttgct ggcctgcccg     78900
     gttcactgtc acccaaaacc gccattaccg tgccgggtgg caccattgcg gctgtgcggc     78960
     ccttcctacc gtctttcggg gcgctgtgga acattacgca gcatgagcag tggtttgcca     79020
     acattcagga aaacatgcgg tcttttcagg ctgcgggtta tggcaatgcc accccatggg     79080
     gtgtaaccag tcaggccgcg tttgaagact tcaagcgtca tggcaaacct gaaacatcct     79140
     ggacgtatga aaccgggttc cgtaccaaca ggcatctgga tgctggcccg ctgacaaaca     79200
     tcagcggtca gcttgaatac tatcatgtgc atttctcaaa ccgtctgctg gctgtggcct     79260
     caacccagac gctgtcttcc attgtaggca gcgccaccac actgacaaac gttgggtcgg     79320
     tttctactga cgggatggat ttctccttca ccgcgcagtt tggccagcat ttctcattct     79380
     acaatgcgct gtcctataac aaatcgacct ataacgataa ctacctgaac ggttcaaccg     79440
     ttgtgcatac cgcaggtaaa aacgtggctg gtgtaccgaa ctggactgaa aagttcgtgg     79500
     cctccaccca ctggggcaat tttgacgccc agtttattgg cgatgttgtg ggcaaacgct     79560
     acaccacctt caccaatgac ctgcacgcca gcgcctatgc cctgttcagc ctgaatgccg     79620
     ggtataacat tacgggtatt ccgcatgtgc gctcgctgcg ggtgcagggg aacatcacca     79680
     acctgaccaa tgaaaaaggc tggtccaccc tgaacaccaa caatgcatcg ggccagtata     79740
     cggcgttccc cattgcgccg cgtatgtatt tccttacact cacggcctcc ttctaagggg     79800
     tagagcgtat ggctgatctt tcccgtcgtg cacttctggc tgccacctgc gcagccggat     79860
     ttatgggcgc aacccgtagc tgggccgccc cttcccttgt gccaaaaccg cttgtttttg     79920
     cgcaccgtgg ctgttctgcg cagcggccgg aacatactct ggcatcatac gcaaaagcca     79980
     ttgccgatgg cgcagatttt gtcgaacccg atctggtgcc aaccaaagac ggtattctgg     80040
     tctgccgcca tgaaagcaat attgccgaaa catctgacgt ggcagaccgg cccgaatttg     80100
     caaaccgccg ccgcacgttg aaaattgacg ggcgggagga aacaggctgg ttcacgacag     80160
     attttacgct ggcggaactg aagaccctcc gcgcgcgtga acggctggcc accctgcggg     80220
     tgcacaatac ccgctataac gggcagtttg atatcccgac ctttgaggaa atgattgatt     80280
     tcgttgccgc ggactctgcc gcccgtggcc gtgtggtagg gattattcct gaaatcaaga     80340
     attcaaccca ttttcacgct ctgggctttg acccggaaac cacatttctg cggattattg     80400
     cggcccatag ctatacccgt tttgctccgc ttgaagtgca gtcttttgaa acaaccaatc     80460
     tgcgccatct gaaagacgcc gtaaaagccg tcaacccaca ggcacgcgtc atgtttctga     80520
     tgggtgaacg cggccagacc ccgcctgacc ttgccgccaa gggagagaaa actacctttg     80580
     gtgacctgat gaagccggaa gggttgaaag aggtccgcac ctatgccgat gttattggcc     80640
     cgtctctgac tgaccttatc ccgcgtgatg cacagggcgc gtggacaaca cccaccacgt     80700
     tgattgacga cgcccatgcc gcagggcttc tggtgcatgc ctatacctgc cgcccggaaa     80760
     atatctttct gccaaagcag cttcgcaatg cagacggaga tgctgcgcgc aatatcaaag     80820
     gatcactggc tgaaattcgc cggtatctgg atatggggct tgatggtttc ttcacagatg     80880
     atccggctat tggccgaaag gctgttgatc ggatctgacc tgcgtcaggc tggcgttatt     80940
     ccgtttcacc ctgcctgaaa cagcatttta cagcaatcat agtttgacga ttttgaccgg     81000
     ctctctggat gtttctgcat cagagagccg gttttggttg tgggtggttc tatccgttca     81060
     gcttgggtta caccatgctg ccaaaacacg atccgtcacg cacggggctt gagtttatgc     81120
     cacggaaaaa aggaaaccag attacctacc agcaccagcg caatgcctgc gcccatgctg     81180
     gcggaccaca cgctgttttc tgccatgctg gaaataacca gtgcgaccac gggtgaaaga     81240
     atagtggtgt acgccgcacg gtctgcacca ataacatgca ccagccgcag ataggccaca     81300
     aaaccgataa tagaccccgg aacagccaga taaagcaggg atgcaaccca ccccggctgc     81360
     catgacccgg ccagcccgtg ccctgtcagc agcagccatg ccccggtaaa gccacagccc     81420
     cacatcatgc cccggcagac aacggttggc agatcaagcc ccttcagcaa caggtggcgc     81480
     gagatcatgt tgccgattga aaagcaggct gtgccgccca gcgccaaagc aatgccgtca     81540
     atttccgtca aagaggcacc agtgacaccc atcatcaacg ccacgcccgc cacagccagc     81600
     acacccccca caatcccgtg caaggcaggc cgaatacgga aaaacagcca ctggttcagc     81660
     atattgaaaa taacggccag actgaacaca acagagaccg tgccgctgga gatactctgt     81720
     tcagcccgat acatgaacat gtaattgcag gaaaacatgg tggcccccaa cagcgccagc     81780
     aacgggatat cctgccgggg aacagccttc cattttcctg ataatttcag ccacgccgcc     81840
     aacaacgcag atgccaccag aaaccgccag aaaatggctg tgttggcatc tgttaccgca     81900
     acctgcatgt gaatggcgta ccacgttgtg ccccagatca gcacaaccgc aaaaaacagg     81960
     aacgccgcca tactattctt acccctttgc tttatggtct gacgcaacac ggggtgggtg     82020
     ggctgcgcca tagtccgtgt tgcaccctat ccccggttaa accggggctg gaggggccgc     82080
     tatcatattc ctgcggtttt tgccgccgca tcaggcaggg cctacttgcc ttgcgctgta     82140
     ttccatgccg atatggtaac aagatgtccg cgctgtcccg cttcaccatc cgcaattatc     82200
     tgcacggccg atcggtgccc gccgtggccg aagtggaact tggcgcgggt ttggccatgg     82260
     tgatctggga ccgggatgaa cggacctgca ccacctatga aacgcccaac caccacacgc     82320
     ttagcctgta tcttgaacac ggggacaagc tgcgcaagcg cacggcgtct ggttggcaga     82380
     acagccacgg cgcgggcgat ttctgcctga tgccgcataa tgtcagcacg gaatgggatg     82440
     tgcagggccc cattcgcatg ttccatttct atattgcgcc ccagacgttt gaccgcgccg     82500
     cgcatgaaat attcgacatg gaccccgacc gtgttcggct gggccatgat gcctatttca     82560
     gaaacccgcg gcttgaacgg cagatccgca cctgcatgat caacctgtgc tggcagcccc     82620
     ctgaaaaccg gctcaccctt gggcaacagg cccaaacgct gctgcaccat gtgctgaaac     82680
     agtgctctac ccggttggtc aacgcgcccc agcgtggggg gctgtcaccc gccaacctgc     82740
     gccgggttga tgagtatgtc aggcaggcac ttgaccagcc attgggggtt gaagaccttg     82800
     ccgcggtagt gggagtcagc ccgtatcatt ttatccgctc attccgacaa tcaagcgggg     82860
     aaactccgca tgcctttgtg ttgcggcgca ggcttgaata cgcagcattt ctgctgaaaa     82920
     cgggcgaacc tgcctcaacc gtggcccatg cgtgcggctt tagctcacac agccatctgt     82980
     ctgcccgctt ccggcagttt atgggcgtta cccctaccga atacgccctg tgggctggcc     83040
     ccagacaaat ataattcaat ttctataaga tatttagatt actgtcagtt ttcacaaaaa     83100
     taccatagga aaacactctc ttattatcat ggactactct tcccggtaga attcttcctg     83160
     ctctcttcac gcatatagcc acgcagaaga aaccaatttc ctgtttggtg cattttatca     83220
     aattatagtc cagacaggcc aacagcatca aacacgcctg aaccatgttt gatggtctgt     83280
     tggcatgagt gttgtcagac ttcttcttca atatcggcct gtgccaccag cattgtgtgg     83340
     tggttcaggc gcgatgccag aatatggccc agggatgcgg cccctacgca cagcacaacg     83400
     gacagcccga cagtcagcat agcgcggccc catgcgccga tgcgcagcag atcaagcgtt     83460
     tgcaggctga aagaggaaaa agtggtatag ccaccgcaca gcccgatcat gacaaacagg     83520
     cgcatgtttt ctgaaacggc atagcggccg tcagccaaag tcagtgtgcc gaaaaaagcg     83580
     ataatgaatg accccaccat attgaccgca ataatggtgc cccacggcat catgcggcta     83640
     taggggcctg tcagcacgga cacaacgtag cgggccagcg tgcccaaggc accgctttgc     83700
     cagccaatgc tgcgcagttt gcccggcctc ctgacagacg gcccgaggcc agaccaaaga     83760
     tcaggtcatg ccgcagggca tcgtgatcat tgagatcttc atagcccagt gccaggccca     83820
     tgatccgctg acggacaagg tcttcaaccc ggtattccac aaagccggga tgccgcttat     83880
     cgcgaaaaca ggcagcaaag cggcggctga gccccagaat gtcatcagcc tgcttcacca     83940
     gaatgacgcc cccatccgaa ctcatgcgcc ccccgtcaaa acgggccaca acacgccgtc     84000
     cacaggaggc tggaaattca tacgcgcctg cgctacactc tgtctgcatc gggttttctt     84060
     atagcttacg aaaatttctt ttctacaaaa cagacttttt cataatctaa cccgatgtac     84120
     aacccttctg tgagatttcc gcgtcgaaga agcgcgggca gctaatttcc ggcagggcta     84180
     tcgtcacgat gccgttctgg aagaagctaa tgagcgcttt atgcttggtt tgatttcgct     84240
     tgatgattta aaaaaagaaa tgcggcaggc tgttctgaat aaccgttgag cgttccagca     84300
     tgtcacacgt aaacgtccgt tttctcctgg tgacttatag ttgcccattt tcgtaacaat     84360
     tgggtatacg gaaaaaaaac acatcaagag ggctcttgct agatgttgcg cgttcttgtt     84420
     atgttccgag cgggagagcc gctatgagtg attacaaagg ggatcgtaca actggttttg     84480
     cttcgcctgc agcagatgca gtcgaaggcc caattgatct ggcagaggtg ctcgatttgc     84540
     ggcggccgag tcgctatccg gtacggctgc ggggagcaac attcaaaaca cgtgggatgg     84600
     ctttgttgcg taaatgctcg gagtggattc acggaatgaa tccagactgg tagctgggag     84660
     tgatgagcaa gccgaaagcc acgcgatacc gtacgacgaa ctggtcctcc tacaacgccg     84720
     cgctgaagaa gcgcggctct ctgacggtat ggtttgaccc atccatgaat tgggagggcc     84780
     ttccgacggg acgtcgagga cggcggcaga attacagcga tgccgcgatc cagagttgcc     84840
     tgacgctgaa agtgtcctgt ttggctttgc gctgcgacag acgacgggct ttgtcgaaag     84900
     tctccttcgt ctggctgtgc tgtcgtggtc cgtgccggat ttcagcacgc tgagccgtcg     84960
     gcagaaatcc ctgacggtcg atattccgta tcgtagttcg ggcggtccgc tccatctcct     85020
     gatcgacagc accggcatca aggtcgaggg agaaggcgaa tggcacaccc gcaaacacgg     85080
     ggcgtcaaag cacaggatct ggcgcaaact tcatatcgcg atcgatgaag gatcactgga     85140
     aatcagggct gttgagatca cgaaaaacga tgtcggtgat gccccagtcc taccggcgct     85200
     tctggaacag atccccgatg aagaggacat cgcctgcgtc actgctgatg gcgcgtatga     85260
     tacaagaaaa tgccacgaaa ccatcgccaa ccgtggcgca caggctgtca taccgcctcg     85320
     aaaaaacgca aaaccatggt gtcccacatc accaggagcc atcgcccgca atgaagccct     85380
     gcggacgtgc gggcatctcg ggcgggctat ctggagacgg tggagtggtt accatcggcg     85440
     aagccgcgtc gagacaaaga tgcactgcat caagctgctg ggccagcgtc tgacagcacg     85500
     cgatttcgac cgccagatca ccgaagttca catccgtgtg gctatcctca atcgcttcac     85560
     agcgctcgga atccctctca cacacgcggt cgcgtaatgg aaaactctat agcggcctcg     85620
     tcacgccaat agaccgaatt gtgcaacaga gcccctgatc gggttcaatg gccattgcgc     85680
     ataaatcacg ctgatgtcgt gtttcgctgc tcaactggac ggatgggggg agaccttttt     85740
     cgccttcgcg catagctgga aggggtgtgg ccaaccaggc tctacagctt tcggtcatag     85800
     ctcgggtttg gtcccgcaag agcggagaag gctccggaat tgtgctcgca ggctgtgtag     85860
     ttttagggtc tggtgacgcg gtttctgctg ccgcgaacgc aggcatgccc ccaagcaaga     85920
     caaatagagg caggatatgt tttgctgtgc agacgggtct gccatggctg atagagcagt     85980
     agggatgagg cataagaggt tctcctttag ggatgagtat tccctctcat catgcgacca     86040
     gattcacttt tttagacgaa tctggcgaga ctaagttttt cgtcgcatcc tgtgacgcaa     86100
     agataggggc tcacgggaat aaggagacga aactgttatg caacatggcg tcaatccgag     86160
     ttgtgacgcg gtaagcacct gggaagatac tggaatacag ggtgagcacc tgaaactgga     86220
     ggaaacatcc accagcgtgg tgacattccg cactccaagt tcaccagagg tgagagcgcg     86280
     ttataggcaa attgcccagg atggagaagg agacgtaccg cacccccgtt ttggtgacgg     86340
     atggcggttg cgtgtcgata tcctgagtga agatggcagc atagtcgatg ggagcgtctt     86400
     tttcagactg ttccggggac ctgaacagat cgtcagacca tatttgttag ggctgatgac     86460
     atgggatgaa gacatgcgtc ttggagcgtt gataactgcc agtttactgg gttcccttgg     86520
     atatgctcag ggaaagatca acccgacaga gaaacccaaa gaaatcaaaa agagcggcat     86580
     acttccccaa cttattaccc tgatttcaaa cacgccgcat gggccgcgtc catctgaaga     86640
     tccgcatatg atggaactca ttcacgaaat tgccgccgtg ctcatgcagg aagtaaagcg     86700
     acgggttgga gaaatcgctc ccccaccacc tatggtgaaa ttctgtctgt gaaggaactt     86760
     attgtgaaat taacgtatag cctgccactg gcagctcttt ctggtttgat gacactgtca     86820
     cagccggctt cagcgcaaaa catgatcagc agcgggacga gccagtttgc gccaaaaacc     86880
     acgccacacg ctgttcccac tctcttttca gaacacccgg cttctttgga gcagttgctg     86940
     aactctggat atgaaatccg ttccagcgca agtagcgaaa caggttcatc catgattctt     87000
     ttccggccgg cccagccaga ccagaaggca tcatgggtaa ggtgtgaatt gattggagac     87060
     aggaacggca acgttgtgtt gcgttcgagc cataatgtta catcagactg tcgcaatttg     87120
     aactgagaag accaagcgtc ttgcggtatt aaactctcgt ttttagtcaa ccacacaggt     87180
     ccgttatgac aaccaagaaa acatctcgca ccaaaaaacc agtcgtatcc aaagctccag     87240
     aagatcctgc acggcatcgt tatacagaag aagaaatgga tgcgcttatt gataaagcgt     87300
     ggccagagga aaaagtggag gcgtatttcc gagccgagcg agaagatgca cccattcctg     87360
     ttgtgcatga ttttgccgtc atgaggcccc agacagcacg gctggcgaag gctctggccg     87420
     acatgtttcc tggccagttc aaaggcgtgg aaatcggcgc atggcccccg atcaatgcgg     87480
     aagatggcat gatagacgtg atctatctcg gtgagagctg gattgtgcag cttggatatg     87540
     acggctacga gccttcaaga ctgggatttg ttaatgcgac atgtgacggg ctggactacg     87600
     aggaagctct ggaaattgat tgtggtctct accagcaaga gggctttgat acctacgagg     87660
     cagcgtttcc gttgacagat gaagaccgag aggaattcat tgattacatg caacgcaatt     87720
     ttaaccgacc ggccgaaaag gtcattcttg ttcgagaaga tgatcgcgaa gcaaatcagg     87780
     caaatgggga taaggtcgtt cctttccgca agccctcatg atgttttgct gcttcagtta     87840
     gacgatccca ggcatgctgg agcagctctg aaacagagtt gttccgtagg ttttccagtt     87900
     ccttcgcaaa cgtttcacgt gtgtggacca cagagagaag ctccggagca acttctgcag     87960
     gccccgtcat gacaattctg ctgagtgtct gaatgccagg atctatgtga cggacaatct     88020
     cgtacactgc ggcacaatga ctggcattct gtcgcagagg gctgtagatt ttctctgacc     88080
     agccagaagg caaggtttgc cgccagtaat cgttgcgaac atccccactc aatcggcctc     88140
     gtaagtgctt tgtttcaacg acgaggatgc caagaggcgt cagagccaca tgatcaatct     88200
     gagttgggtt tcctgatcgg gttggcaaca caatatcatg gtgactgggt agaccatatt     88260
     cagcaagaat gttcctgacg tccgtctcac ctttgcgccc ctgaatgtca gatttgaaag     88320
     ctttcaagaa cgagttttct cgtgcagacc gcattggagt cccgtatcgc cgacgcatta     88380
     gatgtccctc atttcctggg atacacgcaa cactttcttg cggcgcctgg cttcacgctg     88440
     gcgtgcacaa actaactcgc gatttcgagc atagtatcgt tgatgctttg acatgttatc     88500
     gccagaggtg cgcggataat gagttgtttt gtgcggtgaa ccgttgggtg caatgacaat     88560
     gttttcagtt tcgacagggg acgtcatgac cgaatggttc gacagtttgc tctcaacaga     88620
     ctggggactg gattttcgcg gcattacaaa ctcctcactg atcgggaacc agtttggagt     88680
     gtgctgatgc gacgaaaaat actcattttt tcaggaaaga gacttttatg atgccttgac     88740
     gcggatttct cacacttgag gcaatttcgg gttattttgt agaattcagt catcccacag     88800
     gagcccgatc tggaatattg acgatattgt gcttctggcg gcgggttctg aacgcagtga     88860
     gggtgtcacg gcctgagaag gcagtgttgg tggaagctat gtggtctgtg cactgtctgt     88920
     ttcttcagat ggcctgccgg agccttcgca atcgtgcatg agcgagggcg aattcatgct     88980
     gacaggggaa catgtccggc atggacagga caatccgacg gacgctgagc gttacacgtg     89040
     tcgcgatttt gagcagtcgt gcgcgtatgg tgccacaggt cgccgtctcc aggctggtct     89100
     ggccaagggc cagtctttgc agagcggtca gcaggacata ggctgcggcc gagaaccaca     89160
     gccggagctg gttggcccgg atggtgtggg acgaggtcct gtctgagaac agatccatct     89220
     ggcattcctt gatgcggttt tccatatccc cgcgtgcgca gtaaatctgt tcgtagagat     89280
     ggcgggggtc ggacattccc tgcggtaggg tggtgacaat gaagcgatga tagcggttgc     89340
     cgtggcgcca ttcggccttg gccacgaccc gcctgcggcg cgtccagctg tcctttgtga     89400
     tccagtcaaa ggaggcgaaa ccgcgcgcag ctctgcctgt cgtggcggct tcgtcacgaa     89460
     cctcagcgga caaagaggca atccggtcat acaggcgggt gttgcctgca agcccgaaca     89520
     ggaagtcaac gtggttgtct tcgcaccatg tcatcagact gtcccgggcg aaaccgctgt     89580
     ccccacgcac caggatacgc acccggggcc aacggctcct gatctgctcc acgatccggc     89640
     ggatgtctgc cagtgcttcc ttccccgggt ccctgtctgc cgtgcgcagg gtagcgctga     89700
     ggagatggtc cccgcagaag acatacaggg gaagatagca gttatggccg taatatccat     89760
     gaaaggcacg gccttcctga tggccatgga tacggtcatc ggtggcatcc acatccagaa     89820
     cgatgcgggc gggtgcgcgc tcatgctggt ccagaaagag cgtgacgaac agggtcgcca     89880
     gggcctcatg atcagcaatg atccggcagt aacgatctgc cttgtgccca ctgcgctcca     89940
     accggttcag tgtagatttg ccagccaatg ctgcgcagtt tgcccggcct cctgacagac     90000
     ggcccgaggc cagaccaaag atcaggtcat gccgcagggc atcgtgatca ttgagatctt     90060
     catagcccag tgccaggccc atgatccgct gacggacaag gtcttcaacc cggtattcca     90120
     caaaggcagg atgccgctta tcgcgaaaac aggcagcaaa gcggcggctg agacccagaa     90180
     tgtcatcagc ctgcttcacc agaatgacgc ccccatccga actcatgcga cccccgtcaa     90240
     aacgggccac aacacgccgt ccacaggagg ctggaaactc atacgcgcct gcgctacact     90300
     ctgtctgcat cgggttttct tgatgattat ggaaatttct tttctacaaa acagactttt     90360
     tcataatcta acccgatgta caacccttct gtgagatttc cgcgacgaaa caaccagatc     90420
     gttttggcat ccggaacgcg gtccgaaagc cccagaccaa gaaagcgcat gaaagagaga     90480
     cggtcattga tcagatactc cgttcggtcg tcggacagat tgttcagcgt ctggatgact     90540
     aggattttga acatcagcac cggatcaaac ggcggacgac cgcctttgct cctgtctgaa     90600
     taggccagag cctgctccag atcagggcgg aacgcctcaa aatccacagt ccgggaaaat     90660
     gcttcaagtt ggtcaccaag cccactcaac cgagcaagcc gctcttcaac atcaaaaaaa     90720
     ccagactgtt tcatgagcca tccccccaat catcacacaa aagagggaat cacagagaga     90780
     gacctaaaac cagagggttt ttcgaaccct ccaagtctat ctctcgtaaa tatttaatat     90840
     ataatccatt tattattgat ggtttttcgt aatttcttaa aatatttttt atatataggg     90900
     aaattttatc tattttatga gtctatagtt tatatttgaa tgcttctaca gatcatcaaa     90960
     ataagtaaag actgatattt gattatccat ctttcagttt aataaacatg cttcataagc     91020
     taaaaaacaa aaatttcgca ggcatctggt aaagaaaaag gctcaaggta gatataggcg     91080
     gctttcagag aaagcttcag ttcaaccgag atccgtattg ctgacgccaa aggatagccg     91140
     tgcggatccg cacgtcattc acctcgatat cccgccaagt aaagcccggc aataaatcgg     91200
     gaaatttcct gattgcggtc atgtttttac ctgcattggt ccagtggaca cacggcaaaa     91260
     aagcagaata tcaggaaacc attgtttccg tgatgaagac ctgttgatta tctccctgcc     91320
     gcgactgaca acggcgtcac tgggtagatc agttgggaca ctcatcaaca cgggcttcta     91380
     tcgtggctct ttgggaaaaa gggccgcaga cgctccattt gttcgttcgt cagccaaaac     91440
     aggtcgctca tctccagtca cttcactgag cctgaatcag atttccgcaa tcaaatcatt     91500
     agatcctgag ctgaggcatg accatcttga caaagtaagg gaatttcctt acctataaag     91560
     aaagttaaaa ctggagttaa gccatggtcg acttgctgaa agcagaaagc actatcaccg     91620
     ctaagggcca gacgactatt cccaagagcg tccggaaggc tttaggtgta gactatggtg     91680
     ggcgtattgc gttcgtcgtg gacgatcagc gccgtgttca tgtcgagaag gctacagaag     91740
     agacaagcga tccagtcgtt gagcgcttcc tcgaatttct ggagaaggac atgctcgacc     91800
     attcccgttc acgccttgtc aacttacctg ccagtctgcc tgatcgcgta gccgcgcttg     91860
     tcgggaatat ggacgttgat ctcgatgatg agattgaagg tgatgtggcg ctctgaccat     91920
     gctgacgatt aatggctgga ccatcctagc gcatccgctc tttctcgatc agttggaaaa     91980
     gctcatcggc gctgttgaag agttgaagga aaaaaagccc cacgaatatc aaaagaaacc     92040
     gagcacgaag ttattggccg ctttgaacaa gctgatcttc cagtcaatcc ctgccgatcc     92100
     gacagcaacc gtctatagac aaggcggaac gcttggtgaa gcgcacaagc attggtttag     92160
     ggcaaagttc gggaatggtc gctttcgcct gttcttccgc tatagttcgg ccgagaaaat     92220
     aatcatcttc gcttgggtga acgatgagac gaaattgcgc acctatggtt caaggactga     92280
     cgcttacaaa gttttcaagg cgatgctaca gaagggcaac ccgccagacg attgggacgc     92340
     tctttgtgcg gctgcgtccg atcaggctac agttgaccgg ctgggtaagt cctctcctcc     92400
     aaattcgtga cgaatgcagt ttaacgttac agcattgcat attgtccttt ggatcggact     92460
     gtgggctgcg cctgaaccat gctaaggatg cgttttcgcc attaggctta aatccaatag     92520
     cgcaatggcg gttggggaca cacgaagcct cgaccgtaaa tcacgttggc agcatgctaa     92580
     ctagttttga cggttaggca tcaagcgcga tgatagcagg actatatcgc gctgattact     92640
     tcggatatcc atcagtttaa tcacgcctga atgtcatcag gaaatggcaa agccggccat     92700
     ttactttact taaacttact tgacttcaaa ctccgccctc ttccccatac ctacctgcga     92760
     taatatcaat atcccgctaa accattatga agatgtgcta aacgaacagg aataacggga     92820
     tatgcataca ttgatgatgc ggtattaatc tgtctgtttt tgtttggaaa tctcgccaag     92880
     gtgctcaaga attgccagca aaatgcgcgg tgcaccacga taaccttcat ctccttccgt     92940
     ttccttaatg ttaaccatgg catcaaacag gcgataagct gggccatccc tatttgagat     93000
     aacttcttca atcgcatcca ggtctaattc gagagttttt tgtccagcgt tccgtagggc     93060
     agtatattta tcaagcgcat ccacgaaata aggatctgat gaccaatgtc tcgacattct     93120
     gatgtgagcc ttattgttca agtttgaaac tatagtacat atgctctttt atatcagccg     93180
     aagtaatctg ttcgtaaaga tgaggaagaa ctttcacgcg gacagaaatt cattgcaaac     93240
     tgacattcta gtggtcgcta tttctataac agaataatta tttcgcatgt aaaatcgaga     93300
     tgatgttttg atatgtagaa aatattttcg ccaggtgagc gtagaagaat acacttgtgt     93360
     tgccttctgc acgtcatcca gcgccagccg tatcaacgcg gaaatctcac agaagggttg     93420
     tacatcgggt tagattatga aaaagtctat tttgtgtaaa agaaattttc gtaagctata     93480
     agaaaacccg atgcagacag agtgtagcgc aggcgcgtat gagtttccag cctcctgtgg     93540
     acggcgtgtt gtggcccgtt ttgacggggg tcgcatgagt tcggatgggg gcgtaattct     93600
     ggtgaagcag gctgatgaca ttctgggtct cagccgccgc tttgctgcct gttttcgcga     93660
     taagcggcat cccggctttg tggaataccg ggttgaagac cttgtccgtc agcggatcat     93720
     gggcctggca ctgggctatg aagatctcaa tgatcacgat gccctgcggc atgacctgat     93780
     ctttggtctg gcctcgggtc gtctgtcagg aggccgggca aactgcgcag cattggctgg     93840
     caaatctaca ctgaaccggt tggagcgcag tgggcacaag gcagatcgtt actgtcggat     93900
     cattgctgat catgaggccc tggctaccct gttcgtcacg ctcttccttg accagcatga     93960
     gcacgcaccc gcccggatcg ttctggatgt ggatgccacc gatgaccgta tccatggcca     94020
     tcaggaaggc cgcgcctttc atggatatta cggccataac tgctatcttc ccctgtatgt     94080
     cttctgcggg gaccatctcc tcagcgctac cctgcgcacg gcagacaggg acccggggaa     94140
     ggaagcactg gcagacatcc gccggatcgt ggagcagatc aggagccgtt ggccccgggt     94200
     gcgtatcctg gtgcgtgggg acagcggttt cgcccgggac agtctgatga catggtgcga     94260
     agacaaccac gttgacttcc tgttcgggct tgcaggcaac acccgcctgt atgaccggat     94320
     tgcctctttg tccgctgagg ttcgtgacga agccgccacg acaggcagag ctgcgcgcgg     94380
     tttcgcctcc tttgactgga tcacaaagga cagctggacg cgccgcaggc gggtcgtggc     94440
     caaggccgaa tggcgccacg gcaaccgcta tcatcgcttc attgtcacca ccctaccgca     94500
     gggaatgtcc gacccccgcc atctctacga acagatttac tgcgcacgcg gggatatgga     94560
     aaaccgcatc aaggaatgcc agatggatct gttctcagac aggacctcgt cccacaccat     94620
     ccgggccaac cagctccggc tgtggttctc ggccgcagcc tatgtcctgc tgaccgctct     94680
     gcaaagactg gcccttggcc agaccagcct ggagacggcg acctgtggca ccatacgcgc     94740
     acggctgctc aaaatcgcga cacgtgtaac gctcagcgtc cgtcggattg tcctgtccat     94800
     gccggacatg ttcccctgtc agcatgaatt cgccctcgct catgcacgat tgcgaaggct     94860
     ccggcaggcc atctgaagaa acagacagtg cacagaccac atagcttcca ccaacactgc     94920
     cttctcaggc cgtgacaccc tcactgcgtt cagaacccgc cgccagaagc agaatatcgt     94980
     caatattcca gatcgggctc ctgtgggatg actgaattct acaaaatgac ccgaaattgc     95040
     ctcaagtgtg agaaatccgc gtcaagtagg gccaaacttc gatgcgtcat aatcagcatg     95100
     cgttgcagat ttgaaggatg tgttgcaggt aaacccgcgt gtatcttccg aagtatagca     95160
     agacgagtaa aggaatgctg gatttcgact ttgttgaggg gtagggaatt cgtgttaatt     95220
     ctgttatcag cctctcatga gacgactagg gcctgttaga tcttgaattt cttcccatat     95280
     tgtagggatg gaagaaggag acagaacagg cacctttacg gacgagacat gggcgatctg     95340
     ggaacctctg attgaggagg ttcgcccgag gggcaagacg ccgccacatg atctgcggcg     95400
     gacgatagca gcgattttct ggcgtcatga gaatggcgcg aaatggcgga gtatccccgc     95460
     tgaactgggt ccgtggtggc gggctgcgca gcttttcatc cgctgggcga agctcggcgt     95520
     atgggagcgg ctgctcgcac tggttcagga acaacaggga gtggcattcg gaatgacttt     95580
     tctggatggc acaaacatca gggctcacca caaagcggcg ggagcccaaa aaaaggggcc     95640
     tctttcgaag agcgagacca tcgtgaagca cttggccgct ctcgcggtgg ctatggcaca     95700
     aaagtctgcg tgatcgctga tggacatgga aaagccttcg gttttgcgct ggcccctgga     95760
     caggctcatg aactgcctct ggcaccagcc atgctcgaca gccttcccgc cactcccctg     95820
     tgggtagtag cggacaaggg ctacgcgtcg aacgccatgc gtgaacggat atgggacatg     95880
     ggagcacggc cagccattcc cgcgaaacga cgcgatggcc cggtcgcctg ccccaaatgg     95940
     gcctatcggt gtcggcatct cgttgagaac ctctgggctc gcctcaagga gtggcgcgct     96000
     gtcgcaacca gatatgaaaa aacagcaacg tcgttcctcg cggtcatcca catcgctgcc     96060
     gcagcagact ggatcaagcc ctaacaggcc ctagtcgtta ttattaagct gtatatggtt     96120
     ggggctttct tttatgcggg aaagcccctt tccgtcgcat gtttgttgca gatgcagttc     96180
     attcgtcttg ggaaatagaa tatactggaa taaaaggctt tgacgaatcc agaaatgctg     96240
     agaagtgtaa tcatgtaaat gagtagttca atgcaattca tggggtatcc tcttccaaaa     96300
     gtaagtatct gagcctcatt ttcgcgctgt tcactcatgc gctggaagac ggataggctt     96360
     tgaaagaatt ttctacctgt gtcgtgaaat aaataatggg gattatattg aacgtcatac     96420
     tttgatgtta gaaatctttt aaaaaagtgt atcatataaa agtttgaaat tgagaataag     96480
     aataaccgta gcaacgcccc aagcaagaat ggttattttg cgagagatag caagttctcc     96540
     cattttgcgg cggtcagata caaacattac taaagggata acggcaaaag ggagctgcat     96600
     ggacagaata acttggctta gcatcagcag ttcccccacg cctttactgc cgtaaagtgc     96660
     ggtaacaact ataacaggaa taatagccaa gccgcgtgtc agcaaacgtc gcatccagtg     96720
     tggtattctt aatcttaaaa agccttccat aataatttgc cccgccaatg tgccggtgac     96780
     agttgagtta gttccagcag ccagaagggc aacggcaaac agagtggagg caatgcctag     96840
     tccaagaata ggagagagca ggcggtaagc atcttcaatt tctgcaacat tttgatggcc     96900
     tgttgtatga aaagccgctg cggcaacaat aagaatggca gcgttaataa acagcgccag     96960
     cataagagca attgtactat cccacgttgc ccaccgaatg gcttctttac ggccgggtaa     97020
     tgtgtgttca aaagcccgtg tctgcacaat agcggaatgg aggtacaggt tatgtggcat     97080
     aaccgtagcg ccaataatgc cgattgcaat gtagagcatt tgactattgg ttataatttc     97140
     gggggaggga ataaagcctt taagcacttc ggcaacagga ggggcggcag ctacaatctg     97200
     cacgccaaaa cagatagcaa taatgctgag caaaccgata acaaatgctt ccagatacct     97260
     aaagccgcgg ttcattaaaa agagtacgat aaacgcatca agaaccgaga taatggcacc     97320
     gcccaaaagt ggaataccaa acaaaagctg aagcgctacg gctgtgccaa taacttcggc     97380
     cagatcgcat gcaataatgg caagttcaca tgccagccac agaacaatgt taatggcagg     97440
     cggaaagtga tctcggcagg cttgggccag atcacggcca gtcgcaatgc ccaatctggc     97500
     ggagagcgcc tgtagtagaa tggccattag gtttgaaagc ataataaccg caagcagagt     97560
     atacccaaac tgggcaccgc cttgtaagtc ggtggcccag ttgccggggt ccatatatcc     97620
     cacggaaacc atgtaacccg gcccgatgaa agccagaaaa cgcttgaacc aaggtgtgcc     97680
     ggcagctggc aatttaatgc tagcaaaaac ttccggcaaa ctttggctgt ctgcatcgcc     97740
     tgttttggca aaacgccatg cagatttttg tggaggcaac ggtgaaactg aagagtgcga     97800
     gtcttgggtc ataaaacaag actaaactgt acctgattaa aatatgcaat atgctatatt     97860
     acaaagcaca gtgaaacttt tgtatattat gggtttgcat gacgcgtgat gtaagatatt     97920
     cgtcttggaa tactttattc tttatggaat attgttaacg atatggaacc agagtagctt     97980
     tataaagctg ctggaaaatg gacatgcagc aacgtttcga tacggtagat acattgcctg     98040
     atgcgcaaac gcattcagaa gggtttcgtg tgagtcgtga ggcacgacaa catgccctga     98100
     ttgaagatta tgttgaactc atcgcagatc ttctggatga agggcaagag gcgcggcagg     98160
     ttgatttagc catccggttg ggtgtttctc agccaacggt cgctaaaatg ttgatgcgtc     98220
     tgggtgatga ggggttggtg gtacgcaaac cttatcgtgg tatttttcta acaccagaag     98280
     ggcgcgaact ggcagaaaaa gtgcgcgcac gccaccgtac tgttgaggcg tttcttctgg     98340
     ctcttggtgt aagcccatgc aatgcacgaa ttgatgccga agggctggag cattatgtgg     98400
     gagccgaaac gctcaaagct tttcagctcg ccattgatgc tgatcttggt aatttcatgc     98460
     aaaaagccag aaaaaataaa ggtgccagct ctctgaatat caggcgcttt taaagcgaga     98520
     gatatcaata atcagattat gctgagcctg tagactgggt ttgtgtgtaa ctgaaacaat     98580
     ggtgatgttt ggcagactct gccgaaggtg tgcgtagagg atattctcgg cagtttcatc     98640
     cagattggat gtggcctcgt ccagaaaaac ccaatcaggt ttgttaagca ggatacggcc     98700
     aaacataagc cgctgctgtt ctccggaaga aagggtttgt tcccatactt cctcatcctt     98760
     tagtctgggc gcaagttggg gcaggccaat ttgccttaaa atctgttgca acacagtgtc     98820
     atcgtaattt tctgcctcta aaggatagca aaggatctgc ttcaagtttc ctaaaggcag     98880
     ataggggcgt tgcggcataa acatcatgcg caactgaggt tggtgaatgc agccagaagc     98940
     aaaaggccag atattggcca taacccgtaa aagtgtggat tttcctattc ccgaaggacc     99000
     tgcaagagca atgctttgcc catgaggtag ggtaagagaa acattttgca gcagaatact     99060
     accatcaggt ttgaacacat ccacattctg caaaatcatg tctgacagat cggggattgt     99120
     ctgacgttct atggtctgtt cgtattcttt tgctctgacc atcatacgct gaaacatggc     99180
     aaggcggatg acatttgcac gccattcagc aagggaactg tatgaagaag caatccagcc     99240
     caatgcacct tgaacacgag aaaaagctag aacaagttgc atgagagtac caaagctgat     99300
     ttttccggca aaatatcgaa cagaaccaac aagcagtgcg aaattaccgg aaagcacttc     99360
     caagccgctg gtaagcaggc ctaaccactt gctacgcttc atgatcagga aaaaattatc     99420
     atacacggca gtaaaacggg atgttaaggc gccttgctct cttttgctgc cacccgtgag     99480
     tgcaatactt gccgcatggt tgcgaatatg cacaagagcg taacgaaaat cggcttctac     99540
     tttttgctgc tgcgtttgca agttaataag tttgcgcccg caaaaatgcg ttataatggt     99600
     tgcaataatc gaataaataa gggcaaccca cagaaaataa ccaggaatac gcaaaccaaa     99660
     tataacaagt ggtcctgata atacccataa caaaccaata taacttacga gtgtaataag     99720
     gtttgaaaaa agactggtaa attgcgtaag ggtatctgct gcaaaacgat caatatcttc     99780
     ctgtatgcgc tggtctggat tatcagcgct gatattcatg ttggcagcct gcatggcaat     99840
     aaggaaggct gtattctggt ggagccattg ttggctcatg ctgcgagtca tccatgtgcg     99900
     ccagcgtaat tgcagaagtt gctgcaggta tgtagcataa accccggcca gtagggcggg     99960
     aatggcaatc aggaaaaatc cgggaacaaa accttcaaag gtatgagaat accagaacaa    100020
     accacgtaga aatgttgata aatctttttg ttgtagggcg gtataataga tattgcgtga    100080
     aaaagactgc catacatcca gccccaccat aagaagcgtt aagccaagaa ctgctataat    100140
     aagcaaccat gctttcttac gatcttcaga agaaaaatac gggcggctga ggaaccataa    100200
     atcacccatc atctgaaaaa gttgcttcac ccgaatgtcc caagatcttt gataattatg    100260
     ttatgttata atatgtccaa aaggcagtaa attaccttgt ggcatctgca cactgagatg    100320
     gtgaggttgg tagtaatgca agttctttca taatcggttg ttttgtacga agtgctattg    100380
     gcttgaagat tgaataatat atttgcaagg agagattgaa atatggcgcc aaaataagtt    100440
     aaggattgcg ccaatttgca acggtcccgc gcaagcgggt ttgaaaggga atgccggagt    100500
     ttcaattact gaaacctagt cggcaactgc cctcgcaact gtaggcggag agcacattac    100560
     ttcatggtcg cataaagcgg cagccactgg tggcagcatc gggaaggctg agtaacgtgt    100620
     gatgacccgt aagtcaggag acctgccgtt gttgtctagt ttgatcgccg ggcgagggaa    100680
     ccggagatgg atgatgtcat gtttactctt ctgcctttgg cagatttctt ctcaaatttt    100740
     tcaggcattc tcccttcact ttgtatggtg aagccaaaca atgcctgacc tgacaaacaa    100800
     aatatggaag aaatttccat attcattgca ttgcttgctc ttggttgccg gcgtttgggg    100860
     aactctacct acttttgcac atggtgaaga aacacaaatc gaggaagatc gtcgtcgtct    100920
     tggcaattct gggccgctga ttgagcagat tgatccggcc acggtgcggg attcccagcg    100980
     tgcttcagaa gacgcggcag cagagaaaaa aggcgatgac accccagata tgagcgacca    101040
     cctgctgggc aacatgtggg gcgcgcgaga ctggatggcc aaacacggta tcagctttga    101100
     cattcaggaa gtggatgagt tgtggggaaa caccacaggt ggcacggctt ccagggctga    101160
     tggcgccagt ggttcgggca ctggccccgc ctatgatggg gtaaccatgc caaccctgac    101220
     ggtggatctg gaaaagctga tcgggctgaa gggcggcaca ttcaacgtca gggccctgca    101280
     gctgcgcggg cgctccatct cgcaggatca tctggccaac tttaaccatg ttagtgggtt    101340
     tgaggccgac cgttccaccc gcctgttcga gctgtggtat caacaatcct ttctggacgg    101400
     gaagctggac gtcaaaatcg ggcagcagaa tttggagacc gaatttctgg tcagtgatta    101460
     cggggctttg tatctgaatt ccaacttcgg ctggcccatg gcaccatcag tcaacctata    101520
     tgcaggtggg ccatcttggc cgctgtcctc cccggccatc cgtatccgct atcgtccgtc    101580
     tgacaaattc actttcatgt ttgcggcagc agatgataac ccgccgggta accgcaacaa    101640
     ctcctttggc atccagaacg gtggcaacag cgcagacccc accaaccaga acaccaatga    101700
     tgaagatggc gccaacttca acatgggcac tggcgcgctg ctgattaccg aactgcagta    101760
     tgccctcaac ccccagcctg atgacatgtc acacgtcacc aaggatcctg gtctgccggg    101820
     tatctacaag ctgggcggat attacgatac ggccaaattc cctgattatc gctacaacaa    101880
     tcaaggcaag gctttaggga gtgcggctga caccacaggc attccacggt gggatcgggg    101940
     caactggatg gtatatggca tcattgacca gatgatctgg cgaccctcgc tccagtctcc    102000
     tcagtctgtg ggcgtttttg cgcgtgccac gggcaatggg ggagatcgca acatgatcag    102060
     ctttgccatt gatgcaggca tcaacctcaa ggcgcccttc aaggggcgtg acaatgacac    102120
     ggtgggtctg ggctggggta ttggccgggc ttcttctggc cagcggcgat atgatcgtaa    102180
     ctccggcgcg ccggtgcagg gtaatgaaaa ccatctggaa ctcacctatc aggcccaggt    102240
     gatgccgtgg tgggtcatgc agccggactt ccagtatgtc tggcatccct ctggcggggt    102300
     gactgactgg acaggtaacc gtctcgtcgg gaacgaagcc atcttcggcc tccattccaa    102360
     tatcactttc taggggaggg gggagcagca ggcgtgttcg gaatgctctt gctgtcaggc    102420
     tttgtcattc tatgatgagg gccgaccaaa ccatgacgtt ctgtttcaaa ctcttttgtg    102480
     cctgctccgg taggctctat taaaaaggat acaacaccat gaacacatct gttcatacgg    102540
     ctatgccggt tgcggcagcg ggccagagca ttccggttcg cgccattctg ccttgggctg    102600
     ttttcggcct gattgtttct gcactgctga tctactttgt gggtgcagag caaggtgcca    102660
     cttccctgat ttccgggcac gccgtgcatg agtttgtgca tgatggccgc catctgcttg    102720
     gtttcccctg ccactaaggc attagaagaa agttttactc atggttggtc gtcttttggc    102780
     ccgcggcatg gtcgcgggca ttctggctgc attgctttct tttgtatttg caaagatttt    102840
     tggtgaacca caggtagcat tggccattgc gtttgaagcg gcgcaggatg ccgcggctgg    102900
     tgccgcgcca gagccggaaa ttgtcagccg tggtgtgcag gcatcgtggg ggctgctgac    102960
     agccgtgctg atgtacggtg ctgcatatgg cggcattttt gctattgttt ttgcctttgc    103020
     ctatcagcgc cttgccgcat taagtccgcg cagtatggcg ctgttgcttg ctggtgttgg    103080
     gtttttaaca tttgtgctga tcccagatct aaaataccca ccaaatccac cggctgttgg    103140
     gcaggaagaa accattggcc taagaacgga aatgtatttt gcaatggttg gccttgccgt    103200
     tgctgtttcc atgatttctt tgttggtggg gcgtgcgctg tctcatgtca taggatattg    103260
     gaacggtgtt gtgtgcagca ttgttctggg gatcgcactt gttgctgcgg cgcagtttgg    103320
     tttacctgat atcaatgaag tgcctgacaa tttccctgct gtagtgcttt ggcgctttcg    103380
     ggaagcatcc attggaatgc agatagtttt gtggtctgtt ctggggctgg tgtttggtgc    103440
     tctggcagaa aaatgcctgc cagaagcaaa tggaatggca aggaaggttg cttgattgag    103500
     gttagagaac aaactttata aaatataaat gcacaaaata gcattgggtg atcctgtaat    103560
     gggctaaccc gatgctatat aagggatgct ctggctaagg ttttgacgga gacgttatct    103620
     tttgccaaag cctgaaaacg acttctccca cttgtcagat taaacttgcc gtaggtataa    103680
     tcaaaaaagt aatttatcga tggttctacg cgagtagatt aaaagggaac cccgtgcttc    103740
     tgtaggttat acaggaaagt cgggggctgc tcccgcaact gtaggcggta tgttatctct    103800
     tcggtgccag aaatggcagg ccactggtga tttcactggg aaggccagaa gggtgacgcg    103860
     aagccgtgag tcaggatatc tgccattgat tgtgcaacca tactgccgga cgggatgatc    103920
     cggaagtggg ggatatagat catgcagatt ataatacctg catattccag attattttgc    103980
     gtgcagaacc tgcactcttt cagcgttgac cctcttcctg cttaaaaact gattatcagt    104040
     gcagatctat tggctttgtg ttcatgccat aggggtaaac tgcgcgtgtt gctttgtaag    104100
     taaaagctgg aaagtttatg agacatgaca ttacaaaact gcgcatccca ctgtgcggag    104160
     cttgatagcc ttatcctgtg ttatttgcag gaacgacata gtttgtcttt tggccgtgta    104220
     gaaagggttc aatcgtgagg ttacctttta tttctacaac aagccatgct tcacatccgt    104280
     tgcttgaaaa aattatcatg cttgcgccag acagaacatg tatttccaaa tttttcgggc    104340
     cagaatattt tctacctgtt gaagtacaac tgcaacaaaa cggctatgat ttgttcgagt    104400
     gtatgattac aggtttaccc gttcatcatc aggcacgggg tgattatcta gaagcgcact    104460
     ttaggccatt gctggatgca acactggata tggtaatggc attgcaacat gtttctgctt    104520
     gcacgtcagg aacagaatat gtgcaaactt atattgccgt gcaaaatctt attggtgcac    104580
     aaaaagctgc aatggctatg tattgcagta cttacaatta cgaaaaaaat ctgttgaata    104640
     gagaatgttc tttaaaaatc ttcagctatg cataaggaga atttgttttt ctgatagacg    104700
     tttggtaggt aattttaaca aaatcgatgg tttcgtgcaa acggattaaa agggaacgct    104760
     gtgatatcca tgcgctggtt ggcaccagta atggattaag tcagagactg tgcccgcaac    104820
     tgtaggcaga gattttttcg gatatgtgtt ttattgtaaa cataaaacag tcactggtgc    104880
     tggcgtaccg ggaaggcagc cgaaaaagat agatctgcaa gtcaggagac ctgccatcgt    104940
     tgtttcacca tgtcgtcggg cgggatgaac cgaaggcagg acgaaaaaca tgtacagatc    105000
     agtatggcag atggctgcct gtcggttaac gaatgttatg gtggcgagca ctgggtcgga    105060
     gcaggtccaa tgcagcgaaa tgcttttgtt cgcaagtgca tgaacctgtc ttggccataa    105120
     ccccgacata cagccatgag agttgctatg agccacatca tcaatttccc ggcccaaagt    105180
     ggagcttcca gaccttatct gtcttcgaaa ttactgacag aaggacagcg ccgctttatt    105240
     ctttctctcc ccataagcgg agattatggt attccagcaa cagatatcgg aagtatacgc    105300
     acttctttga tattgatggg gtatgtcgag gcagggtatt cctctcgctg ggggcgtgct    105360
     gctgcacgcc tgacgcgcag agggtgtata ttgcatcaaa aactgatgtc gaaaaagggc    105420
     atctgatgac acagcaggaa aaaaaacctt ctaaccatcg cgaactttct gttggcgaat    105480
     tggtccatat cgctacaacc gtttgccgtg gtgagcaaca ggtggtttgg tcggactatt    105540
     ctattttaac ccgtcaaaga ttgatgacaa cgatatggga tttgaccaga aacggaagtg    105600
     tagaaaaata taatcatctt actatctccg agcatgaaga aaaaaatatc ataaataaat    105660
     tagatggttt gtacttatta aataataaga aaatattgga ttttataaga atgtttttag    105720
     gctttataag tccgcttcat gcgttgcatt ataggaatga aatcattaaa attttatcgt    105780
     attaactatt tattattcca tattttccgg cccatgtctt gcttgtagca gggaatgggc    105840
     cggggtacac atacaatggt ttttatggat gatagccttg ttggctatca taatcccctt    105900
     gaaaaatcat tttatgaaac ggtgaatgtg tacatttatg aagatgcacg tttttgagta    105960
     tcatgattca gtcctccagt atcaggcgag atacctcgtg cacgcaaaag ttgccttagt    106020
     gccagaataa ccggaaaaac ctcggcgtta tgatcaccgc caagatcttt ccatgcgcgc    106080
     tgctcaagct ccacaatttc acgatcttcg aaaaagacac gttctgtaaa agcaataagt    106140
     aatggccatg ccagatctag caataggggc acttttaacc gtcggataga gagcaaacca    106200
     aaaacacgat tggtcagttc ttcgctatct tgcggaacat aggaaatcca tagctccata    106260
     acgggttcat caatgccctg cgtttcgatc ctgagagttt gataaggata ttgagtacga    106320
     atggtcatga tatcacgata agcaaagtca cggccatcgc gccgcctttg gccataaatc    106380
     agtgcttcac tgataggctg cttgcctcct gttctggcaa aggtgtaacg cgcttcaaca    106440
     aaactttctc cactctccat gccaagaaaa cgcggtttca tcttgcccac aagtttgctg    106500
     tgcaaaactt gatgattcat atccatgagg ttttcatgca taaaactgta atggcaattc    106560
     acaacctgtc cgaaacggcg cgtccggtaa tgtctgtcgc ttatccgtgg aaagtcaggc    106620
     aacggtatgg tgttggcaag tgtttgatct cccataaaca caaaaagaag gccgtctttt    106680
     tcctgacatg cccatgtttt cagcttaagg caggttgctc cgggctgggc atttggtgca    106740
     acagattgtc cctcgtggtt aaacgctatg ccatgcgcca tacaggtgat gaggttgtta    106800
     tgcacgtctc ccttaccaag gagcacttgg cgatgagggc aaagtccatc taggctcagg    106860
     actcatagcc agaacaagac ggttgcggcg aggcagactg ccgagaagaa gacggtcggg    106920
     catctgtcat agcgtgttgc gacccgtctc cagtccttga gcctgccgaa catgatctcg    106980
     atacggtggc gtcttttgta tttccgtttg tcgtatttga ccggttttgc acgagatttt    107040
     cgaccaggaa gacagggttt gatccctttc tcctccaagg cctctctgaa ccagtcagcg    107100
     tcatagcccc ggtctgccag catccattcg gctggtggca gactgtccag aagggcagcg    107160
     gcaccagtat aatcactgat ctgacctgct gtcatgaaga agtcgagcgg acgtccgttc    107220
     cggtcggtga cagcatgcag cttcgtattc atcccgcctt tggtccgcca gatcaaacgg    107280
     cctgagcccc cttttttaac cgcaggctcg aagccgtgcg atgtgccttg agataggtcg    107340
     catcaatcat gattgtctga ggctctgcct tgccagtagc cagtccctcc atcatgcgga    107400
     tgaatacccc catagcgctc cagcgcttcc agcggttgta gagcgtcttg tgtggaccgt    107460
     attcccgggg cgcatcacgc cagcgcagac catttctgtt cacgaaaatg atcccgctca    107520
     acacacgacg atcatcaacg cgaggtttgc catggctctt cgggaaaaag ggccgcagac    107580
     gatccatctg ctcctccgtc aaccaataca ggtcactcat cttcagtctc ctcacagagg    107640
     ctgaatcaga tttccgcaat catatcaatg ggtcctgagc ctaacactac agttgcattt    107700
     tgtgtcgtga gtgagcgcgg atagcactgg cctgatgcgt tcgtcgaaag acggaccatc    107760
     tgaggatgtg agagacgggt agtctgcgtt gtgcaagttt tacgacgagg cgcctgatct    107820
     cctgaatgga ccagcggaca aggactgtcg tgttctgagt tgtgtttttt tcggtttcag    107880
     tgagtttgcc tggtaacgga cactggccat gacggcatag gccagcatga ccagagagac    107940
     atgccgatgc caaccatgcc aggagcgggt ctcgttatga tcaagaccaa attcgttttt    108000
     ggccgtctcg aacccttctt cgatcctcca gcgcgtccct tcaacgttca ccagttcctg    108060
     cgtggttgtc cctttcgggc tccaggtcgt aaaataggca aggtccccgt cagcgatgtt    108120
     tcggcggatc aacaggccac gtgtccatgg tccggctata gggcagtcaa attcttcagc    108180
     atccagatca gcaagcggaa gatacgccca gtcataaagt cgctcacctt ttgtgccgtg    108240
     ccccgctgac agacgacgcc aggcctggtc tggcagtcct gctgcaatat ctttcgcctc    108300
     tccggcaatc agcggttccg ttgcccatga tccgaaccag tgattgccct tgaccccaag    108360
     cacatatcca attcctgccc ggcgaagcgt gcgttctacg tcgcccacgc catacacgct    108420
     gtctgctgca acccagcgga acggcacacc ggcctcaata cttcgctcaa tcatcatcga    108480
     ggctaacgcc ggtttggttg caaacaccac gtcatcggga acgtgggccc gcttcagacg    108540
     ctcaggcttt gatgtccagt ctttcgggag atacagggcg cggtcaataa aggcatgccc    108600
     ccgttccgaa acataagcgc caaacacacc aatctggcag ttcgtgatct tgccggcaga    108660
     tcccgtatac tgccgcccca caccgcagga cgcctgaccc ttcttcagaa aaccggtctc    108720
     atcaatgacc agcacgccct cttcagtgcc cagatgctca atcacataat ccctgacgac    108780
     gtcacgaagg gcatcggcat cccagtgccc gcgtcccaga agcgcctgct gccgccatgg    108840
     accaggatct cctgcggctt ccgctcgcat ccatcccgtc ttgcgtggtt cattgccaat    108900
     caaaacatca agaaaagcac aggccgaatc tacgacacgt ttttgcgtga acagcggcgc    108960
     catccgatcc ttggcggacc gaagcgagcg cgcccataat tccagcgtct cttcaacaga    109020
     cgtaccgcca ctcatcatat cctgaatcat ggttacccat agattcagaa ctcaacacaa    109080
     aatgcaactg tagtgctaag ttgcctgacg tttcccggcc agttgtggcg ggcaagcagc    109140
     gacatggccg aagcggacag gctgatgttg cgttcgtatt tctgattgaa ctgactcaga    109200
     gcctgtttgg aaagtcatgg atgagcgttt cttcgggtga gattggcgcc catggcgacg    109260
     aagatcatgg cctgtgagac atcgatgcga cgctcgtaat cgcgcacgag gcgtcgccat    109320
     cgggtcatcc atccgaaggt tcgctccacg acccagcgcc gagggagaac ctcaaagcct    109380
     ttcgctccgt ccctgcgacg aatcacctcg acgacgaagt ccaggtaggc agccttgtcc    109440
     atcaactgga gccggtcata ggcaccgtcc gcgaatagat gcttgaccca cggccagcgc    109500
     ttgcggatcg cgtccaggat catctgcgct ccggcgctgt cggagatgtc cgccggcgtc    109560
     aggttgacca tcagcaggcg tccgtccgta tccacggcaa tatgccgctt gcgcccgaca    109620
     atcttctttc ctgcgtcgta acctcttgtt ttcgcgtgcg gcgccttgat gctctggctg    109680
     tcgatcactc cggccgaagg gctggcttca cggcccgagc gctcccggtc aagcatcagt    109740
     tccacatcat gaatggtctg gaacaggaac cgccgggcca attccctgaa ccaaccatag    109800
     accgtacgcc aatgcccgaa atggatcggc agcattcgcc agccgcagcc ggatcgaacc    109860
     aggtaacgca ccgcgttgat cacctcgcgg aattcgatct cgcgcggacg ccctgaattg    109920
     ccccgggttt tgtggagacg ttttttatct gatttaagcg gctaatgcat gtgatttctg    109980
     ttgtgcataa aagcgtgcct cagcttctgc tggcgggatg tttccaatgg aggacaggag    110040
     ccgccgatta ttgaaccagt cgacccattt aagtgttgcc agttcaacag cttccctgtt    110100
     tttccatggc ccctgccgat agatgagttc ggttttgtaa agtccgttaa tggtctctgc    110160
     caaggcgtta tcataggaat ccccaacact gccgacagaa gcaacgagcc ccgcttcagc    110220
     cagtctttgc gtgtagcgaa tggacacata ttgacagccg cggtcggaat ggtggggcac    110280
     ttttccctca ggctgcctct ggcacagagc ctgctcaagg gcatccagta cgaagtcggt    110340
     atgagccgtt gaggagacac gccaacccac aataacccgt gcaaagacgt caatgatgaa    110400
     ggccacataa acaaagccct gccaagtgga aacatacgtg aaatccgaaa cccacagtct    110460
     gttgggggca ggagcatgaa actggcgctg caccagatcc tgcggacacg gacgttgcgg    110520
     atcaggccgt gtggttctga cccccttgcc acgaatgacg cctttcagcc ccatccggcg    110580
     catcagccgc tctaccgtgc agcgggcgac atccacgcct tcacgtttga gctgatgcca    110640
     gaccttgcgc gctccataga cgcagaaatt attattccac actctacgga tgtcatcgca    110700
     cagttctttg tctttctggc tgcgcacaca cggatttttc tgtctggcaa cagttgcata    110760
     ataggcagat ggtgcaatcg acagaaccct gcagattgac ccgacaccat atgtctgccg    110820
     gtgctcctca atgaagcgtg tcatggcttg aagatgcggt cgagctccgc ctgggcaaaa    110880
     tatgccgacg ccttacgcag gatttcattg gcctgccgca attcgcggtt ctctcgctcc    110940
     agttgcctga tcttctctcg atcaggcagg tcactcaccg caggcgcatt ggcacgttca    111000
     tgcagacggg tccattttga cagcgtgtca ggatgaatat ccagctttgg cgctatcatc    111060
     atcactgcag accaccgcga aggatggttc ttctcttcct ccagaaccat gcgggctgca    111120
     cggtcacgaa actcaggcgg aaaacgcttc gatttattgc tcatgaattc ttcttacctc    111180
     acgggtcttt ctgtctccac aaaacccggg gcaattcacc ccgtgcgtcc cggctcgggc    111240
     atcagtggcg cgatgcgcgc ccattcctcc tccgtcatat cagacggata acgcttcgtc    111300
     ttgcgggtaa tcctggccat gcggcctctc tgctctggcg tccacatcca gagcttgaat    111360
     cacacttcag cgactttcca aacaggctct tatgtaaaaa ccatatataa aatatctgag    111420
     tattgtattt ttatattgat accaatcaat aaactctaag gttcataggt atatacactt    111480
     gtcttgcggc atggtctgtg atgccagccg caaaatagga ggcgagttac tatgccaaaa    111540
     tcagtagtta atcccgaatt ccttcccatt cttgagaaaa tgccatcttt tgatggtctt    111600
     tcgtcgcttt cactgccaga agtgcgagaa gtttttctaa catctgtgcg ccttatagaa    111660
     ggtcggcctc tgccagatgt tatcacgcgg gaagaatacg taccggggtt gaacaatgcc    111720
     ccagatgtgc gtgtggttgt ttatacgccg cgtgaagtgc agcccaatgc gccagctatg    111780
     gtttatattc atggtggcgg tcttgtttct ggccatccag aagtggatga ccccaaatgc    111840
     caaaagctgg ctagtgatct gggctttcag attttctcgg tagattatcg gctggcgcct    111900
     gaggtcaaat atcccggtgc aattgaagac tgttacgcag tgctgaaatg ggtgcatgaa    111960
     aacgccagaa aacttggtat ttcgcgtgat aaggttgttg ttgcgggtga aagtgcaggt    112020
     ggtggtttaa gtgcagcgct gagcctgatg gcgcgtgaca aaaaagaata caaactggct    112080
     tttcagttgc ttatttaccc catgctggat gatcgcacgg caataaacag tgacccgggc    112140
     gccaattttg gcgaatttgt ctggacacgt tctgccaaca aatacgcatg gcaggcttat    112200
     ctgggtgata aagctggcgg cccacaaaca ccaccatatg cagccgctgg ccgtgcaact    112260
     gatctggcag gtttgcctcc cacctttatt ggtgtgggat caatggatct gtttttgaaa    112320
     gaagatcttg attacgcaac gcgcctgatg gctgcggccg tgccaacgga agttatggtg    112380
     gtgccgggtg cgtatcatgt gtttgatatg tatgtgccag atgccgaact ttcccgcagg    112440
     tttatggatg cctactgtgc agcacttaaa cgcacattga atctgtaata ccaacagcgc    112500
     ctgacaggtt gtttcgcctg tcaggctgtg gtgttagctt tacccaccac ctctgcatga    112560
     agccatttct ctggtggaaa ctgcttccga tgcagccttg cgaagctgca aggcacaact    112620
     ttgcgcagaa ataatcattc tttgtgcgct agcagaaaag ggcaatctgc cgccgctttt    112680
     gcctgctgca ataagagcaa gatccttata cgcatctaca aaaatatttt gtgcaacact    112740
     gccaatatcc tcacagtcgc ctagatctgt cggctggaac atgttttttg cgcgaaaaca    112800
     aagcagagag atggagggtt cgaaaaaccc tctggtttta ggtctctctc tgtgattccc    112860
     tcttttgtgt gatgattggg gggatggctc atgaaacagt ctggtttttt tgatgttgaa    112920
     gagcggcttg ctcggttgag tgggcttggt gaccaacttg aagcattttc ccggactgtg    112980
     gattttgagg cgttccgccc tgatctggag caggctctgg cctattcaga caggagcaaa    113040
     ggcggtcgtc cgccgtttga tccggtgctg atgttcaaaa tcctagtcat ccagacgctg    113100
     aacaatctgt ccgacgaccg aacggagtat ctgatcaatg accgtctctc tttcatgcgc    113160
     tttcttggtc tggggctttc ggaccgcgtt ccggatgcca aaacgatctg gttgtttcgt    113220
     gagcgtctga ccgaggcagg cgccatccag cagctgttcg agcgctttga cgccaccctg    113280
     cgtaacgctg ggtatctgcc gatgtccggc cagatcctgg atgccacgct ggtggcagcg    113340
     ccaaagcagc gcaataccaa cggggagaaa gaggatcttc gtgaagggcg gatcccacag    113400
     gactggcagg acaagccggc aaagctgtcc cacaaggaca ggcacgcccg ctggacgctg    113460
     aagttcacga aggcaaagcg gcaggaggac gggacgctcc cggccacgga cctcgccatt    113520
     ccgttctttg gttacaaatc acatgtttct atcgatcgaa agtttcgact gatccggaaa    113580
     tggaagacga cggatgccgc tgccagtgat ggtgccagac tgcgcgaggg cctgctggat    113640
     aaaaccaata cggcctcaac ggtctgggcc gacaccgcgt atcgctcgaa agccaatgag    113700
     gacttcatgg aaaaggaggg ctttgtctcg aagattcaca ggaaaaagcc gcatttcaag    113760
     cctatgccac gacatatcca gaaatcgaat gcaggaaaat ccgttatccg gtcgcgtgtc    113820
     gagcatgtct ttgccgatca gaaatcgcag acagggctgt tcgtccgaac agtgggtatc    113880
     acccgggcca caatgaggat cggcctggcc aatattgtct acaacatgcg ccgcttcctc    113940
     ttcctcgaga ggttgaatgc gggcacgtag tcaccccggt ggcgatactc cccggtctgc    114000
     tcaaatcgca gagcaaaaat caggataagg aacctgaaat cacgcacaag agcactcagt    114060
     caaaggtttt tcgaaccctc cacttgtttt cgaagagtat tttctccatg tcaaatcaat    114120
     ttctcgtgaa acaggacccg catctccttg cccatgaagc tctgctgcag atacgcgatg    114180
     cgcttctgcc agcgctgcag ggcgtgcgtg atgggaaaaa ccaccatgtg gacggaatca    114240
     tcctgctgac ggagggtctt gtaaaagatc ttgacgctgc ctgtgacgcg ctggatgcgg    114300
     catcgcgaag ctgacacact tccggtcttc tgcctgttct caggcagaag actttttccg    114360
     gcaggaaaaa aggttgttat ttccgaaaag agggaggtac aaagttattg taaggtcacc    114420
     agtggccata catcatatca gattggcaat gtaaccttgt atttgaagat ctttattcta    114480
     agtttgcgct agtccatctc tgtaaatgga aaaagaggtc gtaattcacc ttccgtgtta    114540
     cctatattac tgtagcgctt gatggaattt tacgaaattt tttccaaaat attaacgagc    114600
     gggataaatt atgccggata cagtagaaga taatagtctg aatttctttt ggggtaaggc    114660
     gcggccagta gcggaagcgg aagaagttat atcttctatg catccactta ttgctcatat    114720
     gctggatgtg gcagcggtgg caatcttgct gccggagagc aaatgtttgg ggttggattg    114780
     tcgtcaatta ggtatgctaa ttgcattaca tgatatcggc aagttgaccc ctgcttttca    114840
     gtcgaaagtt ccagaatgct ggccagaaca ggcatttgga cgttgtcccg atgaagttgt    114900
     gatgtcacgt cacgatgcag atggtttatt cctgcttgat catatctgta aggatcaact    114960
     ggcaccgtta tttggcacaa atgcagatgg ccttgattgg tcacctaccg ataaaaaaca    115020
     attatggcgt gccgtagcgg gacatcatgg gcaacctgtt tcatcggacg aaaataaatt    115080
     ccagaatgcc gatcttaaac tattggcacc atatgctcac aaacttgtgc gggttttgtt    115140
     agatattttt cgtccacctc ccattccgtc atattctttt ctggaggatc tgctgcaact    115200
     ggaatggcgc ctcgcaggtt tgacagttca ggcagattgg atcggttcgc ggcaagaatg    115260
     gtttccctat gtcagacctg aagatgtggc agatgcttca ggctatttct ggaatcacgc    115320
     acttcatcgg gcgcaagcgg ccattgcaag tgctgggctc agccctgcca atatttcacc    115380
     atttcagggt atggcgagat tatttcctca catttgtaat tcttcgccaa ttcaggcttt    115440
     gctggaagtg gcgtcttttc cagctgaccc aacattgatc gtgattgagg atatgacggg    115500
     ttctggtaaa acagaagctg cattggtggc cgcgcatcga ctgatggcat ctgggcatgc    115560
     gtccgggttg tttgtcgctt tgccaacaat ggcaacggct aacgccatgt ttgatcggct    115620
     ggctattgcg tatcgtagtt tgttccagcc atcctcccat ccttctctcg ctctggcaca    115680
     tggacgtgct ttgctggatg agcggtttgt ctcggttctg gccccagatg atgcactgga    115740
     taatacaaca gtaaagaaag gccgtgatga tgcagccgaa gtctgttgtt cagcatggtt    115800
     gggaagtgaa tcgcgccgtg cgcttctggc gcaggtagga gtgggaacaa ttgaccaggc    115860
     attgatggct gtattgccag tccggtttgc aacggtgcgg caggcgggtc ttgctggcaa    115920
     ggtgttgctg gttgatgaat gccatgctta cgatccttat atgcaggaag aaatggtggc    115980
     tttactacgt ttccatgctg ctatgggagg ctctgcaatt ctgctttccg caacactgac    116040
     caaatctgtg cgccagaaac tggtaacggc attcagggag gggttgcgtc agaaagagtc    116100
     agtcggtttg tcttgtatgg cttatccact tgttacgctt gttgggagag atggagcgga    116160
     ggaacttcca tgcgcgcctc gtcccggtct ggcgcgtaac attgctgttc ggcaaatgag    116220
     cgatgcatca tccatcatgg catatgtttc tgatgcggca gctcaaggtg cagctgtggc    116280
     atgggttcgt aacacggtcg atgacgttat tacctcggca aaagctttgg aggcagaagg    116340
     ccttgatgtc atggtgtttc atgcgcgttt tgccatggtg gaccgtttgg cgatcgagcg    116400
     tgaggtgctt gctcggtttg gaaagaacgg aaccactgca gatcgatcaa gggttttgat    116460
     agccagtcag gttattgagc agtctctgga tcttgatttt gatgtgcttt gtacagatct    116520
     ggcacccatg gatttgatta tccagcgagc gggccggtta cgccgacatg aacgtgcgca    116580
     gcgtccggtg gattgtgacg aaatttgcat tttttcacca aatccggtgg ctgacccaga    116640
     tccgcagtgg atcagtcgtg ttttgccggg cacagcagct gtgtatcgtg atcctgccct    116700
     tttatggcgc accgcgaaag tgctgcaatg caaagggcaa atacgtagcc ccgatatgat    116760
     acgggagttg attgaagagg cagctgatac ttctgatgtg ccaaatgggc tcatgatggc    116820
     cagtgatgaa gcggaaggaa aaggccgcgc agcgcgtggc gcagctattc ggaatatttt    116880
     gaattatgat gcaggatata ctccagatag tgcgttatgg gagcgggaag ttcgcatatc    116940
     aacaaggttg gaggagcgtc cctacgtaac agtacgtctg ggtgttatga aagatggcca    117000
     ggtatggcct tgggctgcat tacaacaaac ctctcttgct gtaccgcatg agcgaaaacg    117060
     tgcctggacg ctttctgaag tttcagtggc gcagcatact cttgcggcat gtccggttgc    117120
     cgacactcag atggaggctg ttgccgcagc ccgtgcagaa tggtcacgtt gggagcgtga    117180
     ggcagaagat cagtttctct tgttgctgct ccatgagact gaagagggat ggaaaggttt    117240
     cgggtttaat ggaaaggggc aggatgttga tatctgctat gataaaaaat atgggtttca    117300
     aatatcaaaa agaaatctag cataaacaag aagcttttgt attttactgg gaatctatta    117360
     ttatataagc aagagttgga aaagtaatgg cgcacggatc attaaatctc atttcagacg    117420
     catggctgcc agttcggcat aaatccggtg catccagcat tattcgtccg gctcaaattg    117480
     tagaagggtt tgaagaggac ccgattgttg gttttgactg gccacgagcc gattttcgta    117540
     ttgcatcctt tgaatttctg attgggcttg ttgcgacagc ttgtccaccc acaaatcgaa    117600
     ggatgttgcg gcagaattgg tgtaatccac cgtccgttga aaagcttgat gaagcttttg    117660
     cgcgtattgc agatgctttc tggctggatg ggccagggcc acgtttcctg caggattatg    117720
     aggaccttca aagcgggcag gagcttgtgg aacggttgct gattgatgcg ccgggggaaa    117780
     gcacagtaaa gcggaatgca gatctttttg tgcaccatgg gcaagttgga cgattggggc    117840
     gagcggcggc ggctatggcg ttgtttacgc tacaatcatg ggcgccgagt ggtggtgcag    117900
     gcaatatgac gggcctgcgt ggtggcggcc cacttacaac attggttttg ccatcagaaa    117960
     acgcgcgttt atgggaaatt atctgggtaa atgttcccga tggggaggct gtgaaaagca    118020
     atgatatgga aaaggttttt ccatggatgg cccctacgat cctttctgga aaaggtggaa    118080
     cggatgtacg ccccacagaa aacgcacatc ccctccaatg ctggtgggga atgccgcggc    118140
     ggatccggtt ggattttgaa aatgttgctg aaggatactg cgaccttact ggtcagaaag    118200
     acgaggttct ggtgtcagga tggcgacaaa ggccctatgg gccgaaatat gcaggttgga    118260
     ttggaacgcc ttacgggtct ggggcagtaa ttcatcccct tacgcccaga tatcgacaaa    118320
     aagaaggaac cgaatggctg gccgttcatc cgcaacccgg gggtattggt tatcggcact    118380
     gggcaggtat tgttgcccag agtgccgata aaaaccggtt gccagcaagt tgtgttgcga    118440
     attggcgtaa cgagcgggca ggagaaattg gtcttccaga aaatgcccgt ttgcttacgg    118500
     ccggttttga tatggacaat atgaaggcgc gtagctttgt ggaaagcgaa atgccactac    118560
     cgggctcatt ggataccgag ttgcaaaaag ctcttgatgc cttggctctt cagtgcgtga    118620
     gcgcggcagt gcacgtggca gatattttgc gaggaagcgt tcgggaggcc ttgtttggca    118680
     agggtacagt ttctgtggac gtaacgctgc tttccaatgt gcgtgaacgg ttctgggcta    118740
     aaacagaaaa ttctttcttt gccattttgc aggatgcaac tggaacagat gacgaaggta    118800
     tggtggctct aagaaaatcc tggctgcaca tactggctca gtcagctctt ggggagtttg    118860
     atgctaccgt tattctggaa cctgatacgg gaataacaga agcgcagcgt tcagcgctgg    118920
     cgcgcaggcg tctgggagcc gccgtttcag gtatgggcaa ggagggaaaa aagatacgga    118980
     gcgaattggg tctccctgaa ctcgtcaaaa agaaacagaa gatagcagag aaggtatcct    119040
     gatgctcctc agtaataagg aagccattcg gcaggttgta aactggtggc atgggttaca    119100
     acctgatcct gagagaaaac aatttggaga ccgtgctacg ctagcccgct tgcgacgatg    119160
     tgcaactgta acagaggctc tttttgagcc acaaacgcag gcacttgtgc acaagtgtgg    119220
     tgccaagaag gactctgaat tatctcgtct ggcattggtt gcggcagttt tggcgcatgt    119280
     tcgggcaaac aagactggtg catgtatggc tcggttgata ggaccatctg atacaagtga    119340
     cagtgcaacc gcgctgtgca aaccggttcg gtttcgtagg ttactggata tggaaaccta    119400
     tgatgactgt ttgcgaagct ttcgacggct tgttgttatg gcgggcgaac ctttggatgt    119460
     cgcagacttg gcgcgttctg tcataatgtg gccgcgtgaa gatacatggg atgatctcgc    119520
     aggggatcag gtgcggcgcc aatgggtcta taattactgg aatgcgggga ttcccgagaa    119580
     cagttctgaa aaacataatt gatttaaagg gaatattgaa aaatgtctcg ttttcttcaa    119640
     cttcaccttt taacattcta tccaccctcc aatgttaacc gtgatgatac gggtaatccc    119700
     aaaaccgcca ctgtaggtgg cgttacacgg ttgcgtattt cctcgcaggc actcaagcgg    119760
     gcttggcgta catcagatat tttttcatca gctctggctg ggcatatggg ccagcgcaca    119820
     cagcgtctgg gtgaagaaat tctgggatat ctgcgtgaca agaatgtgga agagaaaaag    119880
     gctgttgcca tcgcgcggga agttgcgggt gtctatggca aggtgaaaag cgaaaaggat    119940
     aagaatcctg cgcggacaga gcagcttgta ttcatttctc cttcagagcg tgacgcggcg    120000
     cttgccatgg cggatcgttt ggcagcgggt gaaaaggtgg atctgaaaaa agagcaggat    120060
     acacttttgc acagggctga ttcagcggca gatatcgctt tatttgggcg tatgctggcc    120120
     agtgcaccat cctttaatcg tgaggccgct gttcaggtgg cgcatgccat tacaacccat    120180
     cgtgttacgg ttgaggatga ttattatacg gctattgatg atctgaagca ggatgaagaa    120240
     gatgcaggtg caggctttct aggcgaagct ggtttcggat ctggtgtgtt ttatctctat    120300
     ctttgcatta accgtgattt attaaagaaa aatcttggag aacatggtga aacaggtgtg    120360
     gcagaagcag ccttgggggc attggcagag gctgccatga ccgtttcacc ttctggaaag    120420
     cagaacagtt ttgctgctct tgcccgtgcg ggatatgtgc tggcggaaaa gggaaatagc    120480
     cagcctcgta cattggctgg tgcttttgcg cggccggttg gaggaacaga cttgatggaa    120540
     cattccgtca aagcgctgaa agagtttcgt gaagaactgg cacgtgttta tggggcaggt    120600
     gtggatgaaa catgtgagat gatcttagga gataagaaaa gtgcgacgtt ggcagatatt    120660
     gtcgcgttct gtcggtcgta aggaatatgg ggcattttct gacatttgcc atggtagccc    120720
     ccatggcatc cttcggcacg ctctctgtcg gagaaagacg ggatggtgag gaccgacctg    120780
     cgcggtctgc cgtactggga ttggtagggg cctgtctggg cattacacgt aaggacgtgt    120840
     ctggacagaa cgcattggca gaagagtatg gccttgctgt tttgtgtcat gcttctggtc    120900
     acgtgttaac ggattatcac acagctcaga cagcaccttc acgccgaaac tggcggccta    120960
     caacacgggc acaggaactg gctgatgctc ctggtgagtt ggcgacaatt ctttcacgtc    121020
     gagattatcg gataggaagt tggtatctcg gtgccatttg ggtgcgaggc agcacttctc    121080
     actggtcttt ggcagaagtg cgtgatgcca tgcaacaccc tgtctttacg ccctctttgg    121140
     ggcgtaaggc ttgtccactg ggtctgcctc ttgcaccaga acttgcggaa agcgagtgtg    121200
     cggtatctgc tcttttggca cgccagacaa atggtcctga aagtcaggtt cataaccgtt    121260
     ctggcttgtt caggaatcaa ctttccaaac gaaatacacc tactgaaaca cttgttgtca    121320
     tggatattgc agacgtggcg gaacagggtg gtggccatac tattattcgg cgtgaaatgc    121380
     gccgtgacca acctctttcg cgtgcacgat ggcagttcgg gctgcgtgaa gaggctttgc    121440
     ttctgtgtaa aagggaaacg gcgtgatgac tgtaggtttc ctttcgcgcg ttgcattacg    121500
     gcgcgatgcg tctgtgcagg cactggctgg acttctggtt ccacagggag aaggtcgtca    121560
     gcatggagcc gcacatcatt tgctctgggt attgtttggt gatgactcca gtcgtattcg    121620
     tgattttcta tggcgacaga ccgagccagg acatttcatg atcttatcag cccggaagcc    121680
     agtggatagc catcggttgt tcgaaattga aagtcgagag tttacgccca aattaaggga    121740
     aggaaatcgg ctacgctttc ttttgagagt aaacgcgaca gttgatcgaa aagtgccagg    121800
     acgtaagcgc agtcaacgcc atgatgtggt gatggatgca ttgtataaat tgccggcaaa    121860
     agagcgggct gcagcgcgtg aaagccttgt acccaccgca atggaagcat ggttggccag    121920
     acaggggcac cgtactggtt ttgagctcaa agagggtaag ctggctattg aaagttgtga    121980
     tgtcttgcat attccgcgtg cacaagggca gggtaaggca acttttggtg ttgtcgatgt    122040
     aaccggagaa ttatgtgtaa gaacaccaga tctttttacg caggctctta tgcaaggttt    122100
     tggcagggca cgtgcttttg gttgtggatt gatgcttgtc cggcgcacaa tttaaggagg    122160
     cttgattgtg tctcgtcctt taccgggctt accaccaccg cggccaattc cgttaaaaga    122220
     gcgttcatca attctgtttg ttgcaatggg tcagctggat gtgttggacg gggcatttgt    122280
     tctggtcgat cagaatggta tccgcacaca tattcccata ggtggcttag cttgccttat    122340
     gctggagcct ggcacacggg tgagtcatgc cgccgctgca ttggcagcac gtgctggtac    122400
     tttactgata tgggtgggag aggcaggcgt gcgtctgtat gcctcaggtc aacctggggg    122460
     agcgcgagct gacagattgc tgttgcaggc gcggttggca cttgatgata cgggccgcct    122520
     gaaagttgtg cgtaagatgt atgccctgcg ttttggagaa gatgcaccag aaagacggtc    122580
     tgtagatcag cttcgtggta ttgagggtgc acgtgtaaga gagacatatc gtctattggc    122640
     gcattctcat ggtgccgact gggatggacg gcgttacgac ccgcacgagt gggatactgc    122700
     aaatgtggtt aatcgctgtt tatcagccgc aactgcagca ctttatggca ttacggaagc    122760
     tgctattttg gctgctgggt atgcgccagc aataggtttt ttgcacacag gcaaacccca    122820
     aagttttgtt tacgatattg cagatattgt aaagtttgag gttgtggtac ctgaagcgtt    122880
     tcgggtagct gcagcagtac agcgcgatcg cccgcttgac ggccagaggg tgacagatcc    122940
     ggtagcggct gtaaggcatc ggtgccgaga tcaatttcgc aagacaaaga ttttaggacg    123000
     ccttattcct cttattgaag atgtattggc tgctggtgga actgaggcac catccgtaca    123060
     gcctgaagca atgccggttg ctttcgcaga tccgaaaggt tcgggtgatg ttggtcatcg    123120
     tggttgaaaa tgctccgcca cgtttgcgtg ggcggttagc tgtatggctt ctggaagtgc    123180
     gggctggggt ttacattggc agttatggcc ggcgtgtgcg tgaaatgata tgggggcagg    123240
     tttgcgccta tattgaaaat ggcaatgctg tgattgcatg ggcggccccc aatgatgctg    123300
     ggtttgaatt tgatacctgc ggtaagaatc gtcgcgtgcc tgtagatctt gatggcttgc    123360
     gtcttgttgc ttttgggcct gaagccgctc ttcctataca tcctggacca acaacgacaa    123420
     tgcttccaag gcgacgtgga aaagggtaat ataccaactc cattcagttg gtggtttctt    123480
     tgacaataga ataattcttt aaaatcaact atcttcacga agagtgttcc ccgcacacgc    123540
     ggggatgaac cgcggtcgat attaaggcgg aagaggggga ggccgtgttc cccgcacacg    123600
     cggggatgaa ccgccgaggc agatagagct gtggaatgtg tcatggtgtt ccccgcacac    123660
     gcggggatga accgcacgct ctccgtgcct caaatccatt gtgagagtgt tccccgcaca    123720
     cgcggggatg aaccgatagc ggcacctgcg ccaaacccca ttttcaggtg ttccccgcac    123780
     acgcggggat gaaccgttca gcgtttggcc atcagcaaaa actaccgtgt gttccccgca    123840
     cacgcgggga tgaaccgcgg ggcggctgtt ggtaatgcag acaatccgtg tgttccccgc    123900
     acacgcgggg atgaaccgtc gcccacggcc tgccaagact tgctcacttc gtgttccccg    123960
     cacacgcggg gatgaaccgg cggtggatag gccttccata tctggcaggt agtgttcccc    124020
     gcacacgcgg ggatgaaccg cccgcgtagc atgtttgcgc gtgcaccgcc tggtgttccc    124080
     cgcacacgcg gggatgaacc gtcgggcgtc tggccggtcg ctgaggctct caagtgttcc    124140
     ccgcacacgc ggggatgaac cgccgcctga ccgtctgacc tcctgaccgc ctgagtgttc    124200
     cccgcacacg cggggatgaa ccggcgtatc ggtcacaaat gcagaaccgg ctggcgtgtt    124260
     ccccgcacac gcggggatga accgacgcgc gcggcgggta gtgtaaagaa cagcgcgtgt    124320
     tccccgcaca cgcggggatg aaccgccccg accgttggca atattaccat cacgcctgtg    124380
     ttccccgcac acgcggggat gaaccgatat ttggacagtt cgccccggct ggtaatgtgt    124440
     gttccccgca cacgcgggga tgaaccgtcg cagcggaaat cattgttggc aataatgccg    124500
     tgttccccgc acacgcgggg atgaaccacg tggcccatgc attcttctct ggtgacgaac    124560
     gtgttccccg cacacgcggg gatgaaccgt aacaacaacc tagccgccgt ggtaaatacc    124620
     agtgttcccc gcacacgcgg ggatgaaccg cagcacaaag ccagagacca gaaggtttat    124680
     gcgtgttccc cgcacacgcg gggatgaacc gatcttgggt ttgttgactt ccggcatcgt    124740
     gatgtgttcc ccgcacacgc ggggatgaac cgaacagccc cgcataccgg cgcatattga    124800
     cgcagtgttc cccgcacacg cggggatgaa ccgaattgcc gggtctggcc gctacctgca    124860
     aactggtgtt ccccgcacac gcggggatga accggctaaa aatgggtgat tccaaaacca    124920
     aaactagtgt tccccgcaca cgcggggatg aaccgacgcc taacatgtct aggtgtttgg    124980
     tcccggggtt tgatgggttg gattgatgat gaatctttct ggctctgaag tccatatttt    125040
     gcagaggtat tcgtaaggcg tgaggccact cagcgtcttg agccttcgcc cgaaattata    125100
     agctgccatg aagtcgttga ggtgtgtcct caactgctca tgactgtcgt aatggaagcg    125160
     tttgacggtt gcctctttga ttgtccggtt catccgttca acctgaccat tggtccaggg    125220
     atgattgggt ttcgtcagac gatgttcgat cccgtgggct tcgcagatca tgtcgaagcg    125280
     catgggacgc gaccaggccg tattgcgatt acggggttgg tcagcgaact ggatcccatt    125340
     gtcggtcagg atggtgtgga tccggtaagg gatgatgctc aggagatgtt cgaggaattc    125400
     ccaggccgtc ttccgatcag ctttctcgac cagttgtgtg acagcgaatt tgcttgtccg    125460
     gtcaatggca acgaagaggt acagcttgcc ttcagcggtc tggacttccg ctatgtcgag    125520
     atgaaagaac ccgatcgggt agcgtttgaa gcgctggcgt ttggctttgt ccctctctat    125580
     gtccggcagt cgtgaaatcc cgtgacgctg aaggcagcga tgcagggccg agcgtgtcag    125640
     atagggaatg ctggcctgca gggcataaag gcagtcatcc agcggcagca acgtatgccg    125700
     gcgaaaggcc acgatcatcg cttcgtccgt ctcggacagg accgttgagc gcggctcttt    125760
     aggacctgtc ttctgatctt cgacactctg tcgcttccgc catttagcca ctgtcttcgg    125820
     gttgatcccg aactcctcgc tcagcgccgc gagcgaagcc tgcgatcgct gtattgctgc    125880
     tcgcacggcg tgcgtggtcg tggcgctccc atgacgtatc tgtcccataa tgcttccttc    125940
     cactctcgtg aaaatatcac accatcaaac cccgggacta aacacctaag ctacggcttt    126000
     caattcatag tccacatgga acccatcgta aggaaatacg actttatcgc cgatcttttc    126060
     aagcagacct gctgccaaca agacttgaat atcaccgtga gtagctttca cgtcccgtcc    126120
     aatgagctta ctcagacctc ttatcgacat gggctttcgg cctgacatca cctgcaacaa    126180
     ctcctgacga cgtggtgtca gcgttctcca catgagatca agcgttatga atgtatgacg    126240
     gggctcctgt tttttacctt caaacgctgc agccagtcgt ttgcccacct catccaaacc    126300
     atcgaaacca atcagaagaa tttctttctt cttctggcta cgcagaacgt ctttcatttc    126360
     aaccattctc tcacatcctc caaaaaatca tcttttaagg tctgcaaatc ttgaaatgtg    126420
     taagaaactt ctacggctcc tatgtgctta tggtctcctt ttcctgactc attgtcatat    126480
     cgcagaacgc atttgccatc cgatatcaga gccagacgat acttgtagtg gtgcaaactg    126540
     cctctcaagg gagaaggaac ctcccagacc accaattcga taaacacccg ttctgaaagg    126600
     gtgattttct ctttcataat ggaacgggct ttcgtcatgg agacgattat aatttagcat    126660
     gttgtcgttg tccacaacaa caacgattcc ttggcgcgac ggcaccactg atagaacacc    126720
     aattgttgag tatatttacc ctataccata cttaacttca aactccgtct tttatccgaa    126780
     acaggccccc ttccccatac ctacgtgcga taattccact tatcgcaact aggtagagga    126840
     ccataaaaaa aggccctgtg aagggccttt agtgcgtgcc ctcgggcgca tatccgaaga    126900
     cagaggcgta tccgagagat acgaaacaag atatacgcgt cagcgtcatg acggtcaaga    126960
     atttcccgct ctcggaaccc gttctccagg cgctgcagac aagcttgtcg ccggagcggt    127020
     tttcaaccta tctccgggcc tctggcggcc atcaggaaaa ggccctgcgt ctctacacgc    127080
     gcaatacagc ccttagtgcg gccttctacg ggccgctgca aggcctggag attgccgtgc    127140
     gcaacgccct gcaccgggaa ctaaccgccc gatttggacc tgcgtggtat gacaatcgac    127200
     tgacgggcct caatcccaaa gcccaggatc agattctgcg tgccaaacgc gacgttcagc    127260
     gtgagcaccg gcaggcggat ccaccccatg ttgtggcctc gctcagcttt ggcttctggg    127320
     tcgcactgct tggcaaaggc ggcaacagca actacgagat gatcctgtgg cgccccgcac    127380
     tggccaaagc gtttccgcac gcccgcctcg gtcgaaagca ggcgcattga attgccccgg    127440
     gttttgtgga gacgtttttt atctgattta agcggctaat gcatgtgatt tctgttgtgc    127500
     ataaaagcgt gcctcagctt ctgctggcgg gatgtttcca atggaggaca ggagccgccg    127560
     attattgaac cagtcgaccc atttaagtgt tgccagttca acagcttccc tgtttttcca    127620
     tggcccctgc cgatagatga gttcggtttt gtaaagtccg ttaatggtct ctgccaaggc    127680
     gttatcatag gaatccccaa cactgccgac agaagcaacg agccccgctt cagccagtct    127740
     ttgcgtgtag cgaatggaca catattgaca gccgcggtcg gaatggtggg tcacttttcc    127800
     ctcaggctgc ctctggcaca gagcctgctc aagggcatcc agtacgaagt cggtatgagc    127860
     cgttgaggag acacgccaac ccacaataac ccgtgcaaag acgtcaatga tgaaggccac    127920
     ataaacaaag ccctgccatg tggaaacgta agtaaaatcc gaaacccaga gtctgttggg    127980
     ggcaggagca tgaaactggc gctgcaccag atcctgcgga cacggacgtt gcggatcagg    128040
     ccgtgtggtt ctgaccccct tgccacgaat gacgcctttc agccccatcc ggcgcatcag    128100
     ccgctctacc gtgcagcggg cgacatccag accttcacgt ctgagctgat gccagacctt    128160
     gcgcgctcca tagacgcaga aattattatt ccacactcta cggatgtcat cgcacagttc    128220
     tttgtctttc tggctgcgca cacacggatt tttctgtctg gcaacagttg cataataggc    128280
     agatggtgca atcgacagaa ccctgcagat tgacccgaca ccatatgtct gccggtgctc    128340
     ctcaatgaag cgtgtcatgg cttgaagatg cggtcgagct ccgcctgggc aaaatatgcc    128400
     gacgccttac gcaggatttc attggcctgc cgcaattcgc ggttctctcg ctccagttgc    128460
     ctgatcttct ctcgatcagg caggtcactc accgcaggcg cattggcacg ttcatgcaga    128520
     cgggtccatt ttgacagcgt gtcaggatga atatccagct ttggcgctat catcatcact    128580
     gcagaccacc gcgaaggatg gttcttctct tcctccagaa ccatgcgggc tgcacggtca    128640
     cgaaactcag gcggaaaacg cttcgattta ttgctcatga attcttctta cctcacgggt    128700
     ctttctgtct ccacaaaacc cggggcaatt cacatcagca actggattat ctacggacgt    128760
     ttcgcaaccg catagcccac cacgagccga tatttacccg ccacctcgcg gccgatcacg    128820
     aagccattct tcgggtgact ggatggatct gccccctcac ccgcgactgg atcgcctctc    128880
     acagccgcgt gccaactctc ctggcacaac cggcctcagc cgacctgtta ttttgagtgt    128940
     tccaagctta acgcaatgac cgcaaggggc aggagcagac aggcggcaat cgcctcatgt    129000
     cagacataga aaagagccaa acaatgctcc gaaagcggac gttatctcta gaattaaaat    129060
     gctgagatct ccgagttaac tcgttatttt attattgcca cgaacgagcc aatagacgat    129120
     ccccaaggcc aggattgcca ccgagagtgc cagaacctcc atgacgtcga ggccgctgag    129180
     atccaggaca ataaatttgc gaacggtcgc catcataccg atgagaagga cggaccgcat    129240
     tctgaccatg ctgtgcgagg gtgtgtcggg cgagacaaga atagagtgtt tgaattccag    129300
     tgcaatcagg actgtaaaaa acagaccaaa aaggctctgt agaaccacag gattggtcgg    129360
     ggaaagggtt gctgttcgga gcatttcaaa aacggcgtat agcacatgta tgagaccaag    129420
     ggccgcgacg accatgatgc agagcgtaag aaccagcata gcgatctctt caaaaagatc    129480
     gaaaatagaa gaaatcttct caaatcctgg tatgttttta atcatagcct ttgccgtcct    129540
     ttttagccta tgtctgcgta gttagaaacc taataccgca tcagctggag acccgcaaaa    129600
     attggtagcg tttggacggc tatggtgatt cattgaagtt acgcgatcac ggaggcctgc    129660
     catggatccc aagtccctgt tcagtttgag cgatcacctt gatgccttga gcaaagaggg    129720
     cgatccgctt gaggttttgc aggagacggt ggatttcgag tatttccggg cgtggctggt    129780
     cgaagggctt ggctatggcg atgggagcaa aggcggccgc ccaccctttg atccggtaat    129840
     gatgttcaac gcggatttct cacacttgag gcaatttcgg gtcatttcgt agaattcagt    129900
     catcccacag gagcccgatc tggaatattg acgatattgt gcttctggcg gcgggttctg    129960
     aacgcagtga gggtgtcacg gcctgagaag gcagtgttgg tggaagctat gtggtctgtg    130020
     cactgtctgt ttcttcagat ggcctgccgg agccttcgca atcgtgcatg agcgagggcg    130080
     aattcatgct gacaggggaa catgtccggc atggacagga caatccgacg gacgctgagc    130140
     gttacacgtg tcgcgatttt gagcagtcgt gcgcgtatgg tgccacaggt cgccgtctcc    130200
     aggctggtct ggccaagggc cagtctttgc agagcggtca gcaggacata ggctgcggcc    130260
     gagaaccaca gccggagctg gttggcccgg atggtgtggg acgaggtcct gtctgagaac    130320
     agatccatct ggcattcctt gatgcggttt tccatatccc cgcgtgcgca gtaaatctgt    130380
     tcgtagagat ggcgggggtc ggacattccc tgcggtaggg tggtgacaat gaagcgatga    130440
     tagcggttgc cgtggcgcca ttcggccttg gccacgaccc gcctgcggcg cgtccagctg    130500
     tcctttgtga tccagtcaaa ggaggcgaaa ccgcgcgcag ctctgcctgt cgtggcggct    130560
     tcgtcacgaa cctcagcgga caaagaggca atccggtcat acaggcgggt gttgcctgca    130620
     agcccgaaca ggaagtcaac gtggttgtct tcgcaccatg tcatcagact gtcccgggcg    130680
     aaaccgctgt ccccacgcac caggatacgc acccggggcc aacggctcct gatctgctcc    130740
     acgatccggc ggatgtctgc cagtgcttcc ttccccgggt ccctgtctgc cgtgcgcagg    130800
     gtagcgctga ggagatggtc cccgcagaag acatacaggg gaagatagca gttatggccg    130860
     taatatccat gaaaggcgcg gccttcctga tggccatgga tacggtcatc ggtggcatcc    130920
     acatccagaa cgatccgggc gggtgcgtgc tcatgctggt caaggaagag cgtgacgaac    130980
     agggtagcca gggcctcatg atcagcaatg atccgacagt aacgatctgc cttgtgccca    131040
     ctgcgctcca accggttcag tgtagatttg ccagccaatg ctgcgcagtt tgcccggcct    131100
     cctgacagac gacccgaggc cagaccaaag atcaggtcat gccgcagggc atcgtgatca    131160
     ttgagatctt catagcccag tgccaggccc atgatccgct gacggacaag gtcttcaacc    131220
     cggtattcca caaagccggg atgccgctta tcgcgaaaac aggcagcaaa gcggcggctg    131280
     agacccagaa tgtcatcagc ctgcttcacc agaattacgc ccccatccga actcatgcga    131340
     cccccgtcaa aacgggccac aacacgccgt ccacaggagg ctggaaactc atacgcgcct    131400
     gcgctacact ctgtctgcat cgggttttct tgatgattat ggaaatttct tttctacaaa    131460
     acagactttt tcataatcta acccgatgta caacccttct gtgagatttc cgcgtccatc    131520
     cctccttggg aagattgcca tatttgcctg tctcaccata tttctactgc gttgggggcg    131580
     tgccgggttt gcgctggcgc aacctttctg ccagtcgcat cagatagact gtactcaaca    131640
     tcaggctgtt aaggaggccc atattatgag caggctgcca ctaaacgagg acgggctggc    131700
     aacacttgta gacgcctttt acacacgtgt gcgcgcggac cccaagcttg gccccatttt    131760
     tgaagatgcc gtgaccaact ggcctgagca cctgcaaacg ctcacggctt tctggtcttc    131820
     cgtcatgctg ggtaccgggc gttacaaagg ccagccagtg cccgtgcata tgcagcaccg    131880
     tgaccggatt acgccagaac tgtttgatcg gtggctggca ctatggggtg agaccacctc    131940
     cacacacatg ccagcagatg tagccgctgt tctacaggac aaggcagcca acattgccag    132000
     aagcttgcag cttgcactct ctttttacgc caaacgggcc atgctccagc gcaacacagc    132060
     accttgaggc gctgttcccc gaaaagtgat acctatgacc gaagccctgc cctatcgctc    132120
     cacgcccgta ttcgatcagg acacgctacc tgctgctttg cgcacgcgcc ataataccaa    132180
     ggcgggtgtg tggggcgtga tccgtgtgct tgagggggag ttgaagctca cttatctggc    132240
     ccctccatct gaacttctgc tgacacccgc cacccccggc ctgatcgaac cgcagcagcc    132300
     tcattttgta acacccatgg gcaaggtggc gatgagggtg gatttttacg atcagccccc    132360
     tcccccttcc gcgttctctg ccccccagtc ctgaacaggt ggagggatcg aagaactctt    132420
     gattgatgtg cttggctcgt gatttcaggc ttttggcgat ttgattgacg gtttttgcga    132480
     tggcgtccag tctgcgtttt gagcagattg ggagttgtct ctcgctggat ggctatgcgc    132540
     tcgcgttcaa tctttcgagg aagaggaggc ggcgcatatt gtagacgata ttggcgagcc    132600
     cgatcctcat ggtggctcga ctgataccga cagtccggac aaacagcccc gtctgtgact    132660
     tctgatcggc aaagacatgc tcgacacgcg agcggatgac cgactttcca gcatttgatt    132720
     tctggatatg ccggggcata ggcttgagat gcggcttttt gcgatgaacc ttggagacaa    132780
     agccctgctt ttccatgaag tcttcgttgg cttttgagcg ataggccgtg tcggcccaga    132840
     cacttgaggc cgtattggtt ttatccagaa gcccctctct caatcgcgcg ccatcactgg    132900
     cagcggcatg cgttgttttc catttgcgga tgaaccggta tttccgatcg atggaaacat    132960
     gcgatttata gccaaagaac gggatggcga gatcgctgga tggcatggtt ccatcatcct    133020
     gccgcttcgc cttcgtgaac ttcagtgtcc agcgcgcatg acgatccttg tgcgacagct    133080
     ttgcgggttt gtcctgccag tcttcaggaa tacggcctgc tcgcagatcc gctttctctg    133140
     cattggtgtt ccgctgcttc ggagccgcta ccagcgtggc atccaggatc tggcctgaca    133200
     tcggcaaata cccggcgtta cgcagggtcg catcaaagcg gttgaacagc ccatcgatcg    133260
     cacccgcctg ggtcagacgc ttttgacaca gccagaccgt tttggcatcc ggcacccgat    133320
     ctgaaagtcc cagcccaagg aaacgcataa aggagaggcg atcgttggta atccccccat    133380
     ttttagtggg gcattgaatg agaattcagg cagctgtttt tagtttctgg gcgggggtta    133440
     gcccgctgtt ccccatgttg ggtctgtcat ggttatatgt ccagagccat tgtgttgcga    133500
     cctcctgcac gtcctgaatg ctttcaaaca aatactgctc cagccattcc tgccggacag    133560
     ttctgttgta gcgttcaata gaggcgttct gctgcgaatt acccggttgc gtatagatca    133620
     gggtaatccc ctgtttttcg gcccatggaa ccaacgtatg actgacatat tcagggccat    133680
     tatccattcg gatggcttct ggcctgccac gccactccat aacctgttcc agacagcgga    133740
     caacccgaca ggctggcagg gaaaaatcac cctcgatcgc cagtccttca cgattgaagt    133800
     catccagaat gttcaggagc cgaaaagcac gtccatccat cagcctgtcc gccataaaat    133860
     ccatggacca gaccctgttg ggaagggccg gaaccgacag cttttcaggc ttttcgcgaa    133920
     ccagacgcct gcggggttta atccgcaggt tgagttcctg ttcccgatag atccgataaa    133980
     cccgcttatg attccagagc tgtccctgca cattgcgcag atacaggaaa cacagaccaa    134040
     atccccatct cctgtgagcc tgggtcagtc ccacaagaag atcggcaatc ctgtcgttct    134100
     ccgctgccag tcgcggacga tagcgaaagc aggtctcgga tatcccaaaa atccgacagg    134160
     ccagcgcaat gctgacccca tgatgcgcca cagcctgtgc ggccagttcc cggcgctggg    134220
     ctggccgctt catttttttc caagggcttc cttcaggata tccgtctgca tgctcaaatc    134280
     cgcatacatg cgcttcagcc gacggttctc ctcttccaaa gccttcatct gactgatcat    134340
     cgaagcatcc atgccgccat atttcgcgcg ccaccggtaa aacgtggcgt tgctgatccc    134400
     atgctcccgg cacaggtcag gaaccgggac accgccctca gcctggcgga tcacacccat    134460
     gatctgggcg tcactaaagc gatcactctt catcagaatc tcctcaattc ttacgctgag    134520
     aaaattctca ttcaaaaatc actcttttta tggggggatt accctacttc gtcgaaccaa    134580
     acctttctgg tcgcgcggca acccggcctg agacctatcg gtccttcggt ctccggtttc    134640
     ccatgaaaaa gcgaagcgac acaaaagagc aatttaaacg cagggtttcc ggccagcagg    134700
     agaaagacac ccccggtgta caacaggaag gcgcttactg gctgcttggt tcgaatgcaa    134760
     cgcaagccgg gtctcttcat tgcgacctct ggcgcgggcg ggcgattgac ctcgccttgc    134820
     atgatgctat tggggtctat cctgttaccg gctggtggaa aactcatccc ggtcagaaga    134880
     ggttcaatga caaggggcgt tatgctttgg ttgtttcaat ttccgcacct ggacataatg    134940
     tcgatatgca tgctgagatt agtgccatcg ttgccgccaa gatagcctcg atggtcactt    135000
     cgtaaccatt ggcttgagaa gtatggtgga ttgcttctga agtttctttg cgcattgtcc    135060
     tttaagtgcc gagtattttg ccgtctgtga acgcctcttt tctgccgttt ccgcaaccga    135120
     tcaggtttct cgaatgcaga catcagcatc gaccatcttt cgcttcattt gtaccaacag    135180
     ctgtgataca tatgtgcata cacgcaagga ggctttgtat gtctgctgtt acattccggg    135240
     tagatgaaac gctgaaggca gccgcagtta agaagttgtc ggctcaaggc atttcacttt    135300
     ctgacgcact gcgcgatacg ctcgcgtata ttgctgaaac gggtcgctct cccgtcaagc    135360
     ggaggcttgt cacagacgag gatgcggagc ttatcgagat tgtgcgcgaa cgcctaaaaa    135420
     accctgccca aaagcatcgt atgacttttg cagagcttaa gaaccgtcat cgcgaatgaa    135480
     agagtattgt cttgaattcg acgacagagc actcagagag tgggatgctc ttgacggcag    135540
     cgtgcgtaag aaatttgaaa agaagctgga aaagctgatc tggaaccctc actctccagg    135600
     aaacgaactg catcgcgacc tatcagggtt ttataagatc aagcttctga aagatggtta    135660
     ccgccttgtt tatcaggtca tcgacgaacg gatcgtcatc tatgtaattg ccgttggccg    135720
     gagagccgat aatgagattt atgaactggc ttcgaagcga acagagtgaa tttactttct    135780
     tggtagaaag tcagctcccg ccctcatgtc ggatataact gcggctcggg tagctttccg    135840
     caaaccggac ttgaatagta tagttcgctc ttaccacttg ggacagcaag cagtctatca    135900
     gctttcgatt ttgctcccgc acttcgtaat tgcctaaagt aatcgtcagg ctataccgca    135960
     atgtccgcga tcagttccaa agcaatagtg tgttccaacc ttcgggaaat ccagattgct    136020
     cagctacaaa tggtgacttc gtcggaaacg tcaggaaatg agctttgaga aggtttgacc    136080
     actcggtcgc gaacgctgga tcaatcgtgc gaagcaggta ttgcatcact gcagctactg    136140
     cgtagagctt agtctgtgcg aaactgtcag tagccagatg atccaatatt ggatcttcac    136200
     ccagtttcgg tggcatgggc tggtccgctg gtgaacgatt ccaaagcctc gaatagtgtg    136260
     cacagatatt gcgaatatga tttatcgctc gtaaccaact ggggatcaca agctgacgcg    136320
     acattcccag ctgcgtgccg agcgcatata ggtcagaaat tgtcatcccg ctgactaacc    136380
     gagacatcat gccgaaatcc cagacttcga tactgaccca tagtggaaaa ggtagtccat    136440
     atttgctacg catatggaca gcgaattgct cctttgaacg agcttcatgc tcatcgaccc    136500
     gattgaccca cgttgtgtag ggcggcacgc ctgtcgtcgg gtctggtgtt gatgaaaact    136560
     ttggatagag gttctttgga tcgcggtggg ccatagcgcc gtgctgaccc agtaaaagag    136620
     cgacgcgcac tcgtagaccg atctcgatac gttcgacagc acgcaggaaa agcgctcgca    136680
     agtcttcatc gaatttcgca agcttaatgg cttgcgttaa cgtgctgccc tgttggaaat    136740
     cgtcctcata gacggtaccg tcaggcacga tcttccattt acgcatcgga tgccaatagc    136800
     cgctcagcct atagtatccg aactgtgtga ggagagtctc tgcatgcgtg accgtgccta    136860
     catccatgcc acgagcttgt agcaataaga cttgatcatg aacggatagg aagggtttat    136920
     tgtaagacat gcaaaaggtt aatgtcacga acataaaaaa aaccgacccg ctcacaccga    136980
     ttaaggtgcc ggggccggcc gtgttgagac tttgataatc aacgattgcc tgcaagtcaa    137040
     tgattttatc actaaggtca cacggtcgct ttctagcgga tcatagtggc ctaatcgccg    137100
     gaacctacgc caattttaat atcgtacggc aagtgattag gagattttgg tcgctcgggc    137160
     gaactttcga gcgactaatt tgatacgata gctactctgt aaataacgat atcaatgact    137220
     gcttgtgaag cttctccatc tataagccga cattccgtta cccccccaaa ccagcccgta    137280
     gcgctccagc agatcgtcaa tctccgttcc gtgcgtcaga tgccggatca gccccgacgc    137340
     cggtaccttc tctccgtccc gcagttccgc tgccgcctgt agcagcatcc ggacatcgaa    137400
     aatgccgccc gacacttccg gcacagcccg cctgacgcca cacagcgtat agaccgcctc    137460
     catcgccgtg cggacggaat attccgtggt gaagaccgta tcgcgtggcg tttcggtgaa    137520
     ctgccccaga aaggccaggt tgacgcttcc atccggcacc acgttcggcc ggtccgccgg    137580
     tgcgcgcggc atgaactgcg ccgtgatgaa cggcatcatg cacggacgcg tcgtcgcccc    137640
     tgtcgctgcc atatcgtcga tctggtccat cggcacgccc atatggaaca gccactcacg    137700
     ggtgatttcc tcccccgtgc agtcctgcat gggctttttc acgtaatcac ccggcacgtc    137760
     actgaacaga ccatagagcc aggccaccac ctgactttcg ggctgccctt tgaaatgggg    137820
     ctgacggctg accacccagc tcatcagcca ggatgaatcg gcaatcgtga ccgggccacc    137880
     cgtgatgatt ttcccagaaa acggatcacg ccccgtaatc cgctttacaa gctcaggaat    137940
     ccgcgcatcc cgggtcgtaa cggttgccga cagccagcgg gattttgttg tatcgccaca    138000
     gaaaacatcc gggttgccga atgcggaatc ctgcgctgcg atattccgcc agagctgcca    138060
     gatgctcccc tcttcgatag ccgtgtcaat cggcgcaggt gtatgatggt cgccccagcg    138120
     cgaattctcc accatggaac cgttggtcac gaacaccagt tcctctggcc caagatcaac    138180
     accggcggac gcgccattgt ccagccagtc gagatgggtc gcaactttct ttccgccaga    138240
     aacatcaaca gcaacatttg tcaccttcac gccatgacgg aacacgacgc cctgatcggc    138300
     aagccatgtg gccagtggtt ggctcaggga ttcctgttgg ttgtatctgg tgaacttcag    138360
     cgtatgcaga tccttcagtc cgagaatctg atgcacgaac cgtgcgaggt aacgcttcat    138420
     ctcaatagcg ctgtgccagg tctcgaacgc aaacatcgac cgccagaaca gccagaagtt    138480
     cgaagccatg aaatcgccgg acagcacatc cgcgatcgtc tttcccgcca gttcgtcctc    138540
     atcggtcaga atgagggtaa tgatctcgcg tcgcgccttt cccgtgagcg tcagcctgtc    138600
     acgatcagcg aggggctgcc cttgattaca catggcgcgg atcggactgg tggatggatc    138660
     ggcctgattg acctgccaga cctcatccag caccgatgcg ccgggaattt ccagagacgg    138720
     aatggaacgg tacagatccc acagacactg gaactgctct tccatctccc gaccgccgcg    138780
     gatcagccag ccggtctccg cattccccgc tccgtccagc gcgccgccgt cgctgtccga    138840
     ggcttcaaga atggtgatgg ctgaaggcgt catgcctgca tcccggatca ggaacgccgc    138900
     cgccgccatg cccgccagtc ctccgcccac gatccacgct gaccatcctg ccatatcctg    138960
     tggcgcaggg ggttggacaa aagcctcata attgctgtgg gcatatctca tggcgcgtgt    139020
     ccttttccgg aaaagggccg atggcgggcg gcattgctat tcatacgacc cccaatgacc    139080
     cgatctgtcc ttgcgatgta tcaagtgctg taaacaggaa tacctctccc cgcaagaggg    139140
     gaccggtgcc ggtttatgct ccaccacagg ctcatgcgac agcgcgcccg gcagggaaag    139200
     gcaggccaga agccccgcca gaaccagaag aaacagaccg gaccaccagc catacagaaa    139260
     ggcgccggcc acgccgccca gcgtgaagga cagcacgatg gcggcatgca gacccaggcg    139320
     ttcgcgcgta ccggtccgtc gggccgggtc aaccggatgg aaaaaccctt ccagccagtc    139380
     cgccagttcc agccccacat cggtgagcat tcctgtcata tgggtggtgc ggacacgcgc    139440
     cccggaaatg cgtgtgaccg tggcgttctg gagccccatg aggaaactca gcccgtaggc    139500
     cagcaccgga tcccgtggct gggccgaaaa cagaaaatcc acagccccca gaagcccaag    139560
     caggcaggct tccagcagaa tgctccgtgc gtagatcgac ggcaggttgt ggcgacggcc    139620
     cgcattgacc agcagcgcgg acagggcgtg cgtcgtcttg atctgctgct acatagggtg    139680
     gacagccgca tcgaggcgat ccgcgtggcg accgccatgc cggtgcggga cgtcaaacgc    139740
     ctgacccggt tgctgtgcga gaagatcgag accatcgatc cggggttcgg cattgagcgc    139800
     atggtgctga tcgcctcact ggccgaaccg atggaccagc ggcagaccgt atcctccctg    139860
     atcgccgagg aagaggtgga gggatcgaag aaccgtttgt cgcgtttccc tagatgatga    139920
     caaagatcac attgacgctg cttcgggccg ttttttgaag cctaattgac tgcaaaatgt    139980
     tccctcattc ctgacaaaaa ataccctggt tgattgcact tgaatctgta cgaacgaccg    140040
     ttggcacgcg caggtggctt ggccaccttt gcaaacgatc gtttacgaat gtcttcttga    140100
     attgtaaaaa tggactcaga aggagctgga gggttcgaaa aacctttgac tgagtgctct    140160
     tgtgcgtgat ttcaggttcc ttatcctgat ttttgctctg cgatttgagc agaccgggga    140220
     gtatcgccac cggggtgact acgtgcccgc attcaacctc tcgaggaaga ggaagcggcg    140280
     catgttgtag acaatattgg ccaggccgat cctcattgtg gcccgggtga tacccactgt    140340
     tcggacgaac agccctgtct gcgatttctg atcggcaaag acatgctcga cacgcgaccg    140400
     gataacggat tttcctgcat tcgatttctg gatatgtcgt ggcataggct tgaaatgcgg    140460
     ctttttcctg tgaatcttcg agacaaagcc ctccttttcc atgaagtcct cattggcttt    140520
     cgagcgatac gcggtgtcgg cccagaccgt tgaggccgta ttggttttat ccagcaggcc    140580
     ctcgcgcagt ctggcaccat cactggcagc ggcatccgtc gtcttccatt tccggatcag    140640
     tcgaaacttt cgatcgatag aaacatgtga tttgtaacca aagaacggaa tggcgaggtc    140700
     cgtggccggg agcgtcccgt cctcctgccg ctttgccttc gtgaacttca gcgtccagcg    140760
     ggcgtgcctg tccttgtggg acagctttgc cggcttgtcc tgccagtcct gtgggatccg    140820
     cccttcacga agatcctctt tctccccgtt ggtattgcgc tgctttggcg ctgccaccag    140880
     cgtggcatcc aggatctggc cggacatcgg cagataccca gcgttacgca gggtggcgtc    140940
     aaagcgctcg acgcggattt ctcacacttg aggcaatttc gggtcatttt gtagaattca    141000
     gtcatcccac aggagcccga tctggaatat tgacgatatt ctgcttctgg cggcgggttc    141060
     tgaacgcagt gagggtgtca cggcctgaga aggcagtgtt ggtggaagct atgtggtctg    141120
     tgcactgtct gtttcttcag atggcctgcc ggagccttcg caatcgtgca tgagcgaggg    141180
     cgaattcatg ctgacagggg aacatgtccg gcatggacag gacaatccga cggacgctga    141240
     gcgttacacg tgtcgcgatt ttgagcagcc gtgcgcgtat ggtgccacag gtcgccgtct    141300
     ccaggctggt ctggccaagg gccagtcttt gcagagcggt cagcaggaca taggctgcgg    141360
     ccgagaacca cagccggagc tggttggccc ggatggtgtg ggacgaggtc ctgtctgaga    141420
     acagatccat ctggcattcc ttgatgcggt tttccatatc cccgcgtgcg cagtaaatct    141480
     gttcgtagag atggcggggg tcggacattc cctgcggtag ggtggtgaca atgaagcgat    141540
     gatagcggtt gccgtggcgc cattcggcct tggccacgac ccgcctgcgg cgcgtccagc    141600
     tgtcctttgt gatccagtca aaggaggcga aaccgcgcgc agctctgcct gtcgtggcgg    141660
     cttcgtcacg aacctcagcg gacaaagagg caatccggtc atacaggcgg gtgttgcctg    141720
     caagcccgaa caggaagtca acgtggttgt cttcgcacca tgtcatcaga ctgtcccggg    141780
     cgaaaccgct gtccccacgc accaggatac gcacccgggg ccagcggttc ctaatctgct    141840
     ccacgatccg gctgatgtct gccagtgctt cgttccccgg gtcccggtct gccgtgcgca    141900
     gggtggcgct caggagatga tccccgcaaa agatgtatag cggcagatag cagttatggc    141960
     cgtaataccc atgaaaggcg cggccttcct gatggccatg gatacggtca tcggtggcat    142020
     ccacatccag aacgatccgg gcgggtgcgt gctcatgctg gtcaaggaag agcgtgacga    142080
     acagggtagc cagggcctca tgatcagcaa tgatccgaca gtaacgatct gccttgtgcc    142140
     cactgcgctc caaccggttc agtgtagatt tgccagccaa tgctgcgcag tttgctcggc    142200
     ctcctgacag acggcccgag gccagaccaa agatcaggtc atgccgcagg gcatcgtgat    142260
     cattgagatc ttcatagccc agtgccaggc ccatgatccg ctgacggaca aggtcttcaa    142320
     cccggtattc cacaaagccg ggatgccgct tatcgcgaaa acaggcagca aagcggcggc    142380
     tgagacccag aatgtcatca gcctgcttca ccagaattac gcccccatcc gaactcatgc    142440
     gacccccgtc aaaacgggcc acaacacgcc gtccacagga ggctggaaac tcatacgcgc    142500
     ctgcgctaca ctctgtctgc atcgggtttt cttgatgatt atggaaattt cttttctaca    142560
     aaacagactt tttcataatc taacccgatg tacaaccctt ctgtgagatt tccgcgtcga    142620
     acagctgctg gatggcgcct gcctcggtca gacgctcacg aaacaaccag atcgttttgg    142680
     catccggaac gcggtccgaa agccccagac caagaaagcg catgaaagag agacggtcat    142740
     tgatcagata ctccgttcgg tcgtcggaca gattgttcag cgtctggatg actaggattt    142800
     tgaacatcag caccggatca aacggcggac gaccgccttt gctcctgtct gaataggcca    142860
     gagcctgctc cagatcaggg cggaacgcct caaaatccac agtccgggaa aatgcttcaa    142920
     gttggtcacc aagcccactc aaccgagcaa gccgctcttc aacatcaaaa aaaccagact    142980
     gtttcatgag ccatcccccc aatcatcaca caaaagaggg aatcacagag agagacctaa    143040
     aaccagagag tttttcgaac cctccagctt cactacctgc cccctataac catttacaca    143100
     acaaatactt aagtttaatt aaaaatacac ttggaacatt gataaaatac tatcaaaatt    143160
     atgataattt tctttttcgt aatattttgt gtgtgaataa tccaaagaaa ttcgtatgat    143220
     atccaaggga taccaattta tatttacgct ccatatattt tgcttgcccc cagatacatc    143280
     actattttct aaatccattt gagaaaacct tgtcgccagt tctatgactc ccatggcatg    143340
     gcagagggta gagactttct gatcacatga tggagaagca aaacttgcag atgtgggttt    143400
     ccatgctcgc ggctttccaa ccaatgtata tgccgcagta atataccatc cataaaaatt    143460
     ttgacggttt attctagagt ttttattttc attaacaatt aaattatagt attcgctact    143520
     tattaatagt ttcttccatg caacagctcc ctctaaacca aaagcaccag agctctttgc    143580
     tggaatatta cctgtcttta tatatttatc atttaatcca tcgtcgtttt caggtgtatc    143640
     tgaaaatgat acaccttctt ccatagaatt tttatgagac ggtcgaaaaa cccactcacc    143700
     tgatatacct acatgcataa ggaattcttg ggtatgtatc ggtagaatca cagatctaaa    143760
     aacaattgct ctttgattac cgtcttttcc cgggccagct gtcccagccg ttccagaaat    143820
     ggctaaatga tagtaatttc cgtaaaataa cgcttgcact gcctgacgat ttgcaccggc    143880
     ggcaagtcca cgggtaattg ttgcaacgct tgcccgttca ggaaaaatgc tatcacctct    143940
     ggactgcatt gatgacagtc caaaactcgg attgaacact ccgacagaaa attgaaaatg    144000
     tttcaaacca gtatagctgg cagcaccttc gaatagacgc atttgtccac cgggagccgc    144060
     cccaaagtcc caaatggcac cgatcttgac ctgattagct atattaattc ttaccccgtt    144120
     acggatatga gggccactag cagatggaga agagtgctga ttgccatgta tattactacc    144180
     cacctcgagt tgatcttgtg caaaagggtg gataataact ttccctacaa cgatatcttt    144240
     aacagttttg gcaaaagcat cggagtcaga aaaattcgaa acaatcaaaa tacagaaaat    144300
     aaacttttta ttttcccaca taatttttca tatacttcat atcattttct tgtggaaccg    144360
     agtttaccaa tatgtttttt ctgtaagatc aagaaatctt ttagttccgg aacgaacaat    144420
     agataaacca atattaacaa aatctttttg tttccaaggc ttttcttttc ctaaagacaa    144480
     acatacagca taagctgcgc cagctaagta taaatctaat tcttgtacat tacgattttc    144540
     ttcaaaacat aattgtccga tttgttctcc aacatactca ggatcaaatc tgactcgtaa    144600
     tgacatgacg taagaccctt acttgtttcc atatgtgcac attatctaac gtgtttttgt    144660
     tacaaaaagg catcttaaat tacaaatatt ttttatgtta ttataataca tgatttgcgc    144720
     aaatattttt gggcagaatt tttctgacag gagtataccc gcaacatatc tggccatccc    144780
     attctttggt tataaatcgt atcattcaaa agccaatgaa gacttcatag ataaagaggg    144840
     tttcgtctcg acgcggaaat ctcacagaag ggttgtacat cgggttagat tatgaaaaag    144900
     tctgttttgt agaaaagaaa tttccataat catcaagaaa acccgatgca gacagagtgt    144960
     agcgcaggcg cgtatgagtt tccagcctcc tgtggacggc gtgttgtggc ccgttttgac    145020
     gggggtcgca tgagttcgga tgggggcgta attctggtga agcaggctga tgacattctg    145080
     ggtctcagcc gccgctttgc tgcctgtttt cgcgataagc ggcatcccgg ctttgtggaa    145140
     taccgggttg aagaccttgt ccgtcagcgg atcatgggcc tggcactggg ctatgaagat    145200
     ctcaatgatc acgatgccct gcggcatgac ctgatctttg gtctggcctc ggatcgtctg    145260
     tcaggaggcc gggcaaactg cgcagcattg gctggcaaat ctacactgaa ccggttggag    145320
     cgcagtgggc agcaggcaga tcgttactgt cggatcattg ctgatcatga ggccctggct    145380
     accctgttcg tcacgctctt ccttgaccag catgagcacg cacccgcccg gatcgttctg    145440
     gatgtggatg ccaccgatga ccgtatccat ggccatcagg aaggccgcgc ctttcatgga    145500
     tattacggcc ataactgcta tcttcccctg tatgtcttct gcggggacca tctcctcagc    145560
     gctaccctgc gcacggcaga cagggacccg gggaaggaag cactggcaga catccgccgg    145620
     atcgtggagc agatcaggag ccgttggccc cgggtgcgta tcctggtgcg tggggacagc    145680
     ggtttcgccc gggacagtct gatgacatgg tgcgaagaca accacgttga cttcctgttc    145740
     gggcttgcag gcaacacccg cctgtatgac cggattgcct ctttgtccgc tgaggttcgt    145800
     gacgaagccg ccacgacagg cagagctgcg cgcggtttcg cctcctttga ctggatcaca    145860
     aaggacagct ggacgcgccg caggcgggtc gtggccaagg ccgaatggcg ccacggcaac    145920
     cgctatcatc gcttcattgt caccacccta ccgcagggaa tgtccgaccc ccgccatctc    145980
     tacgaacaga tttactgcgc acgcggggat atggaaaacc gcatcaagga atgccagatg    146040
     gatctgttct cagacaggac ctcgtcccac accatccggg ccaaccagct ccggctgtgg    146100
     ttctcggccg cagcctatgt cctgctgacc gctctgcaaa gactggccct tggccagacc    146160
     agcctggaga cggcgacctg tggcaccata cgcgcacgac tgctcaaaat cgcgacacgt    146220
     gtaacgctca gcgtccgtcg gattgtcctg tccatgccgg acatgttccc ctgtcagcat    146280
     gaattcgccc tcgctcatgc acgattgcga aggctccggc aggccatctg aagaaacaga    146340
     cagtgcacag accacatagc ttccaccaac actgccttct caggccgtga caccctcact    146400
     gcgttcagaa cccgccgcca gaagcacaat atcgtcaata ttccagatcg ggctcctgtg    146460
     ggatgactga attctacgaa atgacccgaa attgcctcaa gtgtgagaaa tccgcgtcga    146520
     aggttcccag gaagaagccg cgccccaacc catgactccg tcatattcag cgatccgatg    146580
     caggcaagtc cgtgatctga tcacgcgttg agcatgtctt tgcagatcag aaatcacaga    146640
     ccggactatt catccgaact gtcggtatca tacgggccac catgaggatc gggctgacca    146700
     atatcatcta caatatgcga cgtttcctct ttctggaacg ggtcagtgcc acagcatagc    146760
     agtccagagc aggaagcctt ctccttgctc aaaacgcaga tcagatgcca tcgcagaaat    146820
     catcaatcag tatgccaaaa ctcgaaaaat accagccaac cttaccaaaa taagagttct    146880
     tcgaaccctc catctgattg cacagaccac accggtgcca gcgtcctcat aatatcaggt    146940
     cttaagttga actggaaccg gggaggtgcg taaccgccat aaaggcactt tcactctctg    147000
     cctgtaggct ctctttctgc gcaggcagag aatgtatggt cttaaaacgt ggcggaaagg    147060
     cttatattga aggagcgacc catgcccggc agagcacgag tggtgccaat atagcgtgta    147120
     tcgcccagag agagaccacc cagcggcaga tagtagggct ggttgagcac gttatcaatt    147180
     ccggcatcca gcgttagcat cttccacgtg tagctgccgc caaggttcag cagggcgtag    147240
     cctgcagtgc ggggttcgcc acgtagccag tccaccgtgt ccttgggttt gacaaagttc    147300
     atctccaccc ggcctgtcca gtgtcccacc gtttcatgca ccgccaccgt accgttaagc    147360
     ggcatcatgt ggtacaggcc ggaatgcgtg acctcatcct gcccacgcac ccagttgagc    147420
     acaccggtga cttcaccctt gccatattgc gccgtgtccc acaacgtgta atggccagag    147480
     gcgttaatgc cgtaggtctg agcgttgtga ttggcaaatt gcagcagatg gtgcccgttg    147540
     gagaaggtgc tcaactgcac cacgttgatg taattgcgca cgtagctgta atagggctgc    147600
     accgtcaggc cccatctgtt ggcggcagtg gggtcatgcc agtccagcgt cacgctggcc    147660
     gtgttagcga tttctgactt cagatccacg ttgcccacat agccgttacc atcgccaaac    147720
     cagccgatca tgctggaaga catggtgcca cggccccacg catagcgttc atacaggttg    147780
     ggcgcgcggg atttacgggc gtagccgcct tccagcgtaa agctgtctgt taccttccag    147840
     cgggccatgg cggtgacatc aaagttcaca tccgtccgct cccggttgcg ggcgttgaag    147900
     gcgcgggccg ccatggcatc cgtcatgttc atcatgccgg tccatgaata gggagctacg    147960
     tttcccgtgt tcatcatgat cagatcattg cggaacccca gcagggtgga aacgcggggc    148020
     gtccagtggg cttcccactc ggcgtaatgg cccagccgat cgcggtggcc gttattgatg    148080
     ttgtggtagg tatctggccc catcatcatg ctaccttgca gcgggggcca ccagtcattc    148140
     aaccccacat ggtcaaaccc gctgcccagt ttgagcgtgt ggaaacgccc cagcggtatg    148200
     gtggccttga gcgaataacc cgccagacgg gagtcattgt tcatgggcat gccggtggtg    148260
     gcggaatggc cgcccttgtc cgccagcatg tccatggcgt gggtaatgcg ctgccagtag    148320
     ccacgggctt caaacgtgcc ccagtcaaat gatccggtat atttgccgtt tacaaaggtg    148380
     gagcggttgt tggtcatgtc catatactgg ttggcaaagc cctcacgcgg ggtatcctgc    148440
     tgccccacgg taatggccac cagatggttg tccttgtgca ggcccaccgt tacggcgtga    148500
     ttataggtca ggtaattggt ggagtgcacg gtgcccatgc ccgcgccccc ccgataattg    148560
     ccagactgat cataagaacc cgtatagcgg atgctgagca gatgattggc aaccgtgacg    148620
     gaaccggaag ccccgtaggc cccgccattg ctgcggtagg taccgcgccc ccggcctgtc    148680
     acaagaattt ttcccttgcg ggcaaagcgc gggtctgccc gttccacatc aatggtgccg    148740
     cccagactgt cgcccccgct gctgacaggg gtcaggcccg caatgctggt ggcagtctgc    148800
     acgctgtccg gatcaatgta ggagagggcg ggattcatgt ggttggggca ggcgggagag    148860
     atgcgcacgc catccacaat agtggcgacg cgatcatccg ccatgccgtt cagcacgggc    148920
     agattggcca gccgcccgcc gccgtaggaa ctgaaccccg gctggttacg gaacagcgag    148980
     gacacatccg ggctggaaag ccgggacatg cgctgtgagc tagcatcggg cgaggacgcg    149040
     gtcagcgggg catcggagag ggaggtttct tcttcctcat ccgttgagat atccagccgg    149100
     ggcaaggtga caacggaact gccagaggcc gtgttgcttt gtctggcact accctgtgca    149160
     gccgttgttt gcgcctgcgc ggcggatatg gtgggggccg cgtacaccgc ggcaataacc    149220
     cacgcccacg tcggcacgcg gcgtgggttg ataagtgtaa tcatgagaac aatcctgaaa    149280
     acaaagcgta cagaactctt ttccggttat ggggccggaa aggcgtgaag aggctttggt    149340
     tcaggcagga ggcccacatg aggggggcag accaagcaaa acgctcggcg gtgcgcgtgg    149400
     ggtggaggca tgactgccac gccgcatcca ccgcagaacg ggtggggaca ccagcattac    149460
     ggccatggga agcgccgctg gtagcgagag cagcggacag agtggacacc catccgccct    149520
     atggtgatgg ccggaatgcg actgggtgga tttacccgcc atggccgcag ccatgtggtg    149580
     ggcacgacct accgcacttt ctggtgaggt aaggcccgaa cccttctgcc ttgtgtgaga    149640
     cgatgtagag ccagagaaca ctgcaccagc gggcgttgca tccaaaacgt catcggggac    149700
     ggagagggaa gcggcaatat ccatgcccag aaggcggact atggtggtgc ggggcagttc    149760
     atccggttgc gcaaagctct gaagggcaag caggccgaga aagcccacca gtgtcaccac    149820
     caccagcggc catttcagca gtgtatgcaa agagtgggag gggcgagcca tcagagcagc    149880
     ctgaactcct gtctgtgcgg gccatggtag gatggcccaa aaatggggtg gggctttgct    149940
     ttatttgtct attgggggct ttgtgtcaaa cgtgtgactg ccgcgaaagt aatctttctg    150000
     attgaaggca acggccagag gtataaaact acggaaaaag cccacacaga ccacgcagaa    150060
     aacgggcgga aaacaggcag gcacgcgtgt aaggcggcat gagtagcaag gagtcgcagc    150120
     cgtttgggcg cttgggtgta tctgccttgc gttgtgggta tgggcggttc aggaccaaag    150180
     gacaaaggaa cgcggacggg tgaaaccgca cggcagactg gggcaggatg acggtgcatt    150240
     aacgccagac gtgcgtgcgc cggaaatctg tcctcctctg gcaccgccgg agggggccgt    150300
     gttctctgct cgccagagcc ggaccagccg ggtgtggagt ctggctcttc tggcggcagt    150360
     ggcggggcac ggggtgatta cagcctgcct gctggtgaca ttgcacccca gacatccgcc    150420
     tgaagcaccg gggcagaaag ctgtggagat ggtgtttgaa tctctggcca gcaggcccgc    150480
     cagcaccgcg aaccccgctt ctgtgacccc gccgcaggaa ccgcaatctg ttcccgctcc    150540
     atctcctgag caagcagaac cgctcagtgt gcctcctgcg gctaacctca ctcatgccgc    150600
     gcagccccct gagatgacgc tgccagatga ggcgcttgcc tccccgctgg aagcgccagt    150660
     cacgccagcg gatgcaccac ccgtaccgcc catgaccgat atcttgccgc ctgcgagtgt    150720
     gcccgcgcct gttgccgcgc agaaggccgc ttccgcacat gagcaccggc cttccgctcc    150780
     gtcttctcca atgctccaca aggcggctgt gccacctcca cccaaggcca gtccgacttc    150840
     gcattctcca gagggagcga cacctcctgc ggctcagggc tctgctgctg tgcaatcggc    150900
     ggcggcatcg gtggcgcatg tggccaaagg gagcggggcg cgcacgctta cctgcacccc    150960
     accgcagacg cattatcccc ccatggcccg gcatctgcac gaagaaggag aaggcgtggt    151020
     ggaggtcact ctggcagcag acgggggtat tgccgccacc cgactggtac agagtaccgg    151080
     ctatgatgat ctggatgcac aggcgctggc cgctgcccgt gggttgcact gtgccgcacc    151140
     ggcgtccgcc cccatggtgg ggcggattcc ggtggggttt catattcgtt agcactacag    151200
     ttgcattttg tgttgagttc tgaatctatg ggtaaccatg attcaggata tgatgagtgg    151260
     cggtacgtct gttgaagaga cgctggaatt atgggcgcgc tcgcttcggt ccgccaagga    151320
     tcggatggcg ccgctgttca cgcaaaaacg tgtcgtagat tcggcctgtg cttttcttga    151380
     tgttttgatt ggcaatgaac cacgcaagac gggatggatg cgagcggaag ccgcaggaga    151440
     tcctggtcca tggcggcagc aggcgcttct gggacgcggg cactgggatg ccgatgccct    151500
     tcgtgacgtc gtcagggatt atgtgattga gcatctgggc actgaagagg gcgtgctggt    151560
     cattgatgag accggttttc tgaagaaggg tcaggcgtcc tgcggtgtgg ggcggcagta    151620
     tacgggatct gccggcaaga tcacgaactg ccagattggt gtgtttggcg cttatgtttc    151680
     ggaacggggg catgccttta ttgaccgcgc cctgtatctc ccgaaagact ggacatcaaa    151740
     gcctgagcgt ctgaagcggg cccacgttcc cgatgacgtg gtgtttgcaa ccaaaccggc    151800
     gttagcctcg atgatgattg agcgaagtat tgaggccggt gtgccgttcc gctgggttgc    151860
     agcagacagc gtgtatggcg tgggcgacgt agaacgcacg cttcgccggg caggaattgg    151920
     atatgtgctt ggggtcaagg gcaatcactg gttcggatca tgggcaacgg aaccgctgat    151980
     tgccggagag gcgaaagata ttgcagcagg actgccagac caggcctggc gtcgtctgtc    152040
     agcggggcac ggcacaaaag gtgagcgact ttatgactgg gcgtatcttc cgcttgctga    152100
     tctggatgct gaagaatttg actgccctat agccggacca tggacacgtg gcctgttgat    152160
     ccgccgaaac atcgctgacg gggaccttgc ctattttacg acctggagcc cgaaagggac    152220
     aaccacgcag gaactggtga acgttgaagg gacgcgctgg aggatcgaag aagggttcga    152280
     gacggccaaa aacgaatttg gtcttgatca taacgagacc cgctcctggc atggttggca    152340
     tcggcatgtc tctctggtca tgctggccta tgccgtcatg gccagtgtcc gttaccaggc    152400
     aaactcactg aaaccgaaaa aaacacaact cagaacacga cagtccttgt ccgctggtcc    152460
     attcaggaga tcaggcgcct cgtcgtaaaa cttgcacaac gcagactacc cgtctctcac    152520
     atcctcagat ggtccgtctt tcgacgaacg catcaggcca gtgctatccg cgctcactca    152580
     cgacacaaaa tgcaactgta gtgttagcgt agaaaataaa gtttttttac tgctatgtgc    152640
     cgtgtttgat acattgagcc cccatccctg tgcagtataa tgcccccgat ttcgatcagg    152700
     ggcggcaggc tcatggtgta cacattctca tacgcgcagc ggcatcagta tgcagacgca    152760
     tataacaaga tggagggttc gaaaaaccct ttgtctctga gctgttctgt gtgattccat    152820
     ttcttcggcg ttgattgggg atggtggaag atgaagcagc ctggtttctt tgatgttgaa    152880
     gagcgccttg ctcggctgag cgggcttggc gatcagctgg aggccttttc ccggactgtg    152940
     gattttgagg tgttccgccc tgatctggag ctggctctag cctattcgga cggaagtaaa    153000
     ggcggacgtc cgccgtttga tccggtgctg atgttcaaaa ttctggtcat ccagacgttg    153060
     aacaatttgt ctgatgaacg gacagagtat ctgatcaaca accgcctgtc gttcatgcgc    153120
     tttctgggat tggggctgtc ggaccgcgtg ccggatgcca aaacggtctg gctgtttcgt    153180
     gagcgtttga cacaggcggg tgccattgaa aggctgtttg accgatttga cgcgaccctg    153240
     cggaacgccg gttatctccc gatgtccggc cagatcctgg atgcaacact ggtggctgct    153300
     ccaaagcagc gcaatacgaa cgctgagaaa gcggatctcc gggcaggacg tattccagaa    153360
     gactggcagg acaagcccgc aaagatgtcg cataaggatc gtcatgcacg atggacactt    153420
     aagttcacga aggcgaagcg gcaggacgat ggaaccatac cgtcgagcga tctcgccatc    153480
     ccgttctttg gctacaaatc ccacgtctcc atcgaccgga agtttcggtt catccgaaaa    153540
     tggaagacga cggatgccgc cgccagtgat ggtgcgcgat tgagagaggg gctgttagat    153600
     aaaaccaata cggcctcaag cgtttgggct gatacagctt atcgctcgaa agcgaatgag    153660
     gacttcatgg acaaagaggg ttttgtctca aaggttcaca gaaaaaagcc gcatctcaag    153720
     cctatgcccc gacatatcca gaaatcgaat gctggaaagt ccgtgatccg atcacgcgtc    153780
     gagcacgtct ttgccgacca gaaatcacag acggggttgt tcatccgaac tgtcggtatc    153840
     acccgggcca ccatgaggat cgggctggcc aatatcgtct acaacatgcg ccgcttcctc    153900
     ttcctcgaaa ggttgaacgc gagcgcgtag tcatccagcg ggacggcagt ccccgatctg    153960
     ctcaaaacgc agatcaaaag ctaccccaaa aaccgtcaat caaatcgcca aaagcctgaa    154020
     atcacgagcc aagcgcatca accaacggtt cttcgatccc tccatgtatg cagccacaac    154080
     acttcgacgc atctggttat aacctgcaac ttatgagcca aactctaatt ggaagagact    154140
     taaccagatg agaagaacac tcaagaccgc acgatataac cgcgtttgag cttcttacga    154200
     aacaaaacag ccagttgatt ggccgcagct cccgcatctg ggaacagatc aagcctaacc    154260
     cttccggggg tccctattct gccccatcgc cggataagcg ctgctccccc aaacagatcc    154320
     ggttgaacag agaggtcata atagcgccac gtgttgcgag ggggaaatat gcgcaccaga    154380
     gagaccgcgt ccggaaaaag agaaagctgc tgaaatgctc cgtcccccag cgccggctca    154440
     cagttaccac aaatagtcta ttccaccctc agagcatcct tgacggcctt tgcgggtgta    154500
     taggcgagtt tacgagatgc agggatcacc agctcagcac ccgtttgcgg gttgcgacct    154560
     ttacgctccg ccgtctgacg caccacaaat ttgccaaatc ctgcaatagt tgtgtcatcg    154620
     cctttgaccg cagcttcagt aatcgcagca aaaactgttt ccaaagccgt tttggcatcc    154680
     ttcttctgaa tgtccgttgc agcaacaata cgttcaatca agtcctggct gttcatctta    154740
     atatcccaac ataagaaatt atggattgga aggtagtaga tttaacatcc caactacaag    154800
     agcttccctt ccaatccctc aatgatgaaa cttatgatct ttctggtgat gcagacgtta    154860
     ccggctcaaa ataggtgaat tgccccgggt tttgtggaga cgttttttat ctgatttaag    154920
     cggctaatgc atgtgatttc tgttatgcat aaaagcgtgc ctcagcttct gctggcggga    154980
     tgtttccaat ggaggacagg agccgccgat tattgaacca gtcgacccat ttaagtgttg    155040
     ccagttcaac agcttccctg tttttccatg gcccctgccg atagatgagt tcggttttgt    155100
     aaagtccgtt aatggtctct gctaaggcgt tatcatagga atccccaaca ctgccgacag    155160
     aagcaacgag ccccgcttca gccagtcttt gcgtgtaacg aatggacaca tattgacagc    155220
     cgcggtcgga atggtgggtc acttttccct caggtcgcct ctggcacaga gcctgctcga    155280
     gagcatccag cacgaagtcg gtatgagccg ttgaggagac gcgccaaccc acaataaccc    155340
     gtgcgaatac atcaatgatg aaggccacat aaacaaagcc ctgccatgtg gaaacgtaag    155400
     taaaatccga aacccagagt ctgttggggg caggagcatg aaactggcgc tgcaccagat    155460
     cctgcggaca cggacgttgc ggatcaggcc gtgtggttct gacccccttg ccacgaatga    155520
     cgcctttcag ccccatccgg cgcatcagcc gctctaccgt gcagcgggcg acatccagac    155580
     cttcacgtct gagctgatgc cagaccttgc gcgctccata gacgcagaaa ttattattcc    155640
     acactctacg gatgtcatcg cacagttctt tgtctttctg gctgcgcaca cacggatttt    155700
     tctgtctggc aacagttgca taataggcag atggtgcaat cgacagaacc ctgcagattg    155760
     acccgacacc atatgtctgc cggtgctcct caatgaagcg tgtcatggct tgaagatgcg    155820
     gtcgagctcc gcctgggcaa aatatgccga cgccttacgc aggatttcat tggcctgccg    155880
     caattcgcgg ttctctcgct ccagttgcct gatcttctct cgatcaggca ggtcactcac    155940
     cgcaggcgca ttggcacgtt catgcagacg ggtccatttt gacagcgtgt caggatgaat    156000
     atccagcttt ggcgctatca tcatcactgc agaccaccgc gaaggatggt tcttctcttc    156060
     ctccagaacc atgcgggctg cacggtcacg aaactcaggc ggaaaacgct tcgatttatt    156120
     gctcatgaat tcttcttacc tcacgggtct ttctgtctcc acaaaacccg gggcaattca    156180
     catcagcgca ttctggacgt ggtcagcagg gtttttcagt ctctggaacc cgagatcggg    156240
     cggcgggcaa aactgatcgg tgaccggtat caatggcgtt ccactggcct catcatcttc    156300
     tgggccatgt tgctggtcgt catcggtttc gtgcttggtc ggcttccatg aaagtgtgac    156360
     cataatggac acacctgccc tgcccgctct tttttcaatt ccgtcgcatg atggtctggg    156420
     aaaatcactg catcgcaatc aagggagatg ctcgtgaaaa agagacgatc cactcttcac    156480
     agatggaagg tcctgccagc gcttggctgt tcctttctta tttatcctgc attggcgcaa    156540
     accgtcaatg tcccggctgg cctcccgccc acggtcaatg caacctatca ggaagttggt    156600
     atgggtggct ggacaccgcc aacctcttct accacccagc agatcagtgg aagcggctcc    156660
     gtggtctcaa caaccacaac atcgtctgat agcggcacag acgcgctcca atcaatgtat    156720
     tcccagtcat ggggatatgc tgccgcccag aatgccagcg cccttggtgt taatcctgac    156780
     gctctggcgg caacctgcgt cgtggagtca ggatgccgca acgtttatac agcaaacagt    156840
     aattcatcca ttactggtgc gtttcaaatg tcgaacggca catacaatga agctcttcag    156900
     aaagcgttgg cttccaaccc tagtctagcc tccaccatca ccaacacggg aatatctggc    156960
     cagcaggatc ctgccacgca gacagttgca gcagcacagt atctcaagga tgcggcaacc    157020
     acgctacaaa acgcgggaat tagcaacccg acagctcttg acgcacgtgc gtattacaat    157080
     tttggtccta ctgctggaca agcaatcgca cgtgcaactg acgatacgcc gatgtcagaa    157140
     tttgtctccg cttcacacat ggccagcaac ggcatttcat caaacgagac cgtcggccaa    157200
     tggcgggcta atgtggcttc gaaaatgggt tcggcagctt catctccaat attaagctca    157260
     taaaaaggaa aacagatgtt ttttcgtaaa ttgtcatttg ctgcattcgc tggaatgagt    157320
     ctggcctgtg tatcttcaca cgctctcgct gccggcccta aaccggtaaa acctttgcaa    157380
     ggctacaaat gcttagcaat tgatgcgcct gatagcgtga tgatggattt caataatcca    157440
     attcctcttc gctcagcgcc caatgatcat gctccagtta ttgctccagc gtcagcaatt    157500
     cttgctgtta atgacccgga acaattagat aatggttatg tgaaaagcat gaatttcgca    157560
     ttcaaaccag gctgggtacc aacgaaatgg cttaaagaat attcagaggt ccatcctgga    157620
     aacacttgcg caccatatat catgaatgat ggaaagctcg gtttcaaatt tggacattaa    157680
     ggacaacgtt tcatcattct gatagataca gggaagccgc caactggcgg ctttctttat    157740
     gcttgaaatt ctgacttctc tttcacgaac tcccgaaata tcggatcatt gatccgccta    157800
     cgtggtgaag gccgtgccag aaaagccgct tccagatcaa gcagccacgc ggaaatgtct    157860
     ggaggcaatg cggatgtccc ggcgagggca cggcgtaact gagtgtgatg tgtgtcacat    157920
     ctctcggctg cgagacgttc tgaccaaccc aacaccataa ggcactggaa cagacggcgc    157980
     ccggaaaggc gtatttccgg gcgatcggaa gataaggcat ttttgctcgt tgtcatacat    158040
     ggatgctgcc tgtccatgat gcgacgagcg cacattcaaa tggattttat ccctgaatta    158100
     gaaaggcccg cagcagacgc ttccagaacg gcacaccttc agccttccat gtacgctgaa    158160
     gctgccgatc ggctgcaagg gtgtcccaca gcaaaggaga aacggacagc ttctcccttc    158220
     ggcttgcccc ttctcgacgt tggcgcttgc gttctttgcg gatcataatc gcgcgggcaa    158280
     gattcatggg ttgttatctt tcaacgtggg gcattgtttt tgttatgatc catggcgatt    158340
     ttcttatctg cctatcagtg cacgggcttt tgcccgaatt tccgatagct ctacctcaga    158400
     cacgcgccct ttgctcttcg caccccgcgc ccgccaatcg aaagacttta cctgatccgc    158460
     gagcaccgca ctcggtcgat cagtgtcgat tgcaacttca aaaggatagc ccttcagctt    158520
     ggtcgtcagt ggacaacaca gcatcagacc aatccgatta taagccgccg atgacaaaac    158580
     gactgcgggt cgatgtcccg cctgctcgtg tccgatttgt ggtgaaaaat cgagccacac    158640
     gatttcgcca gcatcgggta cgtaggcaac catgtcagag gagttcgcgg ccaacaggcg    158700
     ctccgaagtc cacttcagga tgaatattct ccggggtaat cccagccaac aaatccgcca    158760
     gatcgtattc tacgactgtg agcggctcaa tgacaatgcg tccgctttcc tcgcgcacat    158820
     ccactggctg atccaacgtc aatccagcag ctgccaatac tgaagcaggg atacgaatgg    158880
     atgcactatt cccccatttt tttaccacag ccttcattgc gccctccatg ccaaattaac    158940
     tcagtcgata ctatatgagt gcgatttaat gtgtcaactt cgtatcaaca tcattcttta    159000
     tttggatccc ttaccctcat ctatcaatca cgcaaaaagc ttctcaagca tgccgattgt    159060
     ctgccctgcc gcctcgagtt cggcgcggat gccaccgtat tcacagtcgg caggaatatc    159120
     gagtggcagc acagggataa acgccaacac gctttcgacc cggttcaaga gcttttcgga    159180
     gccttttttg gcgcatccat agcgtaattc tgcggccacg atgatgctgg tgcaaagatc    159240
     acctgggtca atatgctcaa tgcgttgcgc acaggagccg gaaggattgc gcacgagatc    159300
     gctgatgatg tttgtatcaa gaaggtagat gctcacagga tatcttctgg tctggcggca    159360
     acatcctgaa tatcgggaaa atcgtcttcg ggaggcagct gcggctcttc acgccatgcc    159420
     atgagaagct ccttcagcgt ggaaggcgtc ttcacaggct ccagaacgag tttgtcaccg    159480
     tcacggcgga tcagcacacg atctcccggc atttcaaatt cgaccggaat ccgcacggcc    159540
     tgactgcgat tattccgaaa gagttttact tcgcgcggtc tgggggtcac ttcaggaact    159600
     ggcatagggg cctcctacgt gtatattcca taatgtctat gcccgactgt caaaactcaa    159660
     gacatttgat tgtcctctca gagatgcccg actgtcctac cgtcccgacc acgcatgtag    159720
     tgcatcatat agtcagcacc agcgatggag agtggcgctg ccagcccctg caacccttcg    159780
     atacgggctt cgtcacgacg cgcagcaatg caagccagtg cgcctgatct ggagaaaagc    159840
     cggaaagcat catcctctcg caactggaag cgcaaaggga caaggtcagc cagacggtaa    159900
     tccccccatt tttagtgggg cattgaatga gacttcaggc agctgttttt agtttctggg    159960
     cgggggttag cccgctgttc cccatgttgg gtctgtcatg gttatatgtc cagagccatt    160020
     gtgttgcgac ctcctgtacg tcctgaatgc tttcaaacaa atactgctcc agccattcct    160080
     gccggacagt tctgttgtag cgttcaatag aggcgttctg ctgcggatta cccggttgcg    160140
     tatagatcag ggtaatcccc tgtttttcgg cccatggaac caacgtatga ctgacatatt    160200
     cagggccatt atccattcgg atggcttctg gcctgccacg ccactccata acctgttcca    160260
     gacagcggac aacccgacag gctggcaggg aaaaatcaac ctcgacgcgg aaatctcaca    160320
     gaagggttgt acatcgggtt agattatgaa aaagtctgtt ttgtagaaaa gaaatttcca    160380
     taatcatcaa gaaaacccga tgcagacaga gtgtagcgca ggcgcgtatg agtttccagc    160440
     ctcctgtgga cggcgtgttg tggcccgttt tgacgggggt cgcatgagtt cggatggggg    160500
     cgtaattctg gtgaagcagg ctgatgacat tctgggtctc agccgccgct ttgctgcctg    160560
     ttttcgcgat aagcggcatc ccggctttgt ggaataccgg gttgaagacc ttgtccgtca    160620
     gcggatcatg gacctggcac tgggctatga agatctcaat gatcacgatg ccctgcggca    160680
     tgacctgatc tttggtctgg cctcgggtcg tctgtcagga ggccgggcaa actgcgcagc    160740
     attggctggc aaatctacac tgaaccggtt ggagcgcagt gggcacaagg cagatcgtta    160800
     ctgtcggatc attgctgatc atgaggccct ggctaccctg ttcgtcacgc tcttccttga    160860
     ccagcatgag cacgcacccg cccggatcgt tctggatgtg gatgccaccg atgaccgtat    160920
     ccatggccat caggaaggcc gcgcctttca tggatattac ggccataact gctatcttcc    160980
     cctgtatgtc ttctgcgggg accatctcct cagcgctacc ctgcgcacgg cagacaggga    161040
     cccggggaag gaagcactgg cagacatccg ccggatcgtg gagcagatca ggagccgttg    161100
     gccccgggtg cgtatcctgg tgcgtgggga cagcggtttc gcccgggaca gtctgatgac    161160
     atggtgcgaa gacaaccacg ttgacttcct gttcgggctt gcaggcaaca cccgcctgta    161220
     tgaccggatt gcctctttgt ccgctgaggt tcgtgacgaa gccgccacga caggcagagc    161280
     tgcgcgcggt ttcgcctcct ttgactggat cacaaaggac agctggacgc gccgcaggcg    161340
     ggtcgtggcc aaggccgaat ggcgccacgg caaccgctat catcgcttca ttgtcaccac    161400
     cctaccgcag ggaatgtccg acccccgcca tctctacgaa cagatttact gcgcacgcgg    161460
     ggatatggaa aaccgcatca aggaatgcca gatggatctg ttctcagaca ggacctcgtc    161520
     ccacaccatc cgggccaacc agctccggct gtggttctcg gccgcagcct atgtcctgct    161580
     gaccgctctg caaagactgg cccttggcca gaccagcctg gagacggcga cctgtggcac    161640
     catacgcgca cggctgctca aaatcgcgac acgtgtaacg ctcagcgtcc gtcggattgt    161700
     cctgtccatg ccggacatgt tcccctgtca gcatgaattc gccctcgctc atgcacgatt    161760
     gcgaaggctc cggcaggcca tctgaagaaa cagacagtgc acagaccaca tagcttccac    161820
     caacactgcc ttctcaggcc gtgacaccct cactgcgttc agaacccgcc gccagaagca    161880
     gaatatcgtc aatattccag atcgggctcc tgtgggatga ctgaattcta caaaatgacc    161940
     cgaaattgcc tcaagtgtga gaaatccgcg tcaattgtgg tcactcgcct tgatcggctg    162000
     gcacgcagta cgtttgattt attcgctata gttaaaagta ttaccgaaaa aaagctcagt    162060
     tttactcttt ggcagaacca tggaccgata caactaccag cacgggtcgg cttatgcttg    162120
     ctgtccttgg aggtttagct gatgtcgaaa gagatttaat acgaacgcgc acttccgaag    162180
     gacgcgccag agccatcgcg caagggaaaa agatggggcg accaagtctt gtcaccccgt    162240
     cacaacgact tgaaattatc aaaaaaagaa aaaatggcga aaaattggaa caaattgcaa    162300
     aagctttcgg cataagttcg ggaacggtct atcggattgc ctcacaggcc ttaaaacata    162360
     actcataaag aaattaagga cctgatttct tccaatatcg ccattttttt gattgatatt    162420
     ggatcataaa taccttgctt ttgatcattc cctttaatgc ccgatttcag cacaacttgg    162480
     gatttaagtt tattcgagaa tttgttataa tatcataagc caagagcctg tccgctacct    162540
     atggcggctc ttggtctgat atctattcta tcttcgctgt gaactctaaa ctcgcaaaca    162600
     tcttcatatc gcatcttacc gatgctgaag ggcgaacggg atacgagagg ggatattctc    162660
     aatattcatt caccattaag gttaaaacat tttccacaat ggattatcgg gattggcaag    162720
     aagcttgacc gtaagggcca aggacataat aaccagcaga ggtcggatac ctttgccgcc    162780
     atatctgatt gccaaccatg ctccgacctg gtttccaaga atatttgctc ctgccattcc    162840
     aaatccgagc atccataata cctttccgcc aacaatcatg gccgtaagac ccgcgacatt    162900
     ggttaaaaga ttgataaatt tggtatttgc aattgcacga actaatccaa ggccagcaaa    162960
     agcaaccaag acagttgtta gaaatgatcc cgtaccagga ccaaaaaaac catcataaaa    163020
     tcctatgctg gtcatacata gtgtaatccc catacgtcca aggcgagcgt ggcgatcttc    163080
     cccactcaag ggaggggcca atagaaaata agcagccatt ccgattaaca aaagcggtac    163140
     aattgctgat aaaaagatag gatttacaaa ttgtacgacc gttgcgcctg caagcgctcc    163200
     caggaaagct cctatggctg gcaaaacaaa ttgtctgata tcgacatgcc ctgccctcaa    163260
     aaaggtcaga aaagccgaag aggtcccaat cgtgctttgc agtttattgg tggcaagagc    163320
     cgaaacaggt ggaataccag ccgccatcaa agcgggaatt gtcacaagac cgcccccacc    163380
     cgcaagagca tctatcccac cagccacaaa tgcgctcgat atgagaaaca ggattgtatc    163440
     aaatgtgaat tgcatggtga aaaaccaact cggactcaaa tatctctaat taaaaaaacc    163500
     gaatattctg aaggcatcag catagccccc ctctacgatg gaggaaatag cgatatcaat    163560
     gtaatctggc tgaatacgat catctcctac ctgaccacta gcactacagt tgcattttgt    163620
     gttgagttct gaatctatgg gtaaccatga ttcaggatat gatgagtggc ggtacgtctg    163680
     ttgaagagac gctggaatta tgggcgcgct cgcttcggtc cgccaaggat cggatggcgc    163740
     cgctgttcac gcaaaaacgt gtcgtagatt cggcctgtgc ttttcttgat gttttgattg    163800
     gcaatgaacc acgcaagacg ggatggatgc gagcggaagc cgcaggagat cctggtccat    163860
     ggcggcagca ggcgcttctg ggacgcgggc actgggatgc cgatgccctt cgtgacgtcg    163920
     tcagggatta tgtgattgag catctgggca ctgaagaggg cgtgctggtc attgatgaga    163980
     ccggttttct gaagaagggt caggcgtcct gcggtgtggg gcggcagtat acgggatctg    164040
     ccggcaagat cacgaactgc cagattggtg tgtttggcgc ttatgtttcg gaacgggggc    164100
     atgcctttat tgaccgcgcc ctgtatctcc cgaaagactg gacatcaaag cctgagcgtc    164160
     tgaagcgggc ccacgttccc gatgacgtgg tgtttgcaac caaaccggcg ttagcctcga    164220
     cgcggatttc tcacacttga ggcaatttcg ggtcattttg tagaattcag tcatcccaca    164280
     ggagcccgat ctggaatatt gacgatattc tgcttctggc ggcgggttct gaacgcagtg    164340
     agggtgtcac ggcctgagaa ggcagtgttg gtggaagcta tgtggtctgt gcactgtctg    164400
     tttcttcaga tggcctgccg gagccttcgc aatcgtgcat gagcgagggc gaattcatgc    164460
     tgacagggga acatgtccgg catggacagg acaatccgac ggacgctgag cgttacacgt    164520
     gtcgcgattt tgagcagtcg tgcgcgtatg gtgccacagg tcgccgtctc caggctggtc    164580
     tggccaaggg ccagtctttg cagagcggtc agcaggacat aggctgcggc cgagaaccac    164640
     agccggagct ggttggcccg gatggtgtgg gacgaggtcc tgtctgagaa cagatccatc    164700
     tggcattcct tgatgcggtt ttccatatcc ccgcgtgcgc agtaaatctg ttcgtagaga    164760
     tggcgggggt cggacattcc ctgcggtagg gtggtgacaa tgaagcgatg atagcggttg    164820
     ccgtggcgcc attcggcctt ggccaccacc cgcctgcggc gcgtccagct gtcctttgtg    164880
     atccagtcaa aggaggcgaa accgcgcgca gctctgcctg tcgtggcggc ttcgtcacga    164940
     acctcagcgg acaaagaggc aatccggtca tacaggcggg tgttgcctgc aagcccgaac    165000
     aggaagtcaa cgtggttgtc ttcgcaccat gtcatcagac tgtcccgggc gaaaccgctg    165060
     tccccacgca ccaggatacg cacccggggc caacggctcc tgatctgctc cacgatccgg    165120
     cggatgtctg ccagtgcttc cttccccggg tccctgtctg ccgtgcgcag ggtagcgctg    165180
     aggagatggt ccccgcagaa gacatacagg ggaagatagc agttatggcc gtaatatcca    165240
     tgaaaggcgc ggccttcctg atggccatgg atacggtcat cggtggcatc cacatccaga    165300
     acgatccggg cgggtgcgtg ctcatgctgg tcaaggaaga gcgtgacgaa cagggtagcc    165360
     agggcctcat gatcagcaat gatccgacag taacgatctg ccttgtgccc actgcgctcc    165420
     aaccggttca gtgtagattt gccagccaat gctgcgcagt ttgcccggcc tcctgacaga    165480
     cgacccgagg ccagaccaaa gatcaggtca tgccgcaggg catcgtgatc attgagatct    165540
     tcatagccca gtgccaggcc catgatccgc tgacggacaa ggtcttcaac ccggtattcc    165600
     acaaagccgg gatgccgctt atcgcgaaaa caggcagcaa agcggcggct gagacccaga    165660
     atgtcatcag cctgcttcac cagaattacg cccccatccg aactcatgcg acccccgtca    165720
     aaacgggcca caacacgccg tccacaggag gctggaaact catacgcgcc tgcgctacac    165780
     tctgtctgca tcgggttttc ttgatgatta tggaaatttc ttttctacaa aacagacttt    165840
     ttcataatct aacccgatgt acaacccttc tgtgagattt ccgcgttgat gctgcctacc    165900
     gcatacatgc caagggtcca tttttcctga cgcagacact tttgccgctg atcgcgaacg    165960
     gtggccggat cgtgaacatc tcatctggac tgacacgctt tgcctatcct ggctggattg    166020
     cgtacgctgc tatgaaaggc gccgtggaag tcatgacgca ttacatggcc aaggaactcg    166080
     gaccgcgccg cattgctgtt aacacagtag cgccaggtgc aattcagaca gatttctcag    166140
     gaggtatggt acgcgataac cccgagattg ctcaccacat cgcggaagta accgcgcttg    166200
     gacgtccagg actgccagac gatatcggcc ccatgatcgc atcgctgctc tccgaggaca    166260
     atcgctgggt gaatgcacaa cggattgaag tctccggtgg tcaggccatc taagatctgg    166320
     tcacccctta cacagaaggc catgttggta ccattaggac accagcaagc gttttcgcgt    166380
     aatttttccg gatacggtgg ttggcaatcg cccgacgaag cggacttctt tcagaccaac    166440
     ccaacgcccg aggacttcgt tgatccgcgc aacgatttcc tcggaagaag gcatacattc    166500
     cgcctcggaa tcaggaacga cataagcgat aggtcgctgc cctctcagtt catctggaat    166560
     tgcgaccacg gcacacgcgt gaacggcagg atgggtggcg atgatctttt cgatctgcac    166620
     gccggaaatc cgccttcctg caaccttgat gacatcatcg gaacgtccga gcatatgaac    166680
     tgcgcggttg gcctgaatca tgccttcatc gaaggtgcgg taatacctgc gcgtttcatc    166740
     aagataagcg gacggaacac ggatagcccc attcttccat attccagcga gacacccagg    166800
     cggtaacggc agcgaaagaa cgatctcccc gcactgctca ccgggtatgg agggcacgat    166860
     ggccggacga aatcccggcg caggccgccc gatgtcattc atgagagaaa ctggctcacg    166920
     ttcgggtaga ccgaagaaat gcgcggtgat gctccatccc gtttccgttt gccaccagtg    166980
     attgaccaca ggtgtgcgaa agtaggatcg agcccactcc agcaacgtcg gatccgcata    167040
     ctctccagct acgaaaacac gggcaagagc gggcaggatc acctctgaca gatgacggct    167100
     ctcctgtcgc atgagacgca tctgagtggg cgtggtaaac aggcatttca ctccatgctc    167160
     atgacagagc gtgcgaatgg cggacgcaga tgcaccgcct tcgacgatga cgctggtaca    167220
     gccgctgatc agcggcgcat aaacaccata ggaatgacca acaacccagc caaggtccga    167280
     tgtagtaaag aaggtatcac cgggttcgca gccgtagatc acgtccatgg acaaggcgag    167340
     agccacagca tggccgccat tatcacgcac aatgcctttt gcgtgccccg tcgtgccaga    167400
     tgtgtgaaga atatagagtg gatcttcgga gcgtagcacg acggcctcta cagacgtgga    167460
     ctgttccagc gtatggaaat catgatcccg caatggcatc aatgatgtcc gacatgctgc    167520
     gcgttgcaca atcacgcaag cctgtggccg gtacgctgcc aaagcaagtg catcattcag    167580
     agcaggggca gacggaatgg gcgtctgtcc ctgaaagctg caactggcaa tgataatgac    167640
     tttcggagcc acatcatcaa tccgtcgtgc caactccggt ccggcataac cggcaaaaac    167700
     cacaacatgc acagccccta tccgcgcaca tgccaacata gctatggctg tctcgatcat    167760
     ggtcggcatg gcaatcagaa cgcagtcgcc tttctccact ccgagcaggc gtaggccgcc    167820
     ggcaaatccg gccaccctgt cctgcagttc gcgataggtc acgacctgct gttccttggt    167880
     ggcgcaagaa tgccagatca acgctacctg ctcaccgcga ccattctcca catgccggtc    167940
     tacggcattg tggcaggtat tgagcgtgcc gtcagggaac cagtcatgcc aaccgtctgt    168000
     tcgctcccgg caggccatcg caggctcctg cttccatgtg atacgctgcg ccgcactgag    168060
     ccagaattcc tctggctggt tcagtgccgc atcatacatc gcttcataag ttgtccatgg    168120
     aagcatggcg catactccga tcaggctatg ggcacgtctt tgccggtgat ctggctggcc    168180
     agccacgcag catcacggga aatgccggaa aaccgcccgg agccccatgt atgcagccat    168240
     ggcagaccaa gaaaataaaa gcccggcgca tccgtcacgc cccgatgcca gaccggcttg    168300
     ttagcaccgt tgaagacggg cacatcgatc cagcggtagt tcggacggaa gccgatgcac    168360
     cagacgatcg atgtgattcc agcggccttc agatcgagcg gcgtgttgct tccatcaggc    168420
     tgccagacag gtacgtaagg cgcttccgtc ggtgcattga tgttttcgcg agcaatatag    168480
     gcatcaatgg atttcttgat gtctgcattg gtcttgtccg catcgtcgag atgttgcttt    168540
     agatctggaa gaaaatgcgc aacctcatca cggattgtct caagcgtacc atgcaatcct    168600
     accccttctt ttgcaaaaag acgcagatca aggtcatgcc ccccattgcg gccggtgaca    168660
     taatggttgg tcttatcccg cgccccttcc cgtaaggggt gattatccac cgtcagatca    168720
     tagaagtgca tatccgccag ccagtccaca acgtcacggc cacggtaaaa gcgtgagaca    168780
     cgcggggcgg agccgacaca cagatggacc ttgcgttttt caaggaacag gtcctcgacg    168840
     atctgtgcac cggactgacc gctgcccacg accaggacag ccccttcagg caactgggcc    168900
     gcattgcggt aatcctgcga gtgaacctga aagattgatg gatcgatagc actcgcatat    168960
     ccggggatca ccgcatcctg gtacgctccc gaggcgatga ccacatgctt tgtgtgccag    169020
     gtctcaccgc ccgccaccac acgatagcca ccggcctcat gacgtgtgat ggaggtgacg    169080
     gctgtgtgtt cacgcagcgg gggattgaac gagttaacaa agcctttgac gtattcaatg    169140
     atttcctgct tcaccatgaa gccgtgtgga tcttttccct tgtatgggtg gccgggaagt    169200
     tcacattgcc aattcggtgt gaccaggcag aagttgtccc agcgctcatc gtcccatgag    169260
     tgacaggcgg tcttggattc aaaaacgata tgatccactt tttcgcgaca gagataccag    169320
     ctcagggaga gcccagcctg tccgccgccc acgatgataa caggaatgct tttttcgttc    169380
     tgtgtcatgg tcgttctttt cgtctcagta tctgaaagac aggacgcgca cctgcgcatc    169440
     gggtcgatta aggaaaggcg cactgctctg ctgaatgacg tgcagctggc caagggcgcg    169500
     actgcacgga aagccgtaac gggcacgaac ccgttcgctc gcctgggtca gagccgtgtc    169560
     cgccttttca agaaactccc ggaccggata atcctgaccg ggtgtgaagt ggtcccttat    169620
     gaccagcgat ggggagtaac agtcggtctc gttcccatcg ggccaacgca cgcgaaaggt    169680
     catttcgggc atggtgacaa aactcctgaa gccgggacgt cagcgtgctg caatgctgcg    169740
     agacgccgat atgcggggag atgccgactg gcgacgctgt cccagtcgaa acggcgggct    169800
     gttgcagggc cgctgagccg gaaatggtca cggctttcga cgcgcagggc gtcgcgcaac    169860
     gctatgaaca aggtgtcggg gtgcgccggt tggcaccaca gcgcatctgt tgccgaaaaa    169920
     tgttccgtga aaggtggtgc ggctggcacc accacgggga ttccacaagc cagggcttcc    169980
     agaggacaca gtccgaaccc ctcggttacg gatggatagg ccaacacgtc cgcctgccgg    170040
     tagaatgaag gcatgtcttc atccgcaact ggcccggtga tggtgacatg atcggccgca    170100
     ccgctttcgc gcagacgcgc catgaatcgg gtgcggtagg cagaatgatc cagcagcgag    170160
     gccccgcctg ccacaatcag atgcacatca ggctgttcgc gacgaagggc cagaaatgcg    170220
     tcgagcaagt gcagcgtgtt cttgcgctgc tcgatcccgc ccacggacag gatcaggtgc    170280
     tgaccggcag gcagatgata ccgcgctcgc aacgcggcat cgtgcgcggt tgctacgggc    170340
     gaaaagtgca cgggatcaac cccattgccc acgaccggag cttcgcggcc atggccgttg    170400
     cgcaggacat cttcccacat tgtgctgacg gtaaacagtt cggccgccgc cctgatcccc    170460
     cgttcctgcc gcgcggcaag gaccgggtgc gtgaaatggt caagatggtg gaccgtgcgg    170520
     gcaaagcccg gtatccgccc ttcctgcacc agatcggcca aagcattggc gctgatcgga    170580
     tcctgcgcat gcagcacgtc aaaatgctgt ccgcgcaatg cgtctctgat ttcgccaata    170640
     cgacgctcca ccagtgtcgg cagatcaggt acagacgcgg ctgggatgca ccaggttgcg    170700
     caacggggtt tgcggaagaa acccgatcct gtcacgtccg gtgcgatcag cgttgcgtcg    170760
     tggcccgcgt cacacagagt ttccgctagc gccatgccgt gcaccacgcc gccacgcgga    170820
     ttggtcgaat gggtcagaat gccaatggac agactcatgg cgcaaatccc atgagtgagg    170880
     accgggcgag atcccagaag gtttctttct cgtccgccca tatgacatcc agccgctgcg    170940
     tgctctcaca ccgcccgatg acagaagcag taatgccacg tccacgaaac cgggccatga    171000
     tcgcgtgggc atcttcggga cgcgctgtca gcaggtatcc gtagcttggg aatgcagaca    171060
     gccagcgctc catcggagca tcctcaggcc gtggaatgtc atcgagcata atggtcatgc    171120
     cgatgcctga acattcggcc agcatgagag cggtccccag cagaccggcc atgctgatgt    171180
     ccttggcagc acgactcagg ccatcttcgg caatagtggg cagaagttcg atgtccccac    171240
     gcaaccgggc cgctccctct gtgccgcaca gcccggaact ggcatcccag aacgggtgcg    171300
     gatcgtgcca gcgaccgcgc agatcaatgg ctgcgatcag cacctcgccc ggttgggcgt    171360
     cgaagctggt tagcagatga cgggcacgac caaggattgc cactgagagc gaattatggg    171420
     tactgcgcat gttggtgtgt ccaccaacaa ccggcacacc gtaggtgttc gcaccgtcat    171480
     ggagacccgt caggatggac gcggccgcct cggacgtatc gctccacaac gcatccacca    171540
     ccgccacggg acggccgccc atcgcagcga tgtcgctgac attgaccatc gcgccgcaat    171600
     acccggcaaa ccacggcatt gagcggacaa agctgtcctg aaagccctcg ctggccagca    171660
     ggagatagcc atcgccatcc gggatcgcgg cgcagtcatc cccaagacgg atagctttgg    171720
     cacctgtccc taaaatcgcg ctaacttctg caatatcctg cttagccgca agagagcgcc    171780
     ccatacgaag cgtgcgcagg agtgtggtga gctcatgtgc catcatgcca cctgtcgtat    171840
     ccggggttgc ggacgcagca gccaggtctg atccagaccg tgcgccggat agcgtgacag    171900
     atcagcctcc atgtcgtgat gcggcaggcc atgcagcgta atgacgccga gacttttcca    171960
     gtgcaggcga cggaagaaca gcacattctg ttcctgcacc tgggccaaaa accgtgtagc    172020
     ccccaggccg tgtgccgtac tgacggccat gcggatgagt tccgccccga tccgccccag    172080
     cttgcggtga tcagcatgca cggccaaccg ggaaccgcgc cacacaccgg gctctgcttc    172140
     gtgaatgcgc actgccccca cgatccggtc cggcatcccc gccatgcagc aggcggcaat    172200
     gatgggaatg gcgtcctcat caatcgcgtc gcggtcatcc tctgcaaaaa catgctgttc    172260
     actgcagaac acttcacggc ggagcgcatg ataaccggca cgctcccatg gcgtgcgggc    172320
     aaggcgcaca acatattccg tcggaatgaa cggccggtct tccatacctt cgaggatcgt    172380
     gctcattgtt cgtacgccga aagcgaggaa caggcgccac aacgtccaca cccggcccgg    172440
     atatcggtgg atttcatgtt cgcttcccgg agcatccgcc caagcggtgc cagcacggat    172500
     ttcataaact cggctgaagg cgggacatga ttttccagtg gggtgccgga aatgggcaca    172560
     aacggcacca cgaagggata gacccccagc gcaatcagac gctcggcgag agccagaatg    172620
     tcctcggggc tgtcgccaag accggccaga atgtaggtat tgacctgccc acgaccgaag    172680
     atcggcacgg cgctggcgaa agcgtccatg tagcgatcga cgctgaccgt ggccttgccc    172740
     ggcatgatct tctcacgcac tgcctgcgtg gcggcttcga gatgcatacc cagactatcg    172800
     gctccagctt cccgcaaacg ctggaaccag ccgtgatcac gtggcggctc gcactgaacc    172860
     tgaagcggca gatccaccgc cgccttgatg gcacgggctg actccgccag cacggcagca    172920
     ccccgatcaa ccacattggg cgtgccggtc gtcagcacca tgtcgcgcac gccgtccagt    172980
     tccacagcag ctttggcaac ttcggcaagc tgcgccggtg tcttgtaagc aatcgtccgg    173040
     tccgcctcca gcgattggcc aatggcgcaa aactggcagg atgtgcgccg gtcggcatag    173100
     cggatgcagg tctggtgcac cgtggtcgcc agcgtgtcac ggccatgcag tagcgcgatc    173160
     ttccagtagg gaataccgtc tgccgtgctc agcccgtaaa agcgcggggc agccgggaaa    173220
     tagatcgtac ctactgcccg cccatcgcgt agcagcatgc tcgtcccgtg ctggtctggc    173280
     gggctggcct gaaacggtga atgctgcgcg ccagacgtat agaccggaac catgacggtc    173340
     tggcccgcaa tggtgatcgt cttgtgatcc gaaggaccag cgcctccctt gcgggcaatg    173400
     ccgccagtct gctcgccgat ctgcagtccg aaggactgga gatcggtaac gagcttgcga    173460
     ccagaaagtg taccgagcgt cggaatggtc atgacgcagc ctcatctgta gatgtggaaa    173520
     ccggatcggc ttcaccaacg taatgaacgg tacgggcagg ccgccgatcc tgaagcagac    173580
     taagcagttc aggccgtgca taatgcccta cagagtccat catccgtttg cgcttggtga    173640
     taagagcgaa atcaagatcg gcaatcacca tcccctcacc ttccgtcaaa ggcggggcca    173700
     gaagcttacc ttcgggagag acgatggcgg taaagcagcc tcctcgcagc ggcccttcaa    173760
     gtgcagggtc tcgcgcaata tccttgatct gatcttccgt cagccaaccc gtggcattca    173820
     caacgaaaca gccggattcc agagcgtgat gacggatggt gacttccatc tgatcggcga    173880
     agatctgccc caccagtgaa ccgggaaact gggcgcagtg gatttcttca tgttgggtca    173940
     tcagcgcgta gcgcgccaag ggattgtaat gctcccagca agccaatgcc ccgatgcggc    174000
     cagcggcact ttccaccact ttgagccctg actcgtcacc ctgcccccag atcatgcgct    174060
     catgataagt tggggtgatc ttgcgacgtt tgagaaggat ctcacctgtc gcgtcgaaga    174120
     cgatctgcgt gttatagagt gtgccaaaat cccgctcatt cacgcccagc acgacgacca    174180
     tgccggtatc acgtgcggtt tcggccacca tgtccgtcac cggaccagga atgatgacgg    174240
     cgcgttcata aagttccaga tgttcgccgc cgaaacggaa agctggctgg atgaacgaga    174300
     aataggggta atagggcacg aaggtttcag gaaagaccgc cagcttcaca cctttttcgg    174360
     cggcttcacg gatggcctga cagactttcc gggctgtccc caaaccgtca tcgccgagga    174420
     cgggactgat ctggatggca gcagcgcgaa cgatacgtga catggcttgc ggtccttcct    174480
     ttggccttta gagagtccag gtattgagga tgaaagcgtt gtcacgacgc gcaaggagga    174540
     taatgtcgag cacatcttgc ggattgatcg gcgtgatgcc tgggatcagg ttctgctcac    174600
     cgtatccgta gagcgcctga agcgcgaaac ggcaggcata gactttgccg ccctcttcaa    174660
     taatttttgc aatctgcttg ttgcagttca tgtgccctgg aaaggcttca tcacccagac    174720
     gtgggaaacc gcgctgcacg ccaagagtaa cacctggtcc gtacagcaga acggatgttt    174780
     caaagccttt gcggattaga cgtgtggcct gaagcagatt tacaaaccca atcgaacctt    174840
     cattggcgac ggtatgaaaa gtaataagag ctttttcgcc tggtttggct ttgacgtctt    174900
     caaaaacctt gttttcataa ttaacgaagc aatcaccatc ctgatatggt gcatgttcga    174960
     cttttggcat gatatctctc ccgtgtgatg cgatctccag ccagaaaccg gaactgaccg    175020
     ctgtgccgaa gtgaacgtga cacgggataa ccaaatgaca aaatattgta tgtacttaga    175080
     aataagtaca aataaaacaa gtttaacagt ttattgtctt acaaaggcat acagaaacat    175140
     acaaaaataa tattcaagac atacaattcc aaatgacgcg cataactata tgttttatcg    175200
     tcatttttta atcacgcatt cgtgaatgat gcactttttt gtttttcgga cattcaggcg    175260
     agactcaacg aaatcaaatg agtccgttga gtcccaaacc caaaaccatg tcatacaata    175320
     tcggcgaaac cgggagaacg cttatgctga agaacggaca ccacaccatt taaagattct    175380
     tcaagacttg ctgcatctgg tgcgctgcca agcgcgatgc gcgcgcgctg tggtggctca    175440
     ccactaattg taaaaactgt gctggggacc agagcaagac cacgtcggcg tgcataagcg    175500
     acaaagtccg cactgcccca ccaatcaggc aatttcagcc agacatgtgg accgttcgga    175560
     ttcatgcagt gtccttcccc taaaaccttt cgcgcaatgg attgccgcag gcgaagttct    175620
     ttgcggatgg catgaagaat cgtttccgct tgccccgttt gcatccaccg cgcagtaagc    175680
     gcgctcaata aacctgcatt tgtcagagcg atcgcccgaa tggcagctgt cacacgccgg    175740
     gtcatatctg cattcggcaa ggcgacgtag gctgtgcgca ggcctgggct caatgttttg    175800
     gcaagcgtag caatataact gacccgacta tgatccagag ctgccaacgc tggcagtggc    175860
     tcatccatca acaggctgta aggatcgtct tcggcaatgt gcaaatgatg acgctgcgcc    175920
     actgcgagaa tatccttgcg cctttgcagt gacattgtcg ctgtggtggg attatgaatg    175980
     gtgggaatac agtagagtag tcgtggatga tgttgcgaac acactcggtc tagctgatct    176040
     ggcatcatgc cttcagcatc actgtctaca ccaaccagaa taagatcaaa ttgcgctgca    176100
     atggttcgga tccctgggta ggcaatacgg tccgttacaa tcacgtctcc tggttgggta    176160
     tgcgtgctga caattgctgc taatgcgctt tgcgcaccgg gagaaaccag aacttcttct    176220
     atgcgccgat gaccgataac aggtgctatc cattttgcgc caagctgacg ctcctcaata    176280
     gtgcccccag ttaccctgta ggacatgaga ctattcaaat cctgctgctt caagatagcg    176340
     gagatatcac tctgaataat acgctggagc ggtggatcct gaggaatagg cggcagattc    176400
     atggtaagat caaccaccgc aggtccggta tggcgccaat ggctttcacc ggcgccgacg    176460
     cgcacaaagg ttccccgccc tacggttgca tcaatgagac cacgacgcct tgcctcggta    176520
     aatgcacgcg ttacagttgt caggttggta ccaagataat ccgcaatcgt tctttgcggg    176580
     ggaagtttat ccccttcccg caaatcacct ctccggatgg aaagagccaa ggcatcagca    176640
     agtgtcaggt aaatggcatt cgggctttga ctaatttctt ctttccagtg agccagataa    176700
     ggataggctg acatgcgtgg cggcttccat atattcgaca agattgtatt gcactacatc    176760
     ccatacaatc catgcaatgc atagcgcagc cgcttatttg tgagaacaat tatctccaca    176820
     ttgctacgat ttaactcata gcattgtgca caacacgcaa gttcagactt tattgccttg    176880
     tggaaaatct gttttagaac aagtaagaaa aatgaagaaa cttattccgt tgtggctgat    176940
     caatgcttga atatttatat gtctttttag tatcaattat tttttaataa taccttgcac    177000
     gacagcttat gctcgtcctg agcagtcaca cgctgtcagc atcatacgtt ctgatataaa    177060
     tgaacaggtt tacagcatat cttttagaaa aggtggttac gtaagagtgc tcttttgcat    177120
     cccagcatcc caccgaggaa caatcatcat gtttcctggc ggttctggtg atattggcct    177180
     tgggaaaaat ggcgtaatcc gacacgatca taactttgtt gtccgaacac gccggctatg    177240
     gaacagacaa ggttacgcag tcattattcc agatacaatc aatcatatta atctaagagg    177300
     gaaacgcagt tccgcgacct atgcaagtct gatccaaagt atcattgctt ttgcgcatga    177360
     agaggcaaca gttcctgtgt ttctttttgg aaccagccaa ggcgcaatcg ctgccgtaaa    177420
     cggtaccgcg catgcagctt caggaactat tgcaggtgtc gtgctcagtg aatctgtatc    177480
     agtcatggga ggcagcaagg aaactgtttt tagtgcaacc ccgcaaaaag tgacagtacc    177540
     tgttcttatt gtggccaacc aagatgatcg atgcgatgtc gcaccgcctc aagccgccca    177600
     acagattgct tccggcatga cagcaagccc tgaagtgcgc gtgttcatgg tttctggtgg    177660
     aataacaaaa tcaaaaaaga attgtggctc cttaacacct catgggtatt ttggcattga    177720
     aaatgatgtc gtcgacaaag tcagtgcgtg gctggatgcc aaatcccgat aatcttcagg    177780
     ctattgttgt ttgaatctga gaaatcagat gacgtacggc tggtgcaacc tcatctgagc    177840
     gaaaaatggc ggcaatttct gaaacgattg gttctcccac aatatcgcgg aaaacaacgc    177900
     ccggcaaatt gacgacactt cgtaaagcac tgggaataac cgaaatacca ttgccaattg    177960
     agacctgtgt caacacagcc agtaagctcc ctggcgtaga aacaatacgg ggcgtaaatc    178020
     cacctcgact tgcgacctga aatgtgccga aagcctgctc gggcaatata aaagatgcgt    178080
     tggcaatttc gtgcggcgta accgggcctt ccgacttttc ttcgacacca ggaatcacgg    178140
     aaagtgccag gcaaaagtga tcgcggatca atacatggtg actcaatagc tgtggcatcg    178200
     ccataggcag ccttacaaaa ccgatatcta cgtcaccgtc cgcaaccaac tgaggcagtt    178260
     tatccatggg gaattcacgt acttttaaaa gcacgtctgg ataattctgc gtaaattggt    178320
     tcatctggtc ttgcagtatc cccgtataag cagctgacgc aacataacca atctctatcc    178380
     gacccaattc accgcgccca gcacgacgac cggcgttctc cgctgttgca aattgtttga    178440
     gcacgcgccg tgcttcggaa aggaaaacct ctcccgcaga tgtaagcgtc acagaacgct    178500
     ttgttcggtt gagaagttga gctgataatg tgcgctcaat ttcctgtatc tgcacagtca    178560
     gagtgggcgg ggaaatattc agccgttctg ccgcccgtgt aaaatgaagt tcttccgcca    178620
     agaccacaaa atagcggaga tgtctcagtt ccattcctct atccccctcc ccgcattatt    178680
     aggcaaaacc taataataac gaaaataacc accaatgacg agaaccaagg catgacctag    178740
     cgttacagac taatgcgctc tgcaacggaa catcgccatg acacaactct ttcaagccaa    178800
     tcatgatgaa ctgattatcg gaacttctaa tgctatcgtg aagcgatggg gacctcgatg    178860
     acatcctcgc gcgtaaccaa tccgttattt gtccttctgg cggcttcaac tggctgtgcc    178920
     ttgactgtgc ttgataccaa tgtggtggca atcatcctgc caaccattgc tcgcgagttt    178980
     cgtgcaagtt tcgcggatat tgaatgggtt atcagcacat atgttctgtg cttcgcatct    179040
     ctcctgttgc ccgctggagc cattgcagat cggtatggac gccgtcgcat ctatctgatt    179100
     ggaattacga catttgccct tacctcgttg ttttgcggag ccgccccatc tgccacagca    179160
     ctatatctgg cccgtgcttt acagggcgta agtgctgcat ttttgttagc acctgcttta    179220
     gcgatcatcg gacatacgtt tcataatcca gatgaacgga accgcgcatg ggccatttgg    179280
     ggaagtatca tgggccttac catggttctt gctcctatta ttggtggtat tattgcctat    179340
     gcgctcggtt ggcggtgggc gttttatatc aatattccaa tctgcgtcct acttgctggc    179400
     gcagtcttta ttctggtcaa agaatcacgt gatactgatg cccgaagact ggacccggtc    179460
     gggattatat ttttcgctgc attcatgttc ggtctgacgt ggggaatgat taacggtcag    179520
     gcaagcggtt ggacctcatg gaacgccctg aatggtttta ttggaggaag tatctcctta    179580
     ggcattttca tagcatctga acgtgcccaa tcacgtccga tgttagatct tggcctattc    179640
     tccaatcccc gttttctggg agctgtctgg gcgatgtttg cttatgcagc atccgctcag    179700
     gttatggcct caatgcttcc gctatttctc caaaacggct taggccgctc agcacttcag    179760
     gccggcttcg ccatgttgcc ttttgccctg gcaatgttga ttttcccaca tattggacgt    179820
     cttctggaac gccatatctc ttcgagcggt attctagccg gtggtctgtc atgcgtcgcc    179880
     attggcaatg gaataacagc atggggagca tatgtcggat catggatcat tgttatggct    179940
     ggcatggtcg tcattggaag tgggggcggc cttctcaatg gggaaacaca aaaagctatc    180000
     atgagtgttg tgccaaaaga acgatctggc atggcgtcag ggatcagtac gacttcacga    180060
     ttttccggga ttttgcttgg ttttgccatg cttagcggca tactcgcaac aatggtaagg    180120
     aaatgggttg ccgcctttgg atgtggcact ggttgccatc atccatcaga cttcgccgat    180180
     gccatcgttg ccggtgatct acccagtgct atttccggtt tagagggttc caatcaagaa    180240
     atcgccattc agcatgcaca tcatgctttc tcttatggtt ttgccgtagc acttcttgtg    180300
     gcatcaattt tcgcattagg atcatcaatt actgtcttta cactgatgca gtcaaagatg    180360
     aaacagaata taacctgagt aaataataaa tactcaatgt gtaatgatag atattttgca    180420
     gattctctag agcgtttcgt cagttggtac atggctgagt aacgcttgta ctcccacttg    180480
     acctctggtc tttcctccct gttttttggg atcgggagag atgggaatgc gatgatatgg    180540
     tttgagtgag agccagtaag atcggataac tgacgacacg ctctaacact acagttgcat    180600
     tttgtgtcgt gagtgagcgc ggatagcact ggcctgatgc gttcgtcgaa agacggacca    180660
     tctgaggatg tgagagacgg gtagtctgcg ttgtgcaagt tttacgacga ggcgcctgat    180720
     ctcctgaatg gaccagcgga caaggactgt cgtgttctga gttgtgtttt tttcggtttc    180780
     agtgagtttg cctggtaacg gacactggcc atgacggcat aggccagcat gaccagagag    180840
     acatgccgat gccaaccatg ccaggagcgg gtctcgttat gatcaagacc aaattcgttt    180900
     ttggccgtct cgacgcggaa atctcacaga agggttgtac atcgggttag attatgaaaa    180960
     agtctgtttt gtagaaaaga aatttccata atcatcaaga aaacccgatg cagacagagt    181020
     gtagcgcagg cgcgtatgag tttccagcct cctgtggacg gcgtgttgtg gcccgttttg    181080
     acgggggtcg catgagttcg gatgggggcg taattctggt gaagcaggct gatgacattc    181140
     tgggtctcag ccgccgcttt gctgcctgtt ttcgcgataa gcggcatccc ggctttgtgg    181200
     aataccgggt tgaagacctt gtccgtcagc ggatcatggg cctggcactg ggctatgaag    181260
     atctcaatga tcacgatgcc ctgcggcatg acctgatctt tggtctggcc tcgggtcgtc    181320
     tgtcaggagg ccgggcaaac tgcgcagcat tggctggcaa atctacactg aaccggttgg    181380
     agcgcagtgg gcagcaggca gatcgttact gccgcatcat tgctgatcat gaggccctgg    181440
     ctaccctgtt cgtcacgctc ttccttgacc agcatgagca cgcacccgcc cggatcgttc    181500
     tggatgtgga tgccaccgat gaccgtatcc atggccatca ggaaggccgc gcctttcatg    181560
     gatattacgg ccataactgc tatcttcccc tgtatgtctt ctgcggggac catctcctca    181620
     gcgctaccct gcgcacggca gacagggacc cggggaagga agcactggca gacatccgcc    181680
     ggatcgtgga gcagatcagg agccgttggc cccgggtgcg tatcctggtg cgtggggaca    181740
     gcggtttcgc ccgggacagt ctgatgacat ggtgcgaaga caaccacgtt gacttcctgt    181800
     tcgggcttgc aggcaacacc cgcctgtatg accggattgc ctctttgtcc gctgaggttc    181860
     gtgacgaagc cgccacgaca ggcagagctg cgcgcggttt cgcctccttt gactggatca    181920
     caaaggacag ctggacgcgc cgcaggcggg tcgtggccaa ggccgaatgg cgccacggca    181980
     accgctatca tcgcttcatt gtcaccaccc taccgcaggg aatgtccgac ccccgccatc    182040
     tctacgaaca gatttactgc gcacgcgggg atatggaaaa ccgcatcaag gaatgccaga    182100
     tggatctgtt ctcagacagg acctcgtccc acaccatccg ggccaaccag ctccggctgt    182160
     ggttctcggc cgcagcctat gtcctgctga ccgctctgca aagactggcc cttggccaga    182220
     ccagcctgga gacggcgacc tgtggcacca tacgcgcacg gctgctcaaa atcgcgacac    182280
     gtgtaacgct cagcgtccgt cggattgtcc tgtccatgcc ggacatgttc ccctgtcagc    182340
     atgaattcgc cctcgctcat gcacgattgc gaaggctccg gcaggccatc tgaagaaaca    182400
     gacagtgcac agaccacata gcttccacca acactgcctt ctcaggccgt gacaccctca    182460
     ctgcgttcag aacccgccgc cagaagcaca atatcgtcaa tattccagat cgggctcctg    182520
     tggtatgact gaattctaca aaatgacccg aaattgcctc aagtgtgaga aatccgcgtc    182580
     gaacccttct tcgacgcgga aatctcacag aagggttgta catcgggtta gattatgaaa    182640
     aagtctgttt tgtagaaaag aaatttccat aatcatcaag aaaacccgat gcagacagag    182700
     tgtagcgcag gcgcgtatga gtttccagcc tcctgtggac ggcgtgttgt ggcccgtttt    182760
     gacgggggtc gcatgagttc ggatgggggc gtcattgtgg tgaagcaggc tgatgacatt    182820
     ctgggtctca gccgccgctt tgctgcctgt tttcgcgata agcggcatcc cggctttgtg    182880
     gaataccggg ttgaagacct tgtccgtcag cggatcatgg gcctggcact gggctatgaa    182940
     gatctcaatg atcacgatgc cctgcggcat gacctgatct ttggtctggc ctcgggccgt    183000
     ctgtcaggag gccgagcaaa ctgcgcagca ttggctggca aatctacact gaaccggttg    183060
     gagcgcagtg ggcacaaggc agatcgttac tgtcggatca ttgctgatca tgaggccctg    183120
     gctaccctgt tcgtcacgct cttccttgac cagcatgagc acgcacccgc ccggatcgtt    183180
     ctggatgtgg atgccaccga tgaccgtatc catggccatc aggaaggccg cgcctttcat    183240
     ggatattacg gccataactg ctatcttccc ctgtatgtct tctgcgggga ccatctcctc    183300
     agcgctaccc tgcgcacggc agacagggac ccggggaagg aagcactggc agacatccgc    183360
     cggatcgtgg agcagatcag gagccgttgg ccccgggtgc gtatcctggt gcgtggggac    183420
     agcggtttcg cccgggacag tctgatgaca tggtgcgaag acaaccacgt tgacttcctg    183480
     ttcgggcttg caggcaacac ccgcctgtat gaccggattg cctctttgtc cgctgaggtt    183540
     cgtgacgaag ccgccacgac aggcagagct gcgcgcggtt tcgcctcctt tgactggatc    183600
     acaaaggaca gctggacgcg ccgcaggcgg gtcgtggcca aggccgaatg gcgccacggc    183660
     aaccgctatc atcgcttcat tgtcaccacc ctaccgcagg gaatgtccga cccccgccat    183720
     ctctacgaac agatttactg cgcacgcggg gatatggaaa accgcatcaa ggaatgccag    183780
     atggatctgt tctcagacag gacctcgtcc cacaccatcc gggccaacca gctccggctg    183840
     tggttctcgg ccgcagccta tgtcctgctg accgctctgc aaagactggc ccttggccag    183900
     accagcctgg agacggcgac ctgtggcacc atacgcgcac gactgctcaa aatcgcgaca    183960
     cgtgtaacgc tcagcgtccg tcggattgtc ctgtccatgc cggacatgtt cccctgtcag    184020
     catgaattcg ccctcgctca tgcacgattg cgaaggctcc ggcaggccat ctgaagaaac    184080
     agacagtgca cagaccacat agcttccacc aacactgcct tctcaggccg tgacaccctc    184140
     actgcgttca gaacccgccg ccagaagcac aatatcgtca atattccaga tcgggctcct    184200
     gtgggatgac tgaattctac aaaataaccc gaaattgcct caagtgtgag aaatccgcgc    184260
     ggaaggcttc atcggattgt cggtcatccg ggcgggcggc aagagagagc agtgcaagag    184320
     catctttaac tgccacacgt tggtagaacc caacatctcc tacaatttca taaggaacac    184380
     gggcctggat cagagcttct tcaatggcac ggctgagcct gttctgtcgg taaataacgg    184440
     ctatatcatg ccaggcgcac ccagaggctg cacgtctacc aatttcagcg gcaatcgcat    184500
     cagcctcttc gctcatatag gaaaactgca gcatctcaac gggttgacct gcccctttgc    184560
     gcgtatagag cgttttggga atgcgcgatt gatcctgagc gatgattgca ttcgatgcat    184620
     caagtatatg acctgtcgat cggaagtttt cttccagttt aaatgtctgc gcgtctggaa    184680
     attcttttga aaacccccgg ataaatccta ttttcgctcc acgccaggaa tttatgtgga    184740
     atgcaatttc acaacctcaa aaaagcaatt ttaaggtttc tttaggcggg atagatgacc    184800
     tgtacctgac gtacccacca gccagtctct cagttttgac caacgtagcc ttccgccctg    184860
     atttcgcaca gctatggcca gagccttctt ctgcccgacc agcacgacga gcttccgccc    184920
     ccgtgtaaca ccggtataaa gcaggttccg cgccagcatc gtataatgct gcgtcaccag    184980
     cgggatgacc actaccggat attccgagcc ctggctcttg tgaatggtcg tcgcgtaggc    185040
     cagcaccagt tcgtccaact cgccgaagcc gtaaacgacc tcccgtccat cgaataagac    185100
     cgtcagttcg ccctcttcca catcgatctt gtcgataacg ccgagatccc cgttgaagac    185160
     gtcccggtca taatcgttgg cgatctgcat caccttgtcg ccgggaccgt aggtccagcc    185220
     gaaccgctcg accttcacgt cgcctgccgg gttcagcgcc tgctgcaact cgatattcag    185280
     cgaccgtgcg cccagcccac ctcggttcat cgggcagagc acctgcacgt cgcggaccgg    185340
     gtccagcccg aaccgcgccg ggatgcggtc cttcaccacg gccagcaact tgcgcagtcc    185400
     gacctcgggc tcagccgcct ccacgaaata gaaatccgat ccctcttccg cgctcagctc    185460
     cggcatcttc ccttcgttga tccggtgcgc gttggtgatg atccggctct gtgccgcctg    185520
     gcggaacacc tcggtcaggc gcaccacagg gacagcatcg gagccaatga tatcggccag    185580
     cacctgcccc ggtccgacag aaggcaactg gtccacgtcg ccgacgatca gcagagacgc    185640
     gctgtcaggt aacgcgcgca gcagggagcg catcagcagc acgtcgacca tgctggcctc    185700
     gtccacaacc agcaggtcgc aggtcagcgg gttggtatcg tcccgtttga aactgccatt    185760
     gcccggatcc gtctccagca gtctatggat ggtcttgcct tccagccccg tgctttccga    185820
     caggcgcttc gccgcccggc cggtcggcgc gcaaagttgc acgtctgtgc ccttggcagt    185880
     cacgatcttc agaatggcgt tgaccagcgt ggtcttgccc acgccaggac cacccgtgat    185940
     caccagcacc ttgctacgca gtgcaaggcg caccgcttcc tgctggctgg gcgccatggc    186000
     aagtccggtc ttgccttcca cccaagtcat ggccttttca gcatcgatct ccggccaggg    186060
     cggccgaccc acggcgcagg cgcgcaatcg ctcggcgatg ctctgctccg cgcgatagag    186120
     accagccaag aaaatgcaac tcgtctctcc cacgctatca gcgaccacgt ctcccgcttc    186180
     cagctccagc gcgagggctg tttcgatcag aggggcggcg acctccagca gttcggcggt    186240
     gctggtcagg agttcaccga ccgggaggcc gcaatgccct tcatccatcg cctcaccaag    186300
     ggcataggag atcccggccc tcacccggat catggcatca ggcgcgatcc ccatcttccg    186360
     ggcgatctgg tcggcggttt tgaagccgat gccccggatg tccttcgcca accgataggg    186420
     gttctcgctg atcagtctga ccgcatcctg cccgtaggtc ttgaagatcc gtaccgcccg    186480
     cgacgtgccg acgccgttgc tgtgcaggaa cagcatgatc tcgcggatca ccttctggtc    186540
     tgcccagcca ccgacaatcc gttcggcccg cttgggacca atgcctgtca cttcccgcag    186600
     gcgatgcggt tcctgctcga tcaggtcgaa cacggcctcg ccgaacgctt tcaccagttt    186660
     tttggcatag acgggaccaa tgccccggat catgcccgag ccgagatagc gctctatgcc    186720
     ttcgaccgtg gtcggcggac tggccttgag gaactccgcc ttgaactgca agccgtgggt    186780
     gtggtcgttg aaccagcgcc ccgacatctg cacgaactca cccgccgaga tcatggcggc    186840
     atggccgacg acagtgacca gatcgcgctg cccccgcacc ttcacccgca ggacgcagaa    186900
     accgttctcg gcattgtgga acgtcacccg ctccacgagg ccggccagcg cttccgtttg    186960
     gcattgttct ccaaccacgg cactggtcat tctgattctg tgaacggaga agacacttgg    187020
     gaaccgcatg ttgccgaaat ttcgccaggc gttcggccat ccagcgctgg cttatctcga    187080
     agcttgttta acattccctc caatgcttca acgtctccgg agacggcatc ccgttcctct    187140
     gggcttaacc agacctcttc cagtaaacga ttggcggctt gctgagcggc caggacaacg    187200
     cccttggcgc ttggcttcgg aatattgaaa taacagcgtg cgcatgccat gcgatgcgga    187260
     caagtgctcc aaaacgcatt gctacagtaa gaatcaccta aatcgtaata cttccagggt    187320
     gctccatctt tcgttgcgcc tgccgcaata acctcattat caataacaat ttcgatcatc    187380
     cgcgccgcct gatccgcctt ggcaaacgca ctcgccaatt gcgtaggttt cgaccgaaca    187440
     tagctcatcg tcgattgaac ggacgtatgg ccgcaccatt ttgccaaatc gaatattgtc    187500
     attccttgcg gaacactggc cagcatagaa acggctgaag cccgtccacg gtgacttgta    187560
     atacggcctt tactgtcctc aatcggaata ccagcctttt tgcacaaaag cgggataaca    187620
     gtctgattta aaacttcctt cgcgattggc ctgtttcgaa gttgaaagag aaaatgcaca    187680
     tgttcaccgg ttctccgatc aagatgtttg cggggtgacg cacgtttttt catccaggcc    187740
     gtaatgtact tatgaacagc atggccgacc ggtttggtat acgcaaccga agttttgcct    187800
     tccggaacat caagccagca gacctgccct gccggaacga cgttgccaga ctgatcaacc    187860
     acatcctctg attgctcacg cgtgcaaccg accctaagcc gggcgatctc attgctccga    187920
     aggcctgcat gtgtccacac cacggcgatt gcctgcaaca aggcgaatgg atagaaacag    187980
     tcaggagaaa ggtcgtctgg ttcgatgttg aggctggccc aggtcagttt cagccaagaa    188040
     gcatcatcta tggtcctagg atttacgcca agatatttcg caatattctt cggtgtcgag    188100
     agatgatatc gcggattaca cctgagccgc gcccattccc aactctgaat atcagataaa    188160
     aaccggcgca taacctgata ataagcaact ttcgttggag cctgcagagg ctggccaact    188220
     gttgggatca gacgataatc aaaggtggaa ccgccccaat cgccaacacg taacctgtcg    188280
     acggcggcga gatagtcggc acataccgat accgtccatt gctctggtcc agtgacctca    188340
     gggtgctcgc gacccaacca gattccgata cgggttagag tgttgtaaac tgctcgcctc    188400
     gacccttctc gcaacgttgt tgtttccaac caacgtcggc accatgtcat ccactcagga    188460
     ttgatattat cagtttcagt tccgtgacga ggtggatatg cccgaaaatg gataaccttt    188520
     gatgttaatc ccattgccgc caaaccgttt gacaatattc caatccgctt ggcgatatga    188580
     tttcctgtgt aacactctcg tgtatgttcc agtatcttcc tatcaaaact ttcaagtttt    188640
     ggattctcgc cttgtaatgc aactgcagca aatactgatg gtacgagggg ccgaacggtc    188700
     tgacagacga agccgacacg ggttagggcc gagaacagac gctcacattc tgtatcaaca    188760
     atctccgctc caaaaaccaa tcgggcaacg acagccgtcg ccacattgcg ttgaattttg    188820
     tacacgcttc gaaaaccaca cagaagataa gcgactgcaa tcaactgcgg taccattccg    188880
     gtttttttca gaacaggact attattgata atctcaaccc acaggtcttc actccacccc    188940
     cagtagggtt tttcctggtg tgcgaccgtc agaagcaaat acttcaaagc acgatggctg    189000
     ttagcgcggt cgagattgct gcgatacagg atgtccgtca gaggcttatg aagacgcgga    189060
     gcctgccgtt tcgtaataac aagattttct tctttccaac gtctgacaac ttttaattcg    189120
     tctgcagaca atgtcgcccg tctgtcgtat tcatcgagat taatgtggaa tttgtattcg    189180
     ggctggatgt gagaaacctg agattctacc acttttctat cctccgaaga ccctgtgacc    189240
     aagcttcata tccatctgtt cgactgagtt tgcgatcttg cgaagcagat cttcaccgga    189300
     aagatggata tagagtgtcg tgctttgaac attgcgatgc ccggcatacg tcgcaatatc    189360
     gtgtagacgc cagccagcac gggccagatg cgtcaatctc aggtgacgca aagtgtgcgt    189420
     actgaacaat ggcatatcag cctggagagc aagacgtctg acagttttgc tccatgacca    189480
     cttcgtaata ggctgccgaa agttccgatc tgactcagag agaaacaggg ccgctgaatg    189540
     agtcgctgcg ttgcgccttt gatgcagata taccgccaac acaggacaga gcgccgctga    189600
     ataacaaacc acacgagggc gagcgctttt acttgtttcg gcccgaatgg tgagcaaacg    189660
     tctcgcaggg tcgatatccg agacgcgcaa atttactacg gcgtgtcgtc agttaagccc    189720
     tgagagtggc acgtgagggt tgtactttgt gtctgcgtgt gctgactgtt ttcccatttt    189780
     ttggggagac agacagatgc ggcgctatag tttacgcgat gaccagtggg agcggataaa    189840
     ggatcttctt cctggtcgag aaggctatgt cggcggcact gcggtgaaca accgtctgtt    189900
     cgtggaggcg gtgctgtatc gctatcgcgc gggtattcca tggcgcgacc ttcctgcccg    189960
     tttcggtgac tggaaaaacg tgcaccggcg tctgcgccgc tggtgtgaaa gcggcgtcat    190020
     cgaacggata tttcgttatc tggccgctga ttacgacaac gaatacatga tgatcgacag    190080
     cacaattgtc cgagcgcatc agcatagtgc cggagctctc aaaaaagggg cacggatcag    190140
     gccatcggac gatcacgggc gggctaacta caaagatcca tgccatctgc gacgctctgg    190200
     gcaatccagt ggaactcggc atcacaccgg gacaggatgc cgatatcacc caggcagaac    190260
     cacttctgga aaacatcgaa ccggatgctt tccttgctga caaggcgtat gacgcggaca    190320
     ggttgatcga tcggctgata cagcgcggga ttaccccggt catcccgcca aaacgcaaca    190380
     gaacgacacg acgggtaatc cccccataaa aagagtgact tttgaatgag aattttctca    190440
     gcgtaagaat tgaggagatt ctgatgaaga gtgatcgctt tagtgacgcc cagatcatgg    190500
     gtgtgatccg ccaggctgag ggcggtgtcc cggttcctga cctgtgccgg gagcatggga    190560
     tcagcaacgc cacgttttac cggtggcgcg cgaaatatgg cggcatggat gcttcgatga    190620
     tcagtcagat gaaggctttg gaagaggaga accgtcggct gaagcgcatg tatgcggatt    190680
     tgagcatgca gacggatatc ctgaaggaag cccttggaaa aaaatgaagc ggccagccca    190740
     gcgccgggaa ctggccgcac aggctgtggc gcatcatggg gtcagcattg cgctggcctg    190800
     tcggattttt gggatatccg agacctgctt tcgctatcgt ccgcgactgg cagcggagaa    190860
     tgacaggatt gccgctcttc tggtgggact gacccaggct cacaggagat ggggatttgg    190920
     tctgtgtttc ctgtatctgc gcaatgtgca gggacagctc tggaatcata agcgggttta    190980
     tcggatctat cgggaactgg agttcaacct gcggattaaa ccccgcaggc gtctggttcg    191040
     cgaaaagcct gaaaagctgt cggttccggc ccttcccaac acggtctggt ccatggattt    191100
     catggcggac aggcttttgg atggacgcgc ttttcggctc ctgaacatcc tggatgagtt    191160
     caatcgtgaa ggactggcga tcgaggttga tttttccctg ccggcctgtc gggttgtccg    191220
     ctggtaatcc ccccattttt agtggggcat tgaatgagaa ttcaggcagc tgtttttagt    191280
     ttctgggcgg gggttagccc gctgttcccc atgttgggtc tgtcattgtt atatgtccag    191340
     agccattgtg ttgcgacctc ctgtacgtcc tgaatgcttt caaacaaata ctgctctagc    191400
     cattcctgcc ggacagttct gttgtagcgt tcaatatagg cgttctgctg cggattgccc    191460
     ggttgtgtat agatcagggt aatcccctgc ttttcggccc atgaaaccaa cgtatgactg    191520
     acatattcag ggccattgtc cattcggata gcctctggcc tgccacgcca ctccataacc    191580
     tgttccagac agcgaacaac ccgacaggct ggcagggaaa aatcaacctc aatcgccagt    191640
     ccttcacgat tgaaatcatc cagaatgttc aggagccgaa aagcacgtcc atccatcagc    191700
     ctgtccgcca taaaatccat ggaccagacc ctgttgggaa gggccggaac cgacagcttt    191760
     tcaggctttt cgcgaaccag acgcctgcgg ggtttaatc                           191799
//