Dbfetch

ID   AP006620; SV 1; circular; genomic DNA; STD; PRO; 87093 BP.
XX
AC   AP006620;
XX
PR   Project:PRJNA13117;
XX
DT   10-OCT-2004 (Rel. 81, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 9)
XX
DE   Nocardia farcinica IFM 10152 plasmid pNF2 DNA, complete sequence.
XX
KW   .
XX
OS   Nocardia farcinica IFM 10152
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
OG   Plasmid pNF2
XX
RN   [1]
RP   1-87093
RA   Hattori M., Ishikawa J., Yamashita A.;
RT   ;
RL   Submitted (26-SEP-2003) to the INSDC.
RL   Contact:Jun Ishikawa National Institute of Infectious Diseases; Toyama
RL   1-23-1, Shinjuku, Tokyo 162-8640, Japan
XX
RN   [2]
RX   DOI; 10.1073/pnas.0406410101.
RX   PUBMED; 15466710.
RA   Ishikawa J., Yamashita A., Mikami Y., Hoshino Y., Kurita H., Hotta K.,
RA   Shiba T., Hattori M.;
RT   "The complete genomic sequence of Nocardia farcinica IFM 10152";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(41):14925-14930(2004).
XX
DR   MD5; 137be907f1cd58afc2f0f1a97197c3b6.
DR   BioSample; SAMD00061069.
DR   EuropePMC; PMC522048; 15466710.
DR   RFAM; RF01734; crcB.
DR   PubMed; 15466710.
XX
CC   This work was done in collaboration with Jun Ishikawa, Yasutaka
CC   Hoshino, Haruyo Kurita, Kunimoto Hotta (National Institute of
CC   Infectious Diseases) and Yuzuru Mikami (Research Center for
CC   Pathogenic Fungi and Microbial Toxicoses, Chiba University), and
CC   supported by the Research for the Future Program of the Japan
CC   Society for the Promotion of Science.
CC   The genomic sequence assembly and annotation was carried out by
CC   Jun Ishikawa (jun@nih.go.jp). The complete and fully annotated
CC   genomic sequence is also available at http://nocardia.nih.go.jp/.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..87093
FT                   /organism="Nocardia farcinica IFM 10152"
FT                   /plasmid="pNF2"
FT                   /strain="IFM 10152"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:247156"
FT   CDS             1..705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="PNF2_10"
FT                   /old_locus_tag="pnf210"
FT                   /product="putative partitioning protein parA"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_10"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60686"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60686.1"
FT                   /translation="MATDGVLRLLFSTLKGGPGKTTSAILTAIALSRRGLTVVVICADT
FT                   RTRGATDWVQEAERVGDVVPFRLAIWHESDGPLSQYARGVERSTGADVVIIDTGGEQPE
FT                   NFTHGCLYADWLIAPVGPFRAELRRLVPTYQSAAAVDESGSPLEISVLLTRCPAAHKGK
FT                   AKEAREQLTSNLVGEDGQLDPEVPYALGLDVLNTEISRGVAYDEFYGLMPEDVGEYDAL
FT                   ANEILDRRSRTS"
FT   CDS             705..1625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="PNF2_20"
FT                   /old_locus_tag="pnf220"
FT                   /product="putative chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_20"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60687"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60687.1"
FT                   /translation="MPAPERPKRPRSRSVASGLPSTAHSDTAARVSAILAETASATIAA
FT                   PDLQTSAPLSAFAHRPDNPRWAREYDPQADPELEAFAATVEEYGILQAVTVCSAEAWLE
FT                   HHPDDAFGAEVRYVVLMGNRRLAIARYKKIGQLPFHRNDRLADPRLSRESGIIENYHRK
FT                   PLDPVREAGEMAAVLAHTGESRRAFADRIGISHSQVNQRLQLLDLIPEFQGLVSDLALP
FT                   VHKALKVAALPHLDQAALLEMGPPYDPARLTDQTQPPEPESGKTLSTTKPVRIPPHSTP
FT                   DDVVEQLRKQLDPQLLDEVVRLLTK"
FT   CDS             complement(1671..3539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_30"
FT                   /old_locus_tag="pnf230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_30"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60688"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60688.1"
FT                   /translation="MPPAQPGDGRELVWSVLAPAIAGYPAIRVIDPATNTTVRTRSRIP
FT                   ARPPAQPAAVPVYDRAARTDKLVLDLDAKAHGPVAVARDAARARAWLEACGARVVSDRN
FT                   PGNGGRHLLAFFAAGETYSRADVEPVLRRLADRLPTLDLTPMLNARTGSITPPGSATRD
FT                   GHFRVLDGSLEDALAAVRQRSEPGLLERLRAFLGPGAPEAVPTPAAPLPATASASADLW
FT                   EGAGADARLRAPWQCRTPVPAAVLAFAETGALPADGRWPSRSEARAAVLAATALRGWSL
FT                   TDVRAHLTAWPGMAQAYARYRDPERALSQDWDRICTRWVAPHAHLFRSSEHREPGLTPP
FT                   RVSQRSNTPISATSHREWLARAYAWTFATWPGQSYRWTVLAVLDALAYAAAVTREPAAG
FT                   ATAPVAAVGVRSLASFAGLLSVGTVADVLADLRDRPGSPVLRVRRAAGTLADAYALVTP
FT                   RRGEDLDREVDPVPLERVQVRQVHDAWRVLGLHARYLYELVESGLTRTQDVIAAAGLAR
FT                   STAYDSLAVLAQAGLITRGRGTVTLGPTTLDDIAARHGLHHLRTETLARHRAQRAAWHA
FT                   WLEMRWHLTDEPPTDPPSIPLAPWDTDDELHEAIWATQMATGPPEP"
FT   CDS             complement(3731..3919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_40"
FT                   /old_locus_tag="pnf240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_40"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60689.1"
FT                   /translation="MTARRGKPQLVEIDADLLAAVKAEAKRRQMTYRAFFESALSRELE
FT                   VSRRIEVVEAEQLKIAG"
FT   CDS             complement(3953..4648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_50"
FT                   /old_locus_tag="pnf250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_50"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60690"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60690.1"
FT                   /translation="MPTDWEWEWLVQHDDPQPLELPKAAQNDPRVRAGAARHGGPGVAR
FT                   TVALQRARGEYVRNLDADDVLPSTALADAIEILTQHPEIGWTTCRVLDLMPDGTLKEFP
FT                   GDPADGPIPIGSVAEYWRAHDWRLHVHPTTITIRRDLLLAIGGWMALPISEDTGMMLTA
FT                   NAFAAGWFIHRVGLYYRQHPDQITKADPNASDRAERMAMIDQRLRAIEALRRNTAGTQI
FT                   VCSPARRVG"
FT   CDS             complement(4726..5604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_60"
FT                   /old_locus_tag="pnf260"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_60"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60691"
FT                   /db_xref="GOA:Q5YMA0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60691.1"
FT                   /translation="MFGSNKNNGGIVTAKPESGQRLAVTNQEVSVSSANPAWVDIAAGL
FT                   RSRVAAGEWRPGEQLPSMRRLADEYGVGSHAPVNRAIMVLVSEGILTTDPAAPRRGVRV
FT                   RSTQVLTRDLFGNSVLPLTFEDETGADGVEVTVTYDWVEATADLATSLQVSEGTELLAR
FT                   TFRYTLDGTPHQVAREYMRADLARECGLTGPDAEVPGRNTAMWLERAGIHLHREHLVLL
FT                   TRNPTAEERDALAVPIGVPVYEKTLTTYDESDSPLDTRRILVVADRIIYTADRVHPRRT
FT                   DSADPAGADQC"
FT   CDS             5682..5945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_70"
FT                   /old_locus_tag="pnf270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_70"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60692.1"
FT                   /translation="MSEGVFRLSFVPERLVSAAQAVAGLQLAEIVAQWDQLLWVETPNT
FT                   AMVWRLMAGQAQGLDLDVLDAVIRIEQSEWPTSATEWAAWLR"
FT   CDS             5942..6253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_80"
FT                   /old_locus_tag="pnf280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_80"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60693"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60693.1"
FT                   /translation="MRIPEVWTLEIWRRAASPAIPVVRVVEGHMVSEATEHHADYVGQG
FT                   WWVVDFLPGRQLSEEQARAAMRIAVAPQQLEVERWAAKLGLTAAEARAFVAMPVGVAR"
FT   CDS             6250..6513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_90"
FT                   /old_locus_tag="pnf290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_90"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60694"
FT                   /db_xref="GOA:Q5YM97"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60694.1"
FT                   /translation="MTRERVVDVVVPIVPDTGGRGLGVVSAMALLVAGVVLAGLAVMVI
FT                   VLLSFPSREYSTVPVTRQFGPCEPFCSLRTTTAPAPVGGEQR"
FT   CDS             6513..6836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_100"
FT                   /old_locus_tag="pnf2100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_100"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60695"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60695.1"
FT                   /translation="MRSYPDPAYRRDRACAGVDQDVFFPAPSGQQSRRIAPARALCAAC
FT                   PVLAECAGWAEPLARAGELTGCVVAGVYLPSHHNTARRLRDAAADELVVIAATGRLDVE
FT                   GAA"
FT   CDS             6836..7102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_110"
FT                   /old_locus_tag="pnf2110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_110"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60696.1"
FT                   /translation="MAASETAGVVRVFQLHRDRDVTGYSGTGVVADGVIWPDGAVSMRW
FT                   RGPVRTTVEAACLADIQTIHGHDGATRVVLGAVITGGAAWTAA"
FT   CDS             7099..8997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_120"
FT                   /old_locus_tag="pnf2120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_120"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60697"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60697.1"
FT                   /translation="MKAPGQNGFSEWAPVLVPGAVGGVIEAAGVSLRVGDYLYADTPQT
FT                   DVPWNPLALGIHLATGQLEWTGAATGGAVTLAAGTAVTVAGSMWAWRATCRQCRKLADK
FT                   RGQVSRLARGKAFGRSGIRKEAIDSQARYMARGKELADLSREAILGKARDLQVQLRAGD
FT                   APGVLIGRAVADGRELYASYEDLHLDIWGPRSGKSTSRVIPAVMEAPGAVVATSNKRDV
FT                   VDATRGARGEQGQVWVFDPQGVASEPCTWYWDPIAWVLGEDGGAGAQERAAELAGHFAA
FT                   GGEADKRDAFFDPEGEDLLAGLILAAAVDKKPITQVFEWVTSAHEDAPVRILRDAGFGL
FT                   VAGALADQYQAPEKQRGGVFSTAKKMAACLKYARIQPWVCPPAKGDAPRKAFDAAQFVR
FT                   SRDTLYPLSKEGKGSAGPLVTALCAAIAAAGEAEGTRHLGGRLPVPLLIVLDEAANIVR
FT                   WADLPKQYSHFGSRGMVVMTILQSWAQGVRCWGHEGMTALWSAANVKVLGAGLDDAAFL
FT                   RDRSELIGPHYELTTSTSRSHGQNGSRSTSTSRTSEVTLHASDLAALPKGRVVIFISGH
FT                   RPTLGQAVPWMQRPYAAQVRAALDRAARATHPQPSEVRPHLRAVPAYPDELEGKSA"
FT   CDS             8994..9776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_130"
FT                   /old_locus_tag="pnf2130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_130"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60698"
FT                   /db_xref="InterPro:IPR032584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60698.1"
FT                   /translation="MSDTTFEFDNTAEGDDGVTAMPALVIPQMDLGQLLDEAIRKAVSG
FT                   QLAAEAKKIAAGVVGELLTPEVVAGMRETAVLEAVRALDPSPEASLPGEQDPGAAEDDA
FT                   EEDAPPPLEYRTLDAFVRDYLAMMYRREVVEPGSAKHARWCPRWWEHGEAIGRLEALWR
FT                   AFEEARHGEGSEMSTWWLQHADPMMTELLSPTGPFKYCSVQQGHHERLARLPLVPAPEG
FT                   MFEDGHAHDPAPAVLVASSLTLPAPTHPRRRTVMEFPE"
FT   CDS             9773..12784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_140"
FT                   /old_locus_tag="pnf2140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_140"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60699"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60699.1"
FT                   /translation="MSAPARPQRTAAPMQGSWETITSALETAVGPGRPSGAWTKYCCPV
FT                   HEGDGRGHKPSLGVKYDDAGQRTVVRCFAGCDNEQVLDVLGLRVRDMFDRRVEREGSGR
FT                   GRRANRPRSRQLSRADRAIDAAGLPLTQPKKPDPGRQLSPWRTVATYPYLRADGTVAGE
FT                   VVRKEARFEHTGRDKQFHQRRWNPENGRMEAGGFDPLPYQLPQLLEAIDEGRTVYIVEG
FT                   EKDVAAAESAGLTATTNAGGALSWTPRHAEWLRGARTVVIVADRDPAGYRRAERVMATL
FT                   SGLVERVRVVQAATGKDLHDHLQCGHEIADLEPIPYLDPFVSAPPPTTAPGRPASSTET
FT                   STDVSDSAENTTPGGHSDMAEYLLAPSTDTPPPQSDEVDHAGQQMAALWRALVHQLLSH
FT                   ALKVAEQRRRDAEELARRTAVEKAEAEERLALERKSVETKLAALRKQGWDAASRDEIAD
FT                   ALTQARAWAPDSEQAAATFDELRHHLQDRFGLRIDPRTDAVDIDPDAAAVVTHLADFER
FT                   SRAIDARLVAAQARMVEAVGALDGIDESTKQALYADIEAWRTNPSPQQLDVLATKLAAA
FT                   KVPERTRTQIRFTAVYLYDAGAQLTADEHAERGRQAPTTLATHILRQTEAPLVDPGEEA
FT                   KPRIDALLVSYQDRLRTGADTSWVIEKLGREVAVLTEEDRTAARERGKQIRHNPAGKFA
FT                   PLWPDHVDRDALAVTVSTYATLRPQADRAVVATGDYNTAQAAGLRQQADKHRNAIVKAI
FT                   KTGKGLHDLERDQLAAVLRDIDAGRTRPPAMLFVDDRSAAQHDADRAGQIASETSRIHR
FT                   RQLDEILSTARVDPVSARATRDEITRVMDAQTALAAGRQNLHDYGESGVEDRLQAAMTA
FT                   VGIPEPVRNQVRNHLDRAAGEAAIAGKQANRIRDRWLDRHEAVTTARSPQPAGAIDYDS
FT                   PQRREGLETRLRASGLSEDCIAQRMAADTGHAKPPSAAPAAGMAKRRTSPGTGMQRIHH
FT                   RRGKGRGPEQGLGR"
FT   CDS             12921..14978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_150"
FT                   /old_locus_tag="pnf2150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_150"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60700.1"
FT                   /translation="MVGKRRGRRLIAYLFDVGRARPKRTPSPAQLAAIEKATREHQARA
FT                   AARRGYTRTDLTTLTDPGPGWDETTTHQEEPTMPNTDTNTGTVPIVEGGPGAPTRLTPS
FT                   GRGQRLAFLRTVAAVNQAKYHREQLDQLVVEAENAGRSEDFGRRLAQQLAEAEDQLAAE
FT                   DPWRNPHALTHALAEALYWSPGSDLAAARVQQIGEQLAHRWGVVLDGVDPETCTVGIDP
FT                   AFDAAAAQLAVDRAVVRARERAVAETLSQIPMPEPSQDRVVAAVTAWYDAEGAGTATPH
FT                   DSDALAARLEELHGDLSALDLAQPERDQVRFTVDYLWRDVGQVDLLDTPVMVDPGQEVR
FT                   GRVPQLLQAFAEQRIAPAEIGAEISVMTVADQQAVREAGRAIRAGDEVDVRLWPGYADR
FT                   DQLREQLETYARDAVEAGREADYLAETDLAPFDAALVGINDDIEDRIERMSLSHDQLLA
FT                   AAEAAKGLAPAERHQIRAVLADVEAGVAEDYELPELMWVDERSKAQLDTDRSHRQGAVL
FT                   AQTFCREAMQAIADGKAQPSNAHTQTLEGVLSTVGDNLYSVASGSVDDAHRTQFVKDRT
FT                   ALGRALTAAGVYAETKADIRELVDTRARQAGKLGRGAVEREQRWKTRTAEILARRDDAI
FT                   AQRRAANASVAPSARICTTRPDRATGQSTATALPSYTVGVQQKHSREVER"
FT   CDS             14975..15283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_160"
FT                   /old_locus_tag="pnf2160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_160"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60701"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60701.1"
FT                   /translation="MTDADLVELLVIARIDTTTAVADLFSCQTYYDADTGTETGPAVEA
FT                   MWETLTVDPAAPVCLDSLDQALTTSGYRRTSAWRKRVTAAGATRYFAHATIAIPDLP"
FT   CDS             15593..16186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_170"
FT                   /old_locus_tag="pnf2170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_170"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60702"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60702.1"
FT                   /translation="MQVAGSDAAGEQLYEWNQLASGAWHETLGSFEIVLRNALDAQLIS
FT                   YHQRIRKGNGDWYADPKMPWGTGTRLAQSIRKARSRATLNKTIPEVHGKVIAELNFGFW
FT                   RYTLAGTYQSTLWAQAYRHAFPHLRPRSRTAVYDPIVELHELRNRVAHHEPIHGVDHTA
FT                   RLNDLLQVLAWIDPAAAAWVEDTTRIPAVLGSRP"
FT   CDS             complement(16207..16635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_180"
FT                   /old_locus_tag="pnf2180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_180"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60703"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60703.1"
FT                   /translation="MECFVKNCHSPAAGTKDLDPQRIGGWSSYPYEVALCEPHSAAIDA
FT                   GVDWVCRDQEDGSSGWLVLVGDQIKSLEKYTVKSVGAITSGSVNWRSNGVLPSGMHIPI
FT                   EVQQVGNREPSTIGLYIDPDQARRLIDILKLHIRTQER"
FT   CDS             16656..17633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_190"
FT                   /old_locus_tag="pnf2190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_190"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60704"
FT                   /db_xref="GOA:Q5YM87"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60704.1"
FT                   /translation="MCAGTHRHAETSKICSRCRHPGVDFRLDRCGSSSAVIGQVVGIHC
FT                   DTRCSVGRFAKGVGGEVAQRRPWIKRKVGQARLWVWMPYEGGSNREWILGELGRRVRPE
FT                   WNKQDRRWEIARRHLWVLAEAMAQRFGEVDLFMEFSETEKCDRRCQEATETDVSECVCS
FT                   CFGKYHGGFGDPRADWKLVGATTLVASGPLQVKHMVIRRPLPRGPDNAFTSQPLPQQPA
FT                   VSTQLLHDVPEPSASGASTATGSTDVGRDGEGSERAAEPPPVQPVGRAAEAERLPAGCG
FT                   IAMFLTTVIVSAIFALAVHGLFWMGAALAILFAVAFGAERIGLL"
FT   CDS             17674..18216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_200"
FT                   /old_locus_tag="pnf2200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_200"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60705"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60705.1"
FT                   /translation="MLRVRQTRTTCTAHYSPWWPRKNLSSISRHCMPFRNWAVLRSISG
FT                   WISLATSSRIPLSARTLCSDSFTDSSTSLSNVNTLFSLCGPAVGAAPDARWICRTVNQS
FT                   LLGRAERTVETRGATGLLASVAAACELPAVEATGRRPPQLARRELLIGRLVGCALAQSG
FT                   RGGEAARRWRQPRPSWR"
FT   CDS             18383..19318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_210"
FT                   /old_locus_tag="pnf2210"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60706"
FT                   /db_xref="GOA:Q5YM85"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60706.1"
FT                   /translation="MGATTADIDDETTLPLAVHIEQFLTDLANANRPANTLRAYRGDLT
FT                   GFAEHVDGGIDGVTVAAVRGFLSGIADLAPATRKRKRAAVAAFCRWAVRHDLLAANPMD
FT                   KVDTITVPKTLPRPAPAADIAKVFAAICARRPRKDVALDVLRDRVLFETAYVCGARASE
FT                   VCELYVEDFDLRLDDEHVRLHGKGGTVRTVLLDDRGYVAMLRLYLDRTGYTAGPMFRAS
FT                   INGRGGPLSYSAAHHRWSRYCAAAGVDIDIHQLRHSHATELINAGVSIEVVRKRLGHAS
FT                   TETTQIYALLADQVADTEIRAARRRRDRSL"
FT   CDS             complement(19354..24315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_220"
FT                   /old_locus_tag="pnf2220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60707"
FT                   /db_xref="GOA:Q5YM84"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60707.1"
FT                   /translation="MGSVHEVIEAFRLAPSNSERGTKFEQLMVRYFELDPMLAQQYDKV
FT                   WRWTDWPDRAGKPDTGIDLVARERDTGALTAIQCKFYEPTHVLAKGDIDSFFTASGKKP
FT                   FTNRVIISTTDRWGRNAEDALQDQTIPVQRIGLAEIAESPIDWDIAWPAGELQVSLSEA
FT                   KRHEPRPHQAQAIDAVFNGFAAGHDRGKLIMACGTGKTFTALKIAERTAVENGGNARIL
FT                   FAVPSISLLSQTLREWTAQTQLDLRAFAVCSDNKVSRSAEDVSVHDVAIPVTTSSAVLA
FT                   AEMERRRHAAGLTVVFTTYQSLPAVAGAQAEHGVEPFDLVICDEAHRTTGVTLVGDDES
FT                   NFVRVHDGDYLKAQRRLYMTATPRIFDETVKDKAAEHSAELSSMDDETRYGPEFHRLSF
FT                   GAAVERGLLTDYKVIVLTVDEDLVAAPLQQQLAGRFSELRLDDASKIVGCWNGLAKRAG
FT                   KTPEGVGFPPGQPPMRRAVVFAKDIAASKQVAEVFPAVVDAYRELLADREDDGHEITAT
FT                   NLDLSCSVHHVDGTFNALQRNAELAWLKAPVPEGECRILTNARCLSEGVDVPALDAVMF
FT                   LNPRNSVVDVVQSVGRVMRKADGKDYGYIILPVAVPAGVSPAKALSDNTRFKVVWQVLN
FT                   ALRAHDDRFNAMVNSIALNTSSDVQKTGKGSDMLMGGHIGPVTDDHETLSNSTTNHGDN
FT                   AAEGSPAPDEGARMAQQMALFSLSEWQEAIVARIVDKVGTRAYWEDWAADVADIANTLI
FT                   TRIRALLAGASPEVTGEFEKFVQGLRDNLNDSITREDAISMLAQHLITKPVFDALFAEH
FT                   DFASHNPVSRVMQAMVDTLDGSGLEAETIKLEGFYASVRVRAAEVTTADGKQKVIAELY
FT                   EKFFRLGFRKQSEALGIVYTPVEVVDFILHAADQASRDAFGRGLTDQDVHILDPFTGTG
FT                   TFLTRLLQSGLITPKDLARKYAGELHANEIMLLAYYIAAVNIETTYHAILGKEAAAEYS
FT                   PFEGIVLADTFQITENGDSLDSMIFPQNNERITRQNATPINVVIGNPPYSVGQTSANDL
FT                   NANISYPTLDARIADTYAARSTGTNKNSLYDSYLRAFRWATDRIGNKGIVAFVSNGGWI
FT                   DGNTADGIRLSLADEYSRIYAYNLRGNQRTAGELSRKEGGKIFGSGSRNTVAIFIGIKN
FT                   PAHTGPCQIYYRDIGDYLTREDKLRIIADSTLTSIDWQTITPNTHGDWANQRNDEYQAW
FT                   PAIGEKNASREQVTVFSNFSRGLETTRDAWVYNYSRTNLAANVQRLIGNYNDQHIPFAD
FT                   YCRTAGVTRPNEAAVTDYLTANPTAAQADYIKWSRSLRTHLARRTQVTYRTEGHTVSLY
FT                   RPFAKQHTYFDKHLNHERSQLPSMFPTPHHKNLGFYQVGNGSAVPFSVLMLNMLPDLHV
FT                   TGAGSGGQFFPRWTYEKVVTPEGELDFGAATSSDIDDYGFRRIDNITDGILKLYRDVLG
FT                   DEVSKDDIFYYVYGQLHDPTYRQTYAADLKKMLPHIPTPTSRERFEQLADAGRQLADLH
FT                   TSYETVEPYPLDVQVKAADPDDRETWRVSKMKWGKKKDPATGKNVEDRTTIVYNPKVTI
FT                   TGIPEDADRYVLGSRSALAWVIDRYQVKTDPASGIVNDPNDWCDEHDTPTYIVDLIKRV
FT                   TTVAVETMRIVDSLR"
FT   CDS             complement(24400..24528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_230"
FT                   /old_locus_tag="pnf2230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_230"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60708"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60708.1"
FT                   /translation="MVSCQTPSRWAVPLLAEDLLTSATHHLRLRTRGCAVLCRIPS"
FT   CDS             24638..25015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="PNF2_240"
FT                   /old_locus_tag="pnf2240"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_240"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60709"
FT                   /db_xref="GOA:Q5YM82"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60709.1"
FT                   /translation="MSKSKLVVTPVQACSAAPLVREPLSEPHAVELASVFKALSDPVRL
FT                   RLLSAIASRESQEACVCDLSAGIELTQPTISHHLKVLREAGLLDSERRASWVYYRVVPE
FT                   ALQRLSEVLLVESGTAIGAPA"
FT   CDS             25012..26121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_250"
FT                   /old_locus_tag="pnf2250"
FT                   /product="putative arsenic resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_250"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60710"
FT                   /db_xref="GOA:Q5YM81"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60710.1"
FT                   /translation="MSVNTTDQPAVVAKLSTLDRFLPVWIGVAMAAGLLLGRMIPGLGD
FT                   GLSAVEIDGISLPIAIGLLIMMYPVLAKVRYDRLDTVTGDRKLLLSSLLLNWILGPALM
FT                   FALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVALNSVFQVIMF
FT                   AGLGWFYLSVLPGWLGLEQTTIDTSPWQIAKSVLIFLGIPLLAGYLTRRFGERAKGRTW
FT                   YESAFLPKIGPWALYGLLFTIVILFALQGDQITSHPLDVVRIAIPLLAYFAIMWGGGYA
FT                   LGAVLGLGYERTTTLAFTAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVGL
FT                   VYVSLALRKRFPATISPAASSGTGEMAPR"
FT   CDS             26118..26552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_260"
FT                   /old_locus_tag="pnf2260"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_260"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60711"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60711.1"
FT                   /translation="MSTTPSVLFVCVKNGGKSQMAAGLMRAAAGDLVQVHSAGTKPGTA
FT                   INALSAESLLEVGIDISGETPKPIDPALLASVDLVVTLGREAHIGPVDGVRILNWDTDE
FT                   PSERGIDGIERMRLVRDDITTRVNNLLTELTTPIEQRTHP"
FT   CDS             26549..27208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_270"
FT                   /old_locus_tag="pnf2270"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_270"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60712"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60712.1"
FT                   /translation="MTDSPSHTRHDLTIDQQLALKTAATHLQREFNGTFGVETIERFLH
FT                   SSYDQFAGRATVVNYLPLLAERFARQRLHALARVEGKAHTGTPTVLFLCTHNAGRSQMA
FT                   LGFFTHLAGDRAVAWSGGSEPGDEINPAVIAAMAEVGIDITGEFPKPWTEEIIQAADVV
FT                   ITMGCGDACPLYPGRRYEEWDIDDPADLDLAAIRPIRDEIETRVRLLLAELDLPAH"
FT   CDS             27224..27634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_280"
FT                   /old_locus_tag="pnf2280"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_280"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60713"
FT                   /db_xref="InterPro:IPR014064"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60713.1"
FT                   /translation="MTTKPSVLFVCVHNAGRSQMAAGFLSHLAGDAIEVRSAGSAPADQ
FT                   INPAAVAAMAELGIDISDQTPKILTYDAVETSDVVITMGCGDTCPTFPGVSYRDWVLED
FT                   PAGKGVESVRPIRDEIKARVEALVAELLPARA"
FT   CDS             27725..28159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_290"
FT                   /old_locus_tag="pnf2290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_290"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60714"
FT                   /db_xref="GOA:Q5YM77"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60714.1"
FT                   /translation="MTTQRNRHHSTARILVTYVAVATALTAALSELRDDAWPPHAKLHA
FT                   AQYILVTVGLSVIAMVLLWQRGSGARTPVITACSILATPWLGLLAAPLFPGTSLHKPRP
FT                   DNPLLLGLHPQLLLATVMLALLLAAVALTTRASTTGTAAR"
FT   CDS             complement(28133..28582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_300"
FT                   /old_locus_tag="pnf2300"
FT                   /product="putative multimer resolution protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_300"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60715"
FT                   /db_xref="GOA:Q5YM76"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60715.1"
FT                   /translation="MPNPKPDAYQAATPYPPDFRRMLRLPLLPRMLAGRKSGPVFLTDR
FT                   KARPSVAVNDVDPSTGRARLSYRRAAELFESHTLAFDDGPYTLHQLRHSRLTHAAEDGA
FT                   STPVLMKLSGHTSVRSLVKYARVSDEGLRRFQADSDPSARRRSGR"
FT   CDS             28652..31669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_310"
FT                   /old_locus_tag="pnf2310"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_310"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60716"
FT                   /db_xref="GOA:Q5YM75"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60716.1"
FT                   /translation="MATRMFADEELERLRGFPEISREELFRYFTLTSADLAFVDPGRGR
FT                   GPAERLGLAIALCTLPWLGFVPDRLVTAPPVAVARIAEQLRVDPVVIGAYGRRAKTRTE
FT                   HVRLAARYLGWRAAGALEFKELDEFLLARAMEHDSPTLLFRLGCEYLISAKVIRPGPVT
FT                   VVERVAHARHQAQTETYDRLAHEFTAARCAELDGLLVTDASLGISRLRWLSTGPVEASA
FT                   AAVRAEVDKLGFLRGLGADRLDMSVLPAERRRFLATMGRRLSPQALERRDPQRRYPILL
FT                   TVLAQSGTDVLDEVVALFDQAISAKFGAAERKMQQQLAERGKTGEDRQALLDDLLEIVT
FT                   DPTVADEEIGALIRGEKIGWERLRAAIAQAEPRLPRDHGHLAALDSSYNYLRQFTPAVL
FT                   EAVRFAGGTAATELLIAVNMLRELNATGRRKVFDDAPTGFVPMKWRGYLDEAARKSGSA
FT                   TAYRHYWELCVLLGLRDGLRSGDVFVPGSRRYADPAAYLLTTGQWEPQRGEFCRLVGRS
FT                   ADPGVALAAVVAELHDAVGELEAVLAGGDGPVRVDEGGDLVISPLSAEDVPAEAIALKA
FT                   ELTEMLPFAPIVSLLIELDKRTGYLDCFTHAGGQATRTPELKRNLIAVLLAHSTNLGLT
FT                   RMAEACGITYDILAWTDEWYVREETLRAANLTLIDYHQRLPLTAVFGAGTLSSSDGQRF
FT                   PTRGKSTTARPLSRYFASEGLSTYTHVTDQHATYGTKVIVATKREAHYVLDEILGNAAD
FT                   LPITEHATDTHGVTLVNFGLFDLLGMQLSPRIRDLGRITLYRPGPRAQAEARFPHAGPL
FT                   MTRKANLGLIAEHWDDLLRLAGSLKFGHATASLLVGKLSASGRQNTLAAALKEYGALRR
FT                   TIYAARYLSDPDYRRKISRQLNKGESLHALRRDLLYAHEGMIRARHLEDQTEQAWCLTL
FT                   ATNAVIAWTTEYYGLAVDQMRRAGQRIDDEVLAHLSPAHSANINFFGAIEVDIDAELAQ
FT                   LGPTGYRPLRVRDTLF"
FT   CDS             complement(31689..32336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_320"
FT                   /old_locus_tag="pnf2320"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_320"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60717"
FT                   /db_xref="GOA:Q5YM74"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60717.1"
FT                   /translation="MTDPHPADDEQADPRLARSRNRLLDAATHLLSTGGVEAVTVEAVT
FT                   RVSKVARATLYRHFGSTTHLLAATFERLLPHVDAPTGTTPVREQLLTLLTTQADLIEQA
FT                   PVQMTTLAWLAMGSIDDNHTDPAALTSLRARVIEQYRRPFDQILTSPDARATLGELDTT
FT                   FAIIELLGPIVFARLTGLRTIDHDDCARLVDNFLTAHSTATASTSPTGTGRP"
FT   CDS             32458..34047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_330"
FT                   /old_locus_tag="pnf2330"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_330"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60718"
FT                   /db_xref="GOA:Q5YM73"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60718.1"
FT                   /translation="MPVDTPGTDTVEIARWTRAEWWMLTVSCLAVALVVAAMAALYSAL
FT                   PQIAVATGATQAQLTWIVDGYTLVLACLVLPAGAVGDRYGRRVVLVAGLVVFAAASALP
FT                   LLLDEPVWLIATRALAGAGAALVMPSTLSILTAGFAPVHRGRAVGIWAGVAGSGAVLGI
FT                   LGAGVLLERWSWPSVFVGLTVAGTVLAVLACTIAESRHREHPPVDWVGAGTVAVAVAAI
FT                   VFAAIEVPARGWADPLVAAAAGIGVAAAVAFVVVELRSAAPLLDVRLFTRRGFGAGSLS
FT                   VTIQFLVTFGVFLLLVQYLQLIFGYGPLASALALAPMVVPLVAISVIAPWLSSLVGLRV
FT                   MTVTGLLTIAAGLVLVSRLTLAANYPDLLWPLLIMSAGLGLCTAPATYAIVADTPEAKH
FT                   GVAAAVNDAAREIGAAIGIAVAGSVLAAGYTHRIQPALARLPEPARGPVADSLAAALQV
FT                   ADQAGPVAAPLAEFAQAAFVHGSGQAALALAALTTATAIVLAVLAPGRTPRPHTRTPSP
FT                   APHSPPGERRPS"
FT   CDS             34044..34211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_340"
FT                   /old_locus_tag="pnf2340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_340"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60719"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60719.1"
FT                   /translation="MMGYRTSIVGTDGSGPARTAPVGCHHRRSPLLARLLSTPPIELDG
FT                   KAHCDILITA"
FT   CDS             34233..34760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_350"
FT                   /old_locus_tag="pnf2350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_350"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60720"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60720.1"
FT                   /translation="MTENTPSTDTPEPRQVPDWIPAFPVLAPDSVDLPPHHDHCLGCGP
FT                   ANPHGHRLRARRDAHGVYAHHRFDSRHVGAPAIAHGGAVATVLDELFGLLLYTVGEPAV
FT                   TRHLAIDYLAPILLDTPYTLRAHIHSRDGRKLHLKATIENDRAHVVTTATALFLIVDVN
FT                   HFLTPQHTPTHR"
FT   CDS             34849..35517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_360"
FT                   /old_locus_tag="pnf2360"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_360"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60721"
FT                   /db_xref="GOA:Q5YM70"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60721.1"
FT                   /translation="MFRKLCRSTPAIWNTFGMGEPFRIGYCRCSTDEQDVEIQTEQLLA
FT                   LGVPRERIFIDKGFSGTTRKNRAGLDNALAAATSAAAAIDERQVVLTTTKFDRFARNMA
FT                   EAGQTLTELRERDVLFGLGSSIYDWADPFGKLFLQTLAMVAEFEANLNHLRTREGMAKA
FT                   RAKGRLKGKQPKLPLTARKTIHRRYHDPADDASLADLAEEYSVGRSTIHRIVSNAPPRA
FT                   "
FT   CDS             35662..36186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_370"
FT                   /old_locus_tag="pnf2370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_370"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60722"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60722.1"
FT                   /translation="MARQTIVSTQQAERIIDQTQRHIRPIFGKCYGYPGVRCWGEDGMK
FT                   ALWSAANVKVIGGGLDDEAFLRARSELIGPHYEQSVSVSKAQGGHRSHSVSRTTEITLH
FT                   PSDLAAMPRGRCVVFTSGNRATLAQTVPWMDRPYAAQIAAALDELANATEPVRPRLQVV
FT                   PPLSDQKGKTA"
FT   CDS             36183..36959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_380"
FT                   /old_locus_tag="pnf2380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_380"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60723"
FT                   /db_xref="InterPro:IPR032584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60723.1"
FT                   /translation="MTSTDIPTSSSDIDIDLTTLDTDTDTGAGAGAGVGGVVELTEALT
FT                   GAVRKAIASQVAEAAQLIAKGALDEVLTEEVAEEMRVAAVRDALAAVDPQQGEDPVEKL
FT                   KYRNLELFVSEFLARVYRREVTREGSQKKARWCPVWWDHGEAVARLAALWRSFERMRQG
FT                   DGVEMSVWWLHHADPMMDRLLDPENGPFRYCSVADGHVRRLTKLPVVEIPDALKFADGY
FT                   IEDQQPDTTTAALPVTSLYLPPATGQARRVVIREFP"
FT   CDS             36959..39805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_390"
FT                   /old_locus_tag="pnf2390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_390"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60724"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60724.1"
FT                   /translation="MAVPAHEAGRGSWVRVTTALEQVVGPGRPSGSWTKYCCPVHEGDG
FT                   RHHRPSLSVKYFGDAGRTKVRCQAGCEDELVLDAVGLRVADLYDTPLRRGERGARSGPA
FT                   RRPAKRAESRSDRALRAAGIPAHKPKRDLGAQVSPWRSTATYTYVRADGTVAGEVIRRE
FT                   ADFEGGRDKSFSQRSWNSRHGGWERTGFDKIPFQLPQVREAIAAGRTIYLVEGEKDALN
FT                   AAAAGLVATTNAGGASGWSPEHAEWLRGARTVVIVADRDAPGFHRADRVMATLSGLVGR
FT                   VRVVQAATGKDLTDHLEAGHRIADLVPIPYLDPYTRALTAVPTPPATTTAAVAGPAPPP
FT                   SAVSPAPEFPAETPSPQGHPMPESLLTPAAETTPHSDEVDHMHSQWSVFMKLLMQQMLL
FT                   MATKAVHQRAAAAAEAARKSEQAARDAEERAAAEMAAVEVRLRKLRQKGYDTASRTEIA
FT                   DAVRDAATWGDQSEVAGNELGHLALHVSRRWGVELDLDTGQASIAPGTDAQRLAEIEQD
FT                   RAAAARARKAQDRMVEMVAREDDLDESAKVGIYAAIESWRADPSAEKLDALTRQLKDRK
FT                   VPQQTRTRLRFVAAYLGTPAAIGDEENADIKTVSAAEELSRHATPLVDPGEEAKPRIDK
FT                   LLETYQEQLKVGADTSEVREELAREVAVLTVEDQEAARARGKAIRANPAGAYPRMWPDH
FT                   VDRDELDEHIRVYALLAPKAEQAAGKAGDLDDVTATQLAKQAASHKTAIRKALTDGKGL
FT                   HDLERDQIKAVLRDVEAGKPTVPEQLFADDRSAAIVDIQRTQRIAYNTHRTQRRDLDEI
FT                   LDTGAVPEPVRQQVREHLDNTTGAVEMAHRGVADAAFKWARRREAVIVSRTAAVIEADG
FT                   GYDSPQRAQAMQEQLRAGGLDDDQIAERMAAESSFATPPSAAAKPPKLNPRTTSPGAGM
FT                   QRINHRNKNNGPEQGNGR"
FT   CDS             39827..41950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_400"
FT                   /old_locus_tag="pnf2400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_400"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60725"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60725.1"
FT                   /translation="MTTPDQQPATYPWRAAPSHLKTRRQLRDAGLSPGGQDVAALMVRQ
FT                   RRGRRLVAHLFDIALARPKRVPSPGQLAAIEKATRTHQLRAAERRGYTATDLHTPTDLG
FT                   LTWSETPTLQEETTMSTNGSTTGQVRPQGLGQRRAWLHALVATNQARDRRTRLDTDLDH
FT                   AARAGGEVEAGYLAGLRRDLDAAETRLSAVRGIGDPYTDTALLADALYWSPGSDTAARL
FT                   AEQITSGLAAEWGVHVDPESWQVSIDPGFDAATAQTTAETSAMRAREAAIVDVVSGLAL
FT                   PDHTAAAVDQAVQAWAEATPAGSNDLATRREQLRGELAGVRCADTDRALIEFTVDYLTD
FT                   HTAGVDLLDTPVLVDPGQEVRGRIPRLLERFTEGRIAPAQVAEEIAVMTDADQQAVREV
FT                   GAATVHELEQIGFQVWPGWADRDQVFEQLHEYATEAREHHSDIDYLATQDLTDDERENL
FT                   GVSDDIGARIERMTAARTELLDTATTSKGLTAAERHHLTAVIRDIDTGTINSESELPEL
FT                   MWVDERSKAAVDEKRSYEPGRRLSKAVTQEVTRLLSDAGVDLSHRDHGKLASSVSAIGS
FT                   TLDSVAYGGSLLGLDSDREEFLTRRTRLGQHLRDTRIGPEAMTTIREVVDGHARDAGQA
FT                   GQAAIERRGRWKDRITAIAAARDDAIAQRQAATAGHSTRPRACTTSPAITTQATGPTRP
FT                   PRIRHLHGEEIGR"
FT   CDS             42038..42226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_410"
FT                   /old_locus_tag="pnf2410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_410"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60726"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60726.1"
FT                   /translation="MPPSLAALDWARGANPDFADDDSGFFAAADWMREAASAVILPPSL
FT                   SDFDTILSFLGSPTLPV"
FT   CDS             42361..43140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_420"
FT                   /old_locus_tag="pnf2420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_420"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60727.1"
FT                   /translation="MGTGRERVGAVWCESDYRLLFEALALGMTDEEIAAHIDREVGGVR
FT                   SRALLLVDNATSKKGALPMLRRLAEAPDFDWDTWVREVHTRENLPYWDTAADEALIGHW
FT                   AAEPPPRIQQLCEQFGVGQDVIARRAIILGLAQTRAEVVDRFGAAPGSGLAVNAVLAKD
FT                   KLAAAVAVLVVTDTTGEVLYLSLHPTTDEATTSLQDLTTTPLAAIQGRWTIGTRVVGEG
FT                   SVRPTDTGTWPATTEYIPAPQERPSRWRRLLRPVRQG"
FT   CDS             complement(43236..43796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_430"
FT                   /old_locus_tag="pnf2430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_430"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60728"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60728.1"
FT                   /translation="MVPKFIAEANNCLDEQDVATAVLAVLVIVTAGCGSSDTTSTSSAT
FT                   SAPVAAPSAGLESGPTSPLGGTLKIWGGANLSDKTQLAEYTVSNPRTLDGRWTVDVVIA
FT                   CRQGNGYVPGTFEVLTTAGRRLEQFNPYSASGGQLSLAGALIAGERREGYISFEVPADD
FT                   QVAKVVLYHGTLNPPAAFWTVGS"
FT   CDS             complement(43910..44254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_440"
FT                   /old_locus_tag="pnf2440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60729"
FT                   /db_xref="GOA:Q5YM62"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60729.1"
FT                   /translation="MRQRGRARATLYDFEVTTRLWAGAGISDCTEAGVDCMPGFGMFLV
FT                   ELVALGLFLIVWFVSVPIATVSILSVANTAGRRVAWLAVVWLVPVVGALAWYFRARSRV
FT                   ACDVDDGRPV"
FT   CDS             45007..47655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_450"
FT                   /old_locus_tag="pnf2450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_450"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60730"
FT                   /db_xref="GOA:Q5YM61"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60730.1"
FT                   /translation="MPAPDGRKPSGTVVGGVHAEGARSVAVSGDARLVQTGDNATARIV
FT                   ELPAEAYRPISEVDAPPGIDNLPIRPANFVGRTTELDKLDTMLASAGQVVVQAVHGLGG
FT                   IGKTTLVAHWAATRTHGCSPILWLTADTPAEITQGLAGFAAALQPALSTVLEVEQLAER
FT                   GLQWLATHTGWLLVLDNVEDVTDINPVLARAGTGGRIVVTSRRATGWPTGTAVIRLDVL
FT                   DPTESLELLTGLLTASGPRDEDGAVELCAELGHLPLAIEQAGAYLAQNPFLTPRAYLQT
FT                   LDTYPAETLGHGGVDTDAERTIAQIWRVTLDRITTIQPMAAELLRVLAWYAPDAIPLSM
FT                   CQSITDPPTLNTALGVLTAYNMITPDLTTNTVSIHRLVQAVACTPDPTDPHRDPTAIEQ
FT                   ARDQAADVLLACLPDHQDPGTWLTWRALLTHVDTFTGKVQSTSVTDAKAQILTRAGQFV
FT                   LDQGMHTSALIYYRQALTEYERVLGAEHPHTLASRGNLAGAYQSVGRLDEAIPLYEQAR
FT                   TGQERILGPDHPETMAARNNLAYAYQSVGRLDEAIPLYEQVLTDSERILGTEHPDTLKS
FT                   RSNLAYAYQSVGRLDEAIPLYEQVLTDSERILGTEHPDTLKSRSNLAYAYRSVGRLDEA
FT                   IPLYEQVLTDSERILGTEHPNTLTFRSNLAFAYESTGRLEAAIPLLEQTLADRERILGD
FT                   EHPHTLISRGNLAGAYQSAGRLDEAIPLYQQTLTDRERILGVKHPDTLISRNNLAYIYK
FT                   SAGRLDEAIPLYQQTLTDRERILGDEHPHTLISRNNLAGAYQSAGRLDEAIPLYQQTLT
FT                   DRERILGVKHPDTLISYNNLAGAYQLLGRLDEAIPLYERTLTISKELLGAEHPTTRLIR
FT                   GNLAAAREATH"
FT   CDS             47853..48404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_460"
FT                   /old_locus_tag="pnf2460"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_460"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60731"
FT                   /db_xref="GOA:Q5YM60"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60731.1"
FT                   /translation="MRVGYIRVSTVDQNTDRQLDGIDVERVFTDKVTGKNAKRPALQEM
FT                   LAFVRDGDTVLVHSMDRLARNLDDLRRLVRQLTGKGVRVEFVKEALTFTGEDSPMATLM
FT                   LSVMGAFAEFERALILERQREGIATAKARGAYKGRKPALTADQVTALRERAAAGEPKSA
FT                   LAREFGVSRETVYAYLRATA"
FT   CDS             complement(48559..49002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_470"
FT                   /old_locus_tag="pnf2470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_470"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60732"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60732.1"
FT                   /translation="MRWRDLPGAAQRPYVVGEVIVVKRVGAVDEIEELFETQVVEILWS
FT                   EVGVLVTKLEDTPHLELLVVLFSHPAALVLTTAFLPALRVGSPRSEYSSALRTCVCAVA
FT                   VERQRQQHTNGMAADCGQPVPTLDEVERWRASPEGVDAAGLLE"
FT   CDS             49041..49550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_480"
FT                   /old_locus_tag="pnf2480"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_480"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60733"
FT                   /db_xref="GOA:Q5YM58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60733.1"
FT                   /translation="MVHLRYFTDCDEAIRARVLEWVRTDEFISRIGMPDHELKHVPGAE
FT                   TRTGRVHNWVIFVDEQPVGLISAQIQDQPRSHSPLNRELDDPADYPLLGTVTYIDRQHR
FT                   SRGYASAAKHAISEHVAAAGVQTFGCIVAGDNPQSLRSISRAGYERVHTEKVDGKPDKL
FT                   YFRRRR"
FT   CDS             49934..50272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_490"
FT                   /old_locus_tag="pnf2490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_490"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60734.1"
FT                   /translation="MHTLTRDLQLVRNLRRRYQLRQVGRVRLGEVGLLIDHFNRHRRQA
FT                   GDRPNKRSSESGRLHRILCFDIDAQHDRNTGEPSRRGIDIRELFFPHRELFSVDLSRAI
FT                   AQGHYPDH"
FT   CDS             complement(50275..50532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_495"
FT                   /old_locus_tag="pnf2495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_495"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60735.1"
FT                   /translation="MNSDISDLAAWARSQGWRVVDTTRGYTQFFDPDGEYIAQYPATPS
FT                   NPRRRMADLKVKLKAAGLQVPPPSKKEQRAVRRKASTEGA"
FT   CDS             complement(50734..51765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_500"
FT                   /old_locus_tag="pnf2500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_500"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60736.1"
FT                   /translation="MTDAQRRELAEIAARAFRATAPHWPTIDLMGSLQSSLPTDIPWPR
FT                   LEPIRLDPGLFQHMEAAIDVTHSLRSAVFDGILAGVHLPRLDIPTFDVARPMPQLPAVD
FT                   VQRMLRHHIPAPGDLIPPGVQELIDSLFARYPANWPMGEEALDLDLAQQIVENEGIPIV
FT                   YIPRADIVSELAQAPDRAGRDAILVARTSEILDDCAAAVDSQLDPLVAEQRPLLLKAIA
FT                   ALADGHHEAAQALGVSVCNTQIEAHIDNKSGKAKHQCRVTNLEVAFQEDRLRYVLGVAP
FT                   VVNLLTDWNPKSGKPRPVPLSRHVVAHQAHPDHFTPENAVLAVMVATSLMLALDERYSW
FT                   PTD"
FT   CDS             52171..52512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_510"
FT                   /old_locus_tag="pnf2510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_510"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60737.1"
FT                   /translation="MATPARCRASIWWSRFCSAVETRPYPINRRKKHGSPGAGRGKANA
FT                   ERLGREKFARRRTAAGPPRRRSLNPFLRRPTTRTRRHLVGITPLGNHHTGIVGPEHSPP
FT                   LAWSRSARS"
FT   CDS             complement(53022..53444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_520"
FT                   /old_locus_tag="pnf2520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_520"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60738"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60738.1"
FT                   /translation="MTSAIRKASITVVSTAAILLSGTTAAIAAPTTPTAPAVSQVVGEP
FT                   LGATQEAAAETVAAPALANLRPEVTPVKRNWAADTAMFAGCLGGFGFVAAPIVAGFMFG
FT                   GPGGAVAAAKAWIPRLGPVGGGILKWCMASVLGIRM"
FT   CDS             53653..53982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_530"
FT                   /old_locus_tag="pnf2530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_530"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60739"
FT                   /db_xref="GOA:Q5YM52"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60739.1"
FT                   /translation="MIAATRRRDDAMRGEGKSKPAGKTKTLQVRVDEETARHFAAIARA
FT                   RRMTESQLLRATISEMLRSSESNVDVLKAELRAEFEAAEAALDELSSESRQAAVAAGSR
FT                   QRSTR"
FT   CDS             complement(54035..55297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_540"
FT                   /old_locus_tag="pnf2540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_540"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60740"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60740.1"
FT                   /translation="MTRHYYGAVVEMNTAKLKTLALKVLEIVSLPDTVTHESIDVAVLS
FT                   TAMETARLNAGMEKESGGNLPDWPLLLGGHVAFMMLRRGNEIVLDPALELRDPRLVALG
FT                   LTYIEGAALILATLVVETAAGPNSATMEPTTHPAATRDFHCLAEVIPHDDYSAQTAVPA
FT                   LVDVLRRFTIPEASVPDPFSLQSILPPGRIKNKVALLERRINGLSLPTRLAFTAGLAIA
FT                   GIVAGYLAGSSHGPTENPDIVTATEIALPPGFPETYVGPAVPNVVARVLVHESEQQPHP
FT                   RMQSVAGDLPDDAFVTGVDHRLRAEIHLGWRDPALGTDQNIELALGLDAGLTITPGTTM
FT                   LVNDANAAPGIGALQLATTYTPVAMDEEGEIVYQFELAVSSDPALFFCGYNLRPINVLV
FT                   RDGNSPVLVTAMPVYVLKSCP"
FT   CDS             55394..55753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_550"
FT                   /old_locus_tag="pnf2550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_550"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60741"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60741.1"
FT                   /translation="MSESRPRTKILTVLGTVAAAALCTAFLGCPTAAAADVPLDLHAQC
FT                   ATQYPETPHAYAGHPILIAPGNAYSWRCEQPSKLPGGGLLSSLFLDTDAFCVNNRLGHA
FT                   LALDTDNPHSWVCRQ"
FT   CDS             complement(56558..56848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_560"
FT                   /old_locus_tag="pnf2560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_560"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60742"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60742.1"
FT                   /translation="MPGRVRPALLSCGFMSNERVYLTPEAAASLPHTLPLQWDSNRPTI
FT                   CHVDVDAAVPQDNGWLRIVLSQNEGNQFVLSLPPTAVAAVVWVQGAMFPTF"
FT   CDS             57571..58266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_570"
FT                   /old_locus_tag="pnf2570"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_570"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60743"
FT                   /db_xref="GOA:Q5YM48"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60743.1"
FT                   /translation="MKCFSFEKDAPGSGGRITLYRAAPRAQVESAFPHAGPLLTRRCNL
FT                   DLIAEHYDDLLRLAGSLKFGHATASLLVGKLSASGRQNALAAALKEYGALRRTIYAARY
FT                   LSDPGYRRKISRQLNKGESLHALRRDLLYAHEGTVRARHLEGQTEQAWCLTLATNAVIA
FT                   WTTEYYGLAAEQMRRAGRRIDDEVLTHISPAHSENINFFGAIEVDIDAELAQLGPTGYR
FT                   PLRVRDTLF"
FT   CDS             58358..58759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_580"
FT                   /old_locus_tag="pnf2580"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_580"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60744"
FT                   /db_xref="GOA:Q5YM47"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60744.1"
FT                   /translation="MRTGELAARAGINAQTLRYYERRGLLARPARSPAGYRSYPDEAVA
FT                   VVRFVKRSQELGFTLDEVAELLRLADGGPDDCDTARALAESRVAELERRIADLQRMRGS
FT                   LAELIATCELPRNRRSCPILTSLHEGDHP"
FT   CDS             58756..59757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_590"
FT                   /old_locus_tag="pnf2590"
FT                   /product="putative alkylmercury lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_590"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60745"
FT                   /db_xref="GOA:Q5YM46"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60745.1"
FT                   /translation="MKLEILQVPDCPNVAVLEQRIRQATAGQPVQLEITRRVIDDPGRA
FT                   ATAGMTGSPTLLVDGCDPFATPGQVPSLSCRLYPSDTGRLDGAPSVAALRAALRLVPDG
FT                   TAALGDDTASSCCTPPAAESPATVLRAWRAAAQPADPTEKAVHQAILRAFATDGQAPTG
FT                   DDLTEMAAGPDVPVEQLLRRLHDADIVRLDATGSIAAAYPFSATPTPHRVRIAGGATVS
FT                   AMCAVDALGMAAMLDTPVTITSADPVTADPITVTVDGGHVTADPATTVVFVGAQAGPGP
FT                   SADTCCHYLNFFTDRASAQGWADTHPGIGGVIVELPDAHHLGTTIFGHLLHS"
FT   CDS             59804..60841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_600"
FT                   /old_locus_tag="pnf2600"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_600"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60746"
FT                   /db_xref="GOA:Q5YM45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60746.1"
FT                   /translation="MKPGLRRLRSGGARSGPVICGKQAREVTMLSSGITVRAAGDGFLD
FT                   SIRSPNTRRSYAIAVDKTTARLGEARPLANVADDEIGETLETLWGEAAVNTWNARRAAV
FT                   ASWLAWCREHGHLAPAVPAWVKRSTPPDSATPVRSRTAIDRLITRRDIDLREKTLWRML
FT                   YETCARTEELLQVNIEDLDLAGRCCPVKSKGAKPRTRRRGATHHEYAHELVYWDAGTAR
FT                   LLPRLTKGRTRGPLFVTHRRPGPGKAAADRDICPDTGLARLSYGQARAVLDAATATNGP
FT                   GTGWDLHELRHSGLTHLGEAGASLLELMAKSRHRKPDNLRRYFKPSPAAMRGITSLLGP
FT                   DRSHR"
FT   CDS             60940..61173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_610"
FT                   /old_locus_tag="pnf2610"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_610"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60747"
FT                   /db_xref="GOA:Q5YM44"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60747.1"
FT                   /translation="MAAVGSSADNALAESFNATIKREVLQDAACWPDEATCRREVFRWL
FT                   VRYNTRRRHSWCGYLSPSTYEARRAATLPTAA"
FT   CDS             complement(61580..61978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_620"
FT                   /old_locus_tag="pnf2620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_620"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60748"
FT                   /db_xref="GOA:Q5YM43"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60748.1"
FT                   /translation="MKKLSTISDTECRVLLRSVPVARIAYLEDGVPAIRPINFTVAGDR
FT                   IVVWTVPGAHGSAVTGQTVAVQVDRIDPDSHSGWTVLITGPATAISDIDELVAAADIPR
FT                   RPWVTTPHDQVIGIDIERISGLRLPPAP"
FT   CDS             complement(62045..62464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_630"
FT                   /old_locus_tag="pnf2630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_630"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60749"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60749.1"
FT                   /translation="MTDTGTDLGLSTTVTASFDDAVDAAKRALAEQGFGVLTEIDMQAT
FT                   LKAKLGHDMEDYRILGACNPPLAHRAVEIDRQIGLLLPCNVVVRRSPDNDTDIIIEAMN
FT                   PQLMVQLTNQPALAPIAADATTRLRAAIDSLHRSH"
FT   CDS             complement(62513..62758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_640"
FT                   /old_locus_tag="pnf2640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_640"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60750"
FT                   /db_xref="GOA:Q5YM41"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60750.1"
FT                   /translation="MTLPTRPRTWTIDRVVPLLAGTLILLSAALAATLSPWWLILTALV
FT                   GANLLLYSALGWCPASLLMARLGLPAGTATCTVART"
FT   CDS             complement(62812..63081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_650"
FT                   /old_locus_tag="pnf2650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_650"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60751"
FT                   /db_xref="GOA:Q5YM40"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60751.1"
FT                   /translation="MVGDENSIAPVLNRLRRAHGQLAGVIAMIEQGRDCKDVVTQLAAV
FT                   SRALDRAGFKIVATGLRECLAGQPGEGADPMTVEELEKLFLTLA"
FT   CDS             complement(63156..65315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_660"
FT                   /old_locus_tag="pnf2660"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_660"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60752"
FT                   /db_xref="GOA:Q5YM39"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60752.1"
FT                   /translation="MVETRLAGTAAGGQHPDSSPGLLGRWGAFMAGRTRAVIGIWLLVL
FT                   VALGAAAPSVFTSLAGAGWQANGSESVRARELAQQHFGGNSSAAVQVVIHSDTATIGDP
FT                   AMARVVEQVTAVFAGDERIGQVIAPQPGFTISPDGHTGIVIAGANASTDDMVKAVDEHK
FT                   AALTALSEDGIEVYPTGASALWSDFNAANHDAMIQAEMLSWPVTLAIMVLAFGSLVAAG
FT                   LPLLLTLAGLVASAGGLVLLNQITPISVWAMNFAMMFALALGIDYALFLVARFRDALAR
FT                   TGDPRAAVAETMDTAGKAVLLSGLTVLVSLSAVLIVPAPAVRTMAVGIMLAVVFVLAAT
FT                   LTLLPAVLGALGTKVNAAALPYARRQQHRSPVFARWGQILHKHPWPFAAVALAILIGLA
FT                   APVFGLKTAMPSIAVVPTDAPVRQGYELIAEQMGPGAPGMLSIITPTADAAATATIARA
FT                   SDGIVMLTPPQPAADGADLVMMQAMPAVDPSAPQMAEILDQLRADLPADAVVGGAAAEN
FT                   LDLQQALDDYLPIVVGIILVLGFVLLLIALQAPLIAALGTLVSLLSTAAAFGVAKLIFQ
FT                   DGHGAELLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYERTGDPHAAHVD
FT                   GLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAILVRLVLLPVMLR
FT                   LTGHAAWWSPAWLTRVLPTISFAHH"
FT   CDS             65425..65652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_670"
FT                   /old_locus_tag="pnf2670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_670"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60753"
FT                   /db_xref="GOA:Q5YM38"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60753.1"
FT                   /translation="MGIVEFMRGTAGRAARIIAGIALILIGLAAIGGPVGILVAVIGVI
FT                   PIAAGAFNFCLLGPVLGLDLHGQPRRQAGH"
FT   CDS             65751..66371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_680"
FT                   /old_locus_tag="pnf2680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_680"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60754"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60754.1"
FT                   /translation="MADIELFVDPVCPFSWVSSQWLLTAAEDSAHTVRLRQMSLAVLND
FT                   GHDVAADHKPMIDRSRRLGRVFAAATRTGGAEAFARLYDVIGTRLHIQGDDLGPQEVAK
FT                   SLTEAGLDPGLAEHLDSTSLDDDITGTHEVSQAALGGRGGSPIVVVDGRGFNGPVLTEQ
FT                   PRPDRGRDLLDALVTAATTPGFAALQRPYQGPPKIDAATEETH"
FT   CDS             66371..66532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_683"
FT                   /old_locus_tag="pnf2683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_683"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60755"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60755.1"
FT                   /translation="MCSPTRCRTCGKTTWSGCGAHIEAVRARVAPDDWCPGHPTQQAGQ
FT                   PWWRLRRN"
FT   CDS             66773..66964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_687"
FT                   /old_locus_tag="pnf2687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_687"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60756"
FT                   /db_xref="GOA:Q5YM35"
FT                   /db_xref="InterPro:IPR021449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60756.1"
FT                   /translation="MACRVPSLLLATAVYAAGGPGWVAAAIMGVTLPLSWMAVLIANDR
FT                   PPREKRRPSLLRRRRRRR"
FT   CDS             complement(67269..67841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_690"
FT                   /old_locus_tag="pnf2690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_690"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60757"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60757.1"
FT                   /translation="MRSWAIELFVSKEDLSMSGFKINRRGIQQMSREIQREFAKNPVRV
FT                   PIEMEAGGVYPPAANITNYNGPIVTVHGSHAQLAWNNGTVHQGQAHSDQIAPGYEELAA
FT                   TLAELLATLPRFPLADDETTEVREHTETILAEVVNEEPDPGIVKRGLTMIKGLLSPIAA
FT                   GVTAAATDESAQAAREVIQRLGEAVPF"
FT   CDS             68554..68919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_700"
FT                   /old_locus_tag="pnf2700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_700"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60758"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60758.1"
FT                   /translation="MLLGVGAQQHNHVVRSWKPETIICQYCSMEVVWLPTIYGGNKLFD
FT                   AKMYPTSESARGNRFAAKRNGSVVDLDDIHSNRWPAECLHLHRYSCSEYNADMEARIWT
FT                   TKQSPGRDGRRIAEPPF"
FT   CDS             complement(69007..69249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_710"
FT                   /old_locus_tag="pnf2710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_710"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60759"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60759.1"
FT                   /translation="MPYSDWGCEVARKKLTIEFDKPLPSELYANIISATWMNMRAIADA
FT                   ANFEFTIHHDGESSLSVELNNHWDRFATEAWWDTE"
FT   CDS             complement(69349..69990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_720"
FT                   /old_locus_tag="pnf2720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_720"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60760.1"
FT                   /translation="MPRPSRILAHDQPAPSTETSSADHQFAGMPRHLEEPWMNHKHGDE
FT                   TLDRIVHPVEVTAANAMRAEGQLIDAVRTARAQGASWQAIAAAAGVSPLEAERRWATRT
FT                   HTPLAELGAAVIEPWKTRLANYDHAQVERPENPRALVADLLLATTHARQLLDEITAVTD
FT                   RLADTQDTVVATAADTASTALAAGADTADQQARHLRTALTQLGTIDKHDR"
FT   CDS             complement(70026..70451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_730"
FT                   /old_locus_tag="pnf2730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_730"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60761"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60761.1"
FT                   /translation="MTGAAVFAAVLGTYLVAHQVGDYWVQTDHQAQTKGRPGWSGRWAC
FT                   TKHVATYTLTLALCLATVDWWLGMPVQPAWAAAGLTVSAVTHYWADRRATLAWLADLLG
FT                   SGGFYRAGTGLATGAAHLDQSWHWLWLGIAALITTGP"
FT   CDS             complement(70448..71305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_740"
FT                   /old_locus_tag="pnf2740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_740"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60762"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60762.1"
FT                   /translation="MSATGIEWTETTWNPVTGCDRISAGCDHCYALAMAKRLKAMGSAK
FT                   YQRDGDPRTSGPGFGVSVHPDALDIPRRWRAPRMVFVNSMSDLFHARVPDAFVHAVVEV
FT                   MRQTPQHTYQVLTKRPSRARRLTERGLVLPDNVWIGTSVEHGAVTHRITDLLAIDAAVR
FT                   FLSCEPLLGPIDLDPWLFPDRCPDGCSCRWPDDGDHNECACGGACADWAPRPAIDWVIV
FT                   GGESGPAARPIDPEWVRDLRDQCVTAGTAFFFKQWGGRTPKAAGRELDGVIWSQFPTAA
FT                   RRTA"
FT   CDS             complement(71302..72927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_750"
FT                   /old_locus_tag="pnf2750"
FT                   /product="putative DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_750"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60763"
FT                   /db_xref="GOA:Q5YM28"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60763.1"
FT                   /translation="MMGVRMSLRSTVYFAGWGGDSLGWEEVPGIELRLAANHNPVCVEV
FT                   HTLNFPDAEHLPPGDVEAIDLATLPYTELFWASPACPAWTDAKGRKRYFDKSNQYTLLS
FT                   DDELGTVIEDPAEARSRGLVEQIPRYLRAMAGRGTPVLAGVMENVIQCRRWDQWDRWLR
FT                   AIESIGPGYETRVIALNSMHAVPRRCLPAPQSRDRLYVAYWLKSLGRRPDWDKWLRPKA
FT                   WCPTCDRVVDAVQSWKQPGIDMGRYGARHGQYVYRCPAKSCRFQIVEPFTVPAAAAIDW
FT                   SLDPGEKIGERARPLAAATMERIRIGLAKFAGESFLTPAGGTWRADPTALSAPMPARTT
FT                   RESDGLVVPPLIVQTSKRADLTARSTGQPLPTQTTRRELAVAIPPFITSLRGGGSRKTA
FT                   RHVGEPLGTFSARGFHHGLVQPPGSTAVVEQLAGTREQLLVPYYRTGLARPLTEPMGTL
FT                   TTRDRHGLLGIDPDRILAECTFRMLEPDEIRAGMAFPPTYIPIGDKRTQAAGYGNAVTP
FT                   PVPEVIGCALVEAITGEPIERTAA"
FT   CDS             73008..73223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_760"
FT                   /old_locus_tag="pnf2760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_760"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60764"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60764.1"
FT                   /translation="MMAGMSDETDHAAAIRAARAAYDQARSELFATIRAALDDGVGPSA
FT                   IARYSDFTREYIARIRDGKGPKDIRG"
FT   CDS             complement(73335..73985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_770"
FT                   /old_locus_tag="pnf2770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_770"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60765"
FT                   /db_xref="GOA:Q5YM26"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60765.1"
FT                   /translation="MGAPVPPPSAGSPGPASLPPVDAVEVTALAALYQADRADQSQHNT
FT                   SALTLIAGAVAYLGLVVTAWKDVKAAAMWPVLLPVPLWMVAAFHVLIMGAVLTRNQSIR
FT                   ILEVRLHSATKLPMLGVASHELGGARARQVMDLDRQPILLKVQTLVTYMGIGCVLFGFT
FT                   AYAVWNTWHHHGWDAQVRIAAGAYSTASALVLAAWIRILLYLEEPLPAWAQLP"
FT   CDS             complement(74159..74971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_780"
FT                   /old_locus_tag="pnf2780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_780"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60766.1"
FT                   /translation="MPETPRRRRRSGELWTDECNAELVELLRAGLPVEAIAEQAGRSVS
FT                   ALATQCRKMLPPDFDTRPTAVEALRGVLADPDYDWRSPLRELARRARTVYWDAGMVDRL
FT                   RQGWERATPLDDLCEEFEASEIDVARQLLRLGAAESMFDVAERLGCDPHGTLAGRLRIA
FT                   ADRCAAAVWILIVDGALTGAKTQFGSAGPGLRHVSVHHDYDTADLRLAEVLLDHVVAGG
FT                   RIQDVTTTIVERTIGDGAIGFNRFLTGSEALPTPAVAVVDLDDSTPTM"
FT   CDS             complement(75260..75673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_790"
FT                   /old_locus_tag="pnf2790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_790"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60767"
FT                   /db_xref="GOA:Q5YM24"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60767.1"
FT                   /translation="MNRCGRGGRRHGCGSCWPCTGSCTCAAESGACAHAKRYAHTPTPG
FT                   REGEHAMTYYPPPRYRCLNLRCPETYHPLPTCPYTPLTTVVPPRTRPLTPRERDAVDHI
FT                   YRLGQAGELRILPTHWKWWVTAAVAFVLLLILF"
FT   CDS             complement(75764..76096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_800"
FT                   /old_locus_tag="pnf2800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_800"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60768"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60768.1"
FT                   /translation="MHRPRSAPRVSACRVTLSGEGTLRGEERMAATEGPTVRLVAHCRR
FT                   CHGWLLSPESVAQGIGPTCAIRERAEQRAAEAAAATSTLTLFELPAGNSDGDGPHDLLE
FT                   LLGLAS"
FT   CDS             complement(76111..76500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_810"
FT                   /old_locus_tag="pnf2810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_810"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60769"
FT                   /db_xref="GOA:Q5YM22"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60769.1"
FT                   /translation="MSEDVEGSDRADWPGWAEVLEGVRRSRGRVEQAKGALMLVYGLDS
FT                   TAAEQLLRRHSRDRGLPTAVLADQFLHTVAALGGAAGPEHARFDHLLLTAHQRLPADTD
FT                   CPDVLEQALAPHADWTPPSCDRPTS"
FT   CDS             76757..77326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_820"
FT                   /old_locus_tag="pnf2820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_820"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60770"
FT                   /db_xref="GOA:Q5YM21"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60770.1"
FT                   /translation="MTRPEAPELCPRCGEPIVQLPLGRRRKWCSDYCRRRADEEGLKVH
FT                   EVVRERERVVYRPERVSREQQIARLLDDPEATEQLLRALAYRWRHTAPDPAARQQIAPT
FT                   LLELWQAFHARIDPHTAQHPPAKIPTVAAEQRAAVERVLSSPRSTASVINRVTDRLDAG
FT                   ELRSGRDEAILNAIAYLTTRRRFPRR"
FT   CDS             77532..78608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_830"
FT                   /old_locus_tag="pnf2830"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_830"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60771"
FT                   /db_xref="GOA:Q5YM20"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60771.1"
FT                   /translation="MALAVVRSLRETRSLVTDEELADFELDVLSEFVLARASSGVGDST
FT                   IRGDTTHLGQVRQWFGRPLWEMEPQDADRYFGTVLRRVSSSTRAARARTVVSYFEFLEI
FT                   RYKVVLHEMTGRVVECPIDEVNRPRMSVDTMVRIPPTEAELEQLFTGWREDLVTCRKFA
FT                   PSARNYMVARLAADVGLRVNEACMLDLDDIRWELGRFGKLNVRHGKGAFRSGPRQRLVP
FT                   LINGADTALTWFVEDVWAQFDADETLPRAPLFPSERRRAGSSGTRVTRDVIRRALGGAV
FT                   DRHLPTWSGRLTPHVLRHYCASQLYRTGVDILAIQELLGHSWITTTMRYVHPYGTRVED
FT                   AVTAGHKRAAARWEGLIR"
FT   CDS             78605..78940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_840"
FT                   /old_locus_tag="pnf2840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_840"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60772"
FT                   /db_xref="GOA:Q5YM19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60772.1"
FT                   /translation="MKWNLRLVAANRGIWKSSELRRMLAARGLEISTGKMSGMWSSTPA
FT                   VLRPEELDVLCAVLNCGIAELITAEPDTVAAPTDAGEHVRAVGDQGPESVRRIVPKPRT
FT                   GRSLPPR"
FT   CDS             78937..80559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_850"
FT                   /old_locus_tag="pnf2850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_850"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60773"
FT                   /db_xref="GOA:Q5YM18"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60773.1"
FT                   /translation="MTATSCRECGGRIEASTCPRGGRPRQYCLTCRPSKTAERRAEGAK
FT                   DYRDGSCVGCGTQLERAARTIGRPRIYCDACRGRRARTPSRSRRRNDAGPAQDNRSEAY
FT                   RDRRCTRCDAPIEVDGQRKGRPRIYCDGCFGRRVHEQRRHRTRPRSLDGLRFAEVFGTI
FT                   TGRVEHEVLERLFDTARVGRWSVATVQRRSEELRRVLATAGDEPISLSQVRAELGNVWQ
FT                   SRIAARVLDQCGLLIDDTESPTRQWIDRRTAELPPGFRDDVRAWLVVLHEGGQRARPRA
FT                   EATLHAYYSRVLPPLTEWGSTRSHLREVTQADVSVALNRLNGHKRVGTFVALRSLFRFA
FT                   KRHRLIFLDPTRRLRAGAAPSRVLLPMTTGQVDAVTATAVTPLQRVVVALVAVYAVRAH
FT                   ALRQLVLDDLDLARRRIRIGGSVHQLTEFTHDVLTDWLTYRQQRWPGTPNPHVLVSSDS
FT                   VLGNSPVEDYYLTWHLSLLGIQLEHIRGDRILEEALSTDTDPLHLTIMFGLSEKSAADY
FT                   ARLARGITERPIEAVSHYPADWD"
FT   CDS             complement(80866..81024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_860"
FT                   /old_locus_tag="pnf2860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_860"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60774"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60774.1"
FT                   /translation="MGKGVANGPRTQGRGGPSSGPRKRRNHLGCRLATPSLRNLLAPAL
FT                   RNSLPTP"
FT   CDS             complement(81040..82905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_870"
FT                   /old_locus_tag="pnf2870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_870"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60775.1"
FT                   /translation="MIPNSTKGSDIKRLLWYLAGPGRYNEHVGQRVLAGDAVTMAVFAG
FT                   RINQARAWELGKLLDSPRQVLLRGDPVSVTSYQKARALMAEGMSRKAAFEAATSDENTW
FT                   HCSLALHPDEGALSDEKWQAIATDFMREMGFVDAGDAVPDVRWAAVHHGPNRNGCDHIH
FT                   IAMSVVRADGSLVDMMYDRPRSQRAAGRVERKHGLRVLASRETGETEAATTPAERAYMQ
FT                   RVGAHETDREALRRRVRAAAAATGSEAEWLRELRTQQIVVRPRFAKDSTEEVVGYSVRM
FT                   PAQRNVETGVWETPRGYSGLQLGKDLTLPALRSWAGWETSETAQQEAAAEWRRLLAASD
FT                   RRGARAGAHRPLDPAAQTEALAAVSRWCQRIQAIPAEDHAAVRRAASATAGLFAAASVS
FT                   TEPAPGPMDRLSRQLARIGDTDPARRLPRRERADTASVRAAARLLWSTTSRQASQIALI
FT                   EAMMDCFLAVAEARRAVGQAQAAEAMYSQARQALTEVHMRAAGINPDRPYESTPGSPAW
FT                   VAAYRAHAHVTGEDPAITTNTILNQKALHATNTNRRVQKPMTPSRPRPWLPIEDERAAR
FT                   DRQAAEAATLQRLATPRRTSTRSTKAPITPPRPARGNNRDTGFER"
FT   CDS             complement(82913..83506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_880"
FT                   /old_locus_tag="pnf2880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_880"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60776"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60776.1"
FT                   /translation="MHQWCTPPGCRVVAALAVGRLRMAGESRNQRAGVRRTRQANVAGG
FT                   RSHRCVVKLSDSEYADLTVRAEAAGMTVPRLLVETTLGKATPEVGRAAAALRALEEGEQ
FT                   DRRALNNLNQLVRYSHQNRELAEGLPLAVAAVVRAALQMDALARWVMGETPSVSPSVIG
FT                   EDQLAAAQEWVERVDNLGVLGIDEDIDDVDGGGV"
FT   CDS             complement(83798..85564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_890"
FT                   /old_locus_tag="pnf2890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_890"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60777"
FT                   /db_xref="GOA:Q5YM14"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60777.1"
FT                   /translation="MTPDHTPAEAVARKAKDQRSAKIERSVTLFTAGIASVVAAQGMYV
FT                   MFSESLHMHPALQALCFAFIELMVVASAMRARRSQIDTGSAGVDGIAMWVLTILSGVLA
FT                   ASHATNDVGLLVLRLAAPLVAAWGWERSMALERRQLTGRAGGMNWRWTPQRLLVKWGIA
FT                   DPTDRTVAEVAVERRLADLALAADAVRIARINGGGRAERKAMQRLHRAIDKATADGIAL
FT                   GKESVRAQLAEHLEGRFSAYTLPNYRPVTDWADHTARAPRPTLDTIESDPAVRAEIAAL
FT                   EREVERELTARATAPLARGDEDHAPVHAAESAIDRAREAVAGGPRADRSLARGEDESRA
FT                   SDPVDRASIAREPIARSRADIGDGRAGEDAVSIAGEVSTARADASVERAESGSEAESIA
FT                   REVEVVDRAPIAQTGPELDTDRDSRADHTPEEQLSNARPGSEERASVARATEGVDRDRR
FT                   AVVSIARDPKPVSPIAREDADRARPSRAGRARSTVIEGALARATEPAPRARLGGHGPFD
FT                   RALSRAEATVIARAVVDRKLSRKSVEELTAIYEAASAGATPNAIGATMGLPHSTVGRAL
FT                   EAATKVSGPRLV"
FT   CDS             complement(85561..86799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF2_900"
FT                   /old_locus_tag="pnf2900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF2_900"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60778"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60778.1"
FT                   /translation="MTNPEQGPAVGADDGADRRVCQFPVAYDPGSGEFAVAGHPLPPAP
FT                   PGRGRKAEYCGEFHVDPDGVRRRHDRAAAFQRKRELQLEAAGGATARPDRPVPRPVTSA
FT                   RASLAELLAQWEMVTTAHRAQQAEIVDRVAEIVATAGDPDAAVAEVARIRAEAQAEIDA
FT                   ARAAAAEAENEALSARRELARAIEDKTLAEGAAEDAIADRDARAAEAAAEVDQARAEAA
FT                   TVIEQARADVAAAHAELEHALTDARSRIAAAEQAAAERVHAIRTETATEIEQIQAAANE
FT                   QIRAAETRVRAASKAQRDAEAERAGAEQAAADARTEAQQLRRDLEVARAELTELTQAAR
FT                   AEREQLRSELASARAEARADREQMRTDHAAELARTQEAANAQVAALRQALDTAHSTISR
FT                   LEDEMARRKGEQK"
XX
SQ   Sequence 87093 BP; 13872 A; 30167 C; 29417 G; 13637 T; 0 other;
     atggcaactg atggtgttct gcgtctgttg ttctcgacgc tcaagggcgg gccagggaag        60
     acgaccagcg caatcctgac cgcgatcgcg ctcagccgtc gtggcctgac cgtggtggtc       120
     atctgcgccg acacccgcac tcggggtgcc acggactggg tgcaggaggc cgagcgggtc       180
     ggtgatgtgg tcccgttccg gttggcgatc tggcacgaga gcgacgggcc gctgtcgcaa       240
     tacgcgcgcg gagttgagcg ttcgaccggc gcggatgtgg tgatcatcga caccggcggt       300
     gagcagccgg agaacttcac gcacggctgc ctgtacgcgg actggctgat cgccccggtg       360
     ggcccgttcc gcgccgagct tcggcgcctg gtgccgacgt atcagagtgc cgccgcagtc       420
     gacgagagcg ggtcacccct ggagatcagc gtgctgctca cccgctgccc ggctgcacac       480
     aagggcaagg cgaaggaggc gcgtgaacag ctcacctcga acctggtggg cgaagacgga       540
     cagctcgacc ccgaggtccc ctacgcgttg gggctggacg tgctcaacac cgagatctcc       600
     cgcggcgtcg cctacgacga gttctacggg ctgatgcctg aggacgtggg ggagtacgac       660
     gcgctggcga acgagatcct cgaccgtcgc agcaggacca gctgatgccg gccccggaac       720
     gtcccaagcg tccgcggtcc cgctcggtcg ccagcgggct gccgtccacc gcccacagcg       780
     acaccgccgc ccgggtctcc gcgattctgg cggagaccgc cagcgcgacc atcgcagcac       840
     ccgatctgca gacctcggcg ccgctgtcgg cgttcgcgca ccggcccgac aacccgaggt       900
     gggcgcgcga gtacgacccg caggcagacc ctgaactcga agcgttcgcc gcgaccgtcg       960
     aggagtacgg gatcctccag gcggtgaccg tctgctccgc ggaggcatgg ctggaacacc      1020
     accccgacga cgcattcggc gccgaggtcc gctacgtcgt gctcatgggc aaccgccggt      1080
     tggccatcgc ccgttacaag aagatcgggc agctgccctt ccaccgcaac gaccgcctcg      1140
     ccgacccgcg gctttcccgt gagagcggga tcatcgagaa ctaccaccgc aagccgttgg      1200
     acccagtgcg tgaggccggc gagatggccg cggtgctcgc ccacaccggc gagagccgcc      1260
     gcgccttcgc cgaccgcata ggcatctccc acagccaggt caaccagcgc ctgcagctgc      1320
     tcgacctcat ccccgaattc cagggcctcg tctccgatct cgccctgccc gtgcacaagg      1380
     ccctcaaggt ggccgcactc ccccatctcg accaggccgc cctgctcgag atgggaccgc      1440
     cctacgatcc ggcccgactt acggatcaga cacaaccgcc ggagccagag agtggaaaga      1500
     ctctttccac caccaaaccc gtccggatcc cgccgcacag cacccccgac gacgtcgtcg      1560
     agcagctgcg caagcagctc gacccgcagc tgctcgacga ggtcgtccgc ctgctcacca      1620
     agtaacactc ggagctcgcg ccgcaggcga gaccgctgag taggggccca ctacggttct      1680
     ggcggtccgg tggccatctg ggtggcccag attgcttcgt gtagttcgtc gtcggtgtcc      1740
     cagggggcga gcgggatcga gggtgggtcg gtgggtggtt cgtcggtgag gtgccagcgc      1800
     atttcgagcc aggcatgcca ggcagcgcgt tgggcacggt ggcgggcaag ggtttcggtg      1860
     cggaggtggt gcaggccgtg gcgggcggcg atgtcgtcga gcgtggtcgg accgagggtg      1920
     acggtgccgc ggccgcgggt gatgagcccg gcctgggcca ggacggcgag gctgtcgtag      1980
     gcggtcgagc gagcgagccc ggccgcggcg atcacgtcct gggtgcgggt cagaccggat      2040
     tcgacgagtt cgtagaggta gcgggcgtgc aggcccagca cgcgccaggc gtcgtgtacc      2100
     tgccgcacct gcacgcgctc gagcgggacc gggtcgacct cgcggtcgag atcctcgccc      2160
     cgccgggggg tgaccagggc gtaggcgtcg gccagcgtgc ccgcggcgcg gcgcacccgc      2220
     aacaccgggc taccgggccg gtcccgcagg tcagcgagta cgtcagccac cgtcccgacc      2280
     gagagcagcc cagcgaacga cgcgaggctg cgaacaccca ccgcggcgac gggagcggtg      2340
     gcgccggcgg cgggctcgcg ggtgacggcg gcggcgtagg ccagggcgtc gaggactgcc      2400
     agcacggtcc accggtagga ctggccgggc caggtcgcga acgtccaggc gtaggcacga      2460
     gcgagccatt cacggtgcga ggtcgcagag atcggggtat tcgagcgttg ggagaccctg      2520
     gggggtgtga gccctggttc cctgtgttcg gaggaccgga ataggtgggc gtggggtgcg      2580
     acccaccggg tgcagatgcg gtcccagtcc tggctcagcg cccgctcggg gtcgcggtag      2640
     cgcgcatacg cctgggccat gcccggccac gcggtcaggt gggcgcggac gtcggtgagc      2700
     gaccagccgc gcagcgcggt ggccgccagc acggcggcac gggcttccga ccgcgatggc      2760
     caccggccat cggcgggcag ggcaccggtc tcggcgaagg cgaggaccgc ggccgggacc      2820
     ggcgtgcggc actgccaggg cgcgcgcagg cgggcatcag cccctgcgcc ctcccacaga      2880
     tccgccgacg ccgaggcggt cgcgggcagg ggagccgccg gggtcggcac cgcttccggc      2940
     gcgccggggc cgaggaaggc ccgcaggcgt tcgagcaggc cgggctcgga ccgctgccgc      3000
     accgcggcca gtgcgtcctc cagcgagccg tccaggaccc ggaaatgccc atcgcgggtc      3060
     gccgacccgg gtggggtgat cgagcccgtg cgagcgttga gcatcggcgt caggtccagc      3120
     gtcggcaacc gatccgccag gcgccgcagc acgggctcga cgtcggcccg gctataggtc      3180
     tcacccgcag cgaagaacgc gaggaggtgg cggccgccat tgccggggtt gcggtcggag      3240
     accacccggg caccgcacgc ttccagccag gcacgggccc gggcggcatc gcgggcgacc      3300
     gccaccggac catgtgcctt ggcgtccagg tccagcacca gcttgtcggt gcgcgccgcc      3360
     cggtcataga cgggcaccgc cgcaggctgt gccggcggcc gcgccggaat ccgggaccgc      3420
     gtccgcaccg tggtgttggt ggccgggtcg atcacccgga tcgcgggata ccccgcgatc      3480
     gctggagcca gcaccgacca caccagctca cggccatcac ccggctgagc tggcggcatg      3540
     gagttgtctg ggggaggtag ctcgtcggcc gctgtcagca aatcgtgacc agcgacatcg      3600
     cgcccgggtc tttggtgctg accacctcgt gagctaccct tagacccgct tagcacaagc      3660
     gttggtcctt aagggccttg aagcgcctcc ggttgccgcc gggggcgttt cgtcatttac      3720
     atggacattt ctaaccagcg atcttgagct gctcggcttc gacgacctcg atcctccggg      3780
     agacctccaa ctcgcggctc aaggcggact cgaagaacgc ccggtaggtc atctgtcgcc      3840
     gcttcgcctc agccttgaca gccgccagca ggtcggcgtc gatctcgacc agttgcggtt      3900
     ttccacgtcg tgctgtcatg cgggctatat aacgcctagt ttcgggctcg acctagccga      3960
     cacgccgcgc cggtgagcac acaatctgtg tccctgcggt gttcctgcgt agcgcttcga      4020
     ttgctcggag ccgttggtcg atcatggcca tccgctcggc acggtcgctg gcattggggt      4080
     ctgccttggt gatctggtcc ggatgctgtc ggtagtagag cccgacgcgg tggatgaacc      4140
     agccagcagc gaatgcgttg gcggtcagca tcattccggt gtcctcggag atgggcagcg      4200
     ccatccatcc tccgatcgcg agcagcaggt cgcgccggat ggtgatcgtg gtcgggtgga      4260
     cgtggaggcg ccagtcgtgg gcgcgccagt actcagcgac ggacccgatc ggaatcgggc      4320
     catcggcagg gtcaccggga aactccttga gggtgccgtc gggcatcagg tcaaggaccc      4380
     ggcatgtggt ccaaccgatc tcgggatgct gggtcagtat ctcgatcgcg tcggcgagcg      4440
     cggtggaggg gagtacgtca tcggcgtcga gattgcggac gtattcaccg cgtgcgcgtt      4500
     ggagcgctac tgtccgtgcg actccagggc ctccatggcg ggcggcgccg gcgcggactc      4560
     gggggtcgtt ctgagctgcc ttgggcagct ccaacggctg cgggtcatcg tgctggacta      4620
     gccattccca ttcccagtct gttggcatct cctggtgtgc caaagactcg tacgcggcag      4680
     tgaggtagtc gagccgtccg tggtgcacgg gggtgacgac ggagatcagc actggtcggc      4740
     tcctgcgggg tcggcgctgt cggtgcggcg ggggtgcacg cgatctgcgg tgtagatgat      4800
     gcggtcggcg acgacgagta tgcgccgggt gtcgagtggc gagtcggatt cgtcgtacgt      4860
     cgtgagcgtt ttctcgtaga ccggcacgcc gataggtacg gccagggcgt cgcgttcctc      4920
     ggctgtgggg ttgcgggtga gtaggaccag gtgctctcgg tgtaggtgaa tgcctgcccg      4980
     ctccagccac attgccgtgt tacgacctgg aacttctgcg tcaggtccgg tcaaaccgca      5040
     ctcgcgagcc aggtccgccc gcatgtactc gcgcgccacc tggtggggcg tgccgtccag      5100
     ggtgtagcga aacgtcctcg cgagcagctc agtgccttcg gagacctgca gcgaggtagc      5160
     cagatcggct gtcgcttcga cccagtcgta ggtgacagtg acctcgactc catcagcgcc      5220
     cgtttcatcc tcgaacgtca gtggcagcac tgagtttccg aacagatcgc gggtgagcac      5280
     ctgcgtcgag cgcacccgga cgccccggcg tggcgccgca gggtcggtgg tgagaatgcc      5340
     ttcgctgaca agcaccatga tcgcccgatt caccggcgca tggctgccca cgccgtactc      5400
     gtctgccaag cggcgcatcg aggggagttg ctcaccgggt ctccattcgc cagcggctac      5460
     ccgacttctc aggcctgcgg cgatgtcgac ccacgccggg ttcgcggaag acacggaaac      5520
     ctcctggttt gttactgcca aacgttgacc tgactcaggt ttggcagtaa caatacctcc      5580
     attgtttttg ttactgccaa acattggagg gagttgcagt gacgatccgt cgagatggtg      5640
     agtggctgac aacgacgcag tcggcgcacg tcgcctatga ggtgtccgag ggggtgttcc      5700
     ggctcagctt cgttccggaa cgcctggtca gcgccgcgca ggccgtggcc ggcctgcagc      5760
     tggccgagat cgtggcccag tgggaccagc tgctgtgggt ggagacgccg aacaccgcga      5820
     tggtgtggcg gttgatggct ggtcaggcgc agggcctgga cttggacgtg ctggatgcgg      5880
     tgatccggat cgagcagagc gagtggccga cctcggctac cgagtgggcg gcgtggttgc      5940
     gatgaggatc cccgaggtct ggacgcttga gatttggcgt cgcgcagctt ctccggcgat      6000
     tccggtggtg cgggtggtcg aggggcacat ggtgtcggag gcgaccgagc accacgccga      6060
     ttacgtgggg cagggctggt gggtggtcga tttcctgccg ggtcgtcagc tgagtgagga      6120
     gcaggcgcgg gcggcgatgc ggatcgcggt cgctccacag cagctggaag tcgagcggtg      6180
     ggccgccaag ctcgggctga ccgcggcgga ggcccgcgcg ttcgtggcca tgccggtggg      6240
     ggtggcgcga tgacccgcga gcgtgtggtg gatgtggtcg tgccgatcgt gcccgacacc      6300
     ggcgggcgcg ggctcggtgt ggtgtcggcg atggcgctgc tggtcgctgg tgtggtgctg      6360
     gccggtctgg ccgtgatggt catcgtgctg ctgtcgttcc cgtcgcggga gtactcgacc      6420
     gtgccggtca ccaggcagtt cggtccgtgt gagccgttct gctcgctgcg caccaccacc      6480
     gccccggcac cggtgggggg tgagcagcgg tgatgcgcag ctaccccgat cccgcctacc      6540
     gccgcgaccg cgcctgcgcg ggcgtggatc aggacgtgtt cttcccggcc ccgtcgggcc      6600
     agcagtcgcg gcggatcgcg ccggcgcggg cgctgtgcgc ggcgtgcccg gtgctggccg      6660
     agtgcgccgg gtgggcagag ccgctggccc gtgccggtga gttgaccggc tgcgtcgtcg      6720
     ccggggtgta cctgcccagc caccacaaca ccgcccggcg cctgcgcgac gcggccgccg      6780
     acgagctggt cgtcatcgcc gctaccggcc gtctcgatgt cgagggggcc gcctgatggc      6840
     cgcctccgaa accgccggtg tggtgcgggt tttccagctg caccgggatc gggatgtgac      6900
     cggctactcg ggcacggggg tcgtcgcgga cggcgtgatc tggcccgacg gggcggtgtc      6960
     gatgcgttgg cgcggcccgg tccgcaccac ggtcgaggcc gcgtgcctgg ccgacattca      7020
     gaccatccac ggccacgacg gcgccacccg cgtcgtgctc ggggccgtca tcacgggagg      7080
     tgcggcatgg accgcagcgt gaaagcccca ggacagaacg gattttcgga gtgggcgccg      7140
     gtgctggtgc ctggcgcggt cggcggcgtg atcgaggcgg cgggggtgtc gttgcgggtg      7200
     ggggactacc tctacgccga caccccgcag acggacgtgc cgtggaaccc gctcgcgctc      7260
     gggatccacc tggccaccgg gcagctggag tggaccggcg cggccaccgg cggcgcggtc      7320
     accctcgcgg ccgggaccgc ggtcacggtg gccgggagca tgtgggcgtg gcgggcgacc      7380
     tgccgccagt gccgcaagct cgccgacaag cgcggccagg tctcgcgcct ggcgcggggc      7440
     aaggcgttcg ggcgcagcgg catccgcaag gaggcgatcg attctcaggc ccgctacatg      7500
     gcgcggggca aggagctggc tgatctgagc cgggaggcga tcctgggcaa ggcccgggat      7560
     ctgcaggtgc agctgcgcgc cggtgacgcc ccgggtgtgc tgatcgggcg tgcggtcgcc      7620
     gacggccgcg agctgtatgc ctcgtatgag gatctgcacc tggacatctg gggtccacgc      7680
     tcgggcaagt ccacctcgcg ggtgatcccg gcggtgatgg aggcccccgg cgcggtggtc      7740
     gccacgtcga acaagcgcga tgtcgtggat gccacccgcg gcgctcgggg tgagcagggc      7800
     caggtgtggg tgttcgaccc gcagggcgtg gcgagcgagc cgtgcacctg gtactgggat      7860
     ccgatcgcgt gggtgctggg ggaggacggc ggcgccggtg cccaagagcg tgccgccgag      7920
     ctggccgggc atttcgccgc aggcggtgag gccgacaagc gggatgcgtt cttcgacccc      7980
     gagggcgaag acctgctcgc gggcctgatc ctggctgccg cggtggacaa gaagccgatc      8040
     acgcaggtgt tcgagtgggt cacctccgct catgaggacg ccccggtccg gattctgcgc      8100
     gatgccgggt tcgggttggt cgccggagcg ctggccgacc agtaccaggc cccggagaag      8160
     cagcgcggtg gcgtgttctc gacggcgaag aagatggcgg cctgcctgaa gtacgcgcgg      8220
     atccagccgt gggtgtgccc gccggccaag ggggacgccc cgcgcaaggc gttcgacgcc      8280
     gcgcagttcg tgcgcagccg cgacaccctc tacccgctga gcaaggaggg caagggcagc      8340
     gcgggcccgc tggtgaccgc cctgtgcgcg gccatcgccg ccgctggcga ggccgagggc      8400
     acccggcacc tgggcgggcg gttgccggtg ccgctgctga tcgtgctcga cgaggccgcc      8460
     aacatcgtgc gctgggccga tctgcccaag cagtactccc acttcgggtc ccgtgggatg      8520
     gtcgtgatga ccatcctgca gtcgtgggcc cagggggtgc gctgctgggg gcatgagggc      8580
     atgaccgcgc tgtggtcggc cgccaacgtc aaggttctcg gcgcgggcct ggacgatgcg      8640
     gcgtttctgc gggaccgctc ggagctgatc ggcccgcact acgagttgac cacctccacc      8700
     agccgcagcc acggccagaa cgggtcgcgg tccacctcga cctcgcgcac cagcgaagtc      8760
     accctgcacg ccagcgatct ggcggcgctg cccaagggcc gggtcgtcat cttcatctcc      8820
     gggcatcgcc cgacgttggg ccaggcggtg ccgtggatgc agcgccccta cgccgcgcag      8880
     gtccgcgccg cgctcgaccg ggccgcccga gccacccacc cacagcccag cgaggtccgc      8940
     ccgcacctgc gggcggtgcc cgcctacccc gacgagttgg aaggcaaatc cgcatgagcg      9000
     acaccacgtt cgagttcgac aacactgccg aaggcgacga cggcgtgacc gcgatgcccg      9060
     cgctggtgat cccgcagatg gacctgggcc agctgctcga cgaggcgatc cgcaaggccg      9120
     tgagtggtca gctcgcggcc gaggcgaaga agatcgccgc tggtgtggtc ggtgagctgc      9180
     tgaccccgga ggtcgtggcc gggatgcgcg agaccgcggt cctggaggcc gtgcgagccc      9240
     tggatcccag ccccgaagct tcgcttcccg gcgagcagga tccgggcgcg gcagaggacg      9300
     acgcggagga agacgcgcct ccgccgctgg agtaccgcac gctggatgcc tttgtccgcg      9360
     actacctggc gatgatgtac cggcgcgagg tcgtcgagcc cggctcggcc aagcacgccc      9420
     gctggtgccc gcgctggtgg gagcacggcg aggcgatcgg ccgcctggag gcgctgtggc      9480
     gggcgttcga ggaagcccgc cacggtgagg gctcggagat gagcacctgg tggctccagc      9540
     acgccgaccc catgatgacc gagctgctgt ccccgaccgg cccgttcaag tactgctcgg      9600
     tgcagcaggg acaccacgaa cggctggccc ggctaccgct ggtgcccgca ccagagggga      9660
     tgttcgagga cgggcacgcc cacgacccgg caccggcggt gctggtggca tcgtcgttga      9720
     ccctccccgc gccgacgcac ccgcgccgac gcacggtcat ggagttcccc gaatgagcgc      9780
     cccagcccgg ccgcagcgca ccgccgcgcc catgcagggc tcgtgggaga cgatcaccag      9840
     tgcgctcgag accgcggtcg ggcccggccg cccgtcgggg gcgtggacga agtactgctg      9900
     cccggtccac gagggcgacg gccgcgggca caagccctcg ctgggcgtga agtacgacga      9960
     cgcgggccag cgcacggtgg tgcgttgctt cgccggatgc gacaacgaac aggtcctcga     10020
     cgtgctcggg ctgcgggttc gggacatgtt cgaccggcgt gtcgagcgtg agggcagtgg     10080
     gcggggccgc cgcgcgaacc ggccccgctc ccggcagctc tcgcgtgccg accgggcgat     10140
     cgacgccgcg ggcctgccgc tgacccagcc gaaaaaacct gacccgggcc gtcagctttc     10200
     gccgtggcgc acggtggcga cctacccgta cctgcgcgcc gatggcaccg tcgccgggga     10260
     ggtcgtccgc aaagaggcgc ggttcgagca caccggtcgt gacaagcagt tccatcagcg     10320
     ccgctggaac cccgagaacg gccggatgga ggccggtggg ttcgacccgc tgccgtatca     10380
     gctgccgcag ctgctggagg cgatcgacga gggccgcacc gtctacatcg tcgagggcga     10440
     aaaggacgtc gcggccgccg aatccgcggg tctgaccgcc accaccaacg ccggcggcgc     10500
     gctgtcgtgg accccgcgcc acgccgagtg gttgcgcggt gcccgcacgg tggtgatcgt     10560
     cgccgaccgc gacccggccg ggtaccggcg cgctgaacgc gtgatggcca ccctgtccgg     10620
     gctggtcgag cgggtgcggg tggtgcaggc cgccaccggc aaggacctgc acgaccacct     10680
     gcagtgcggt cacgagatcg ccgacctcga gccgatcccg tacctggacc ctttcgtctc     10740
     cgccccgccg ccgaccaccg cgccggggcg gcctgcttca tcgaccgaga cctccaccga     10800
     cgtctcggat tctgctgaaa acaccactcc gggaggacat tccgacatgg ccgaatactt     10860
     gctcgcccct tcgaccgaca cacctccgcc gcagtcggac gaggtcgacc acgccggcca     10920
     gcagatggcc gcgttgtggc gggcgctggt gcaccaactg ctgtcgcacg cgttgaaagt     10980
     ggccgaacag cgacgccgtg acgccgagga actggcgcgc cgcaccgccg tggagaaggc     11040
     cgaagccgag gaacggttgg ccctggaacg taagagcgtc gagaccaagc tcgcggccct     11100
     gcgcaaacag ggctgggacg ccgccagccg ggacgagatc gccgacgcac tgacccaggc     11160
     gcgagcgtgg gcgccggatt ccgagcaggc cgccgccacc ttcgacgaac tgcgtcacca     11220
     cctgcaggac cggttcgggc tgcggatcga cccgcgcacc gacgccgtcg acatcgaccc     11280
     cgacgccgcc gcggtggtga cccacctggc cgacttcgag cgcagccgcg cgatcgatgc     11340
     ccgcctggtc gccgcccagg cccggatggt ggaggcggtg ggtgcgctcg acgggatcga     11400
     cgagtccacc aagcaggccc tctacgccga catcgaggcg tggcggacca accccagccc     11460
     gcagcagctc gacgtcctgg ccacgaagct ggccgcagcg aaagtgcccg aacgaacccg     11520
     gacccagatc cggttcaccg cggtctacct ctacgacgcc ggcgcccagc tgaccgccga     11580
     cgagcacgcc gaacgcggcc gccaggcgcc gaccaccctg gccacccaca tcctgcgcca     11640
     gaccgaggct ccgctggtcg accccggcga ggaggccaag ccgcgcatcg acgccctgct     11700
     ggtgtcctac caggaccggt tgcgcaccgg cgccgacacc agctgggtca tcgagaagtt     11760
     gggccgtgag gtcgcggtgc tgaccgagga ggaccgcacc gccgcacgcg agcgaggcaa     11820
     gcagatccgc cacaatcccg ccgggaagtt cgcgccgctg tggcctgatc acgtcgaccg     11880
     cgacgccttg gcggtgacgg tgtcgaccta cgccacgctg cgcccgcagg ccgaccgcgc     11940
     ggtcgtggcc accggcgact acaacaccgc ccaggccgcg ggcctgcgtc agcaggccga     12000
     caagcaccgc aacgccatcg tcaaggccat caaaaccggc aaaggcctgc acgacctgga     12060
     acgcgaccag ctcgccgcgg tgctgcgcga catcgacgcc ggacgcaccc gcccgccagc     12120
     gatgctgttc gtcgacgacc gcagcgccgc tcagcacgac gccgaccgcg ccgggcagat     12180
     cgcctcggaa acctcgcgga tccaccgccg ccagctcgat gagatcctgt ccaccgcgcg     12240
     ggtggacccg gtctcggcgc gggccacccg cgacgagatc acccgcgtca tggacgccca     12300
     gaccgcgctc gcggccgggc ggcagaacct gcacgactac ggcgagtccg gtgtcgagga     12360
     ccggctgcaa gccgccatga ccgccgtcgg tatccccgaa ccggtacgca accaggtccg     12420
     caaccacctc gaccgcgccg ccggtgaggc cgcgatcgcg ggcaagcagg ccaaccggat     12480
     ccgcgaccgc tggctcgacc gccacgaggc cgtcaccacc gcacgatccc cgcagcccgc     12540
     cggcgcaatc gactacgaca gcccgcagcg gcgagagggc ctggaaacca ggctgcgggc     12600
     ctcgggcctg tccgaggact gcatcgccca gcgcatggcc gccgacaccg ggcacgccaa     12660
     gccgccctcg gccgcacccg ccgccgggat ggccaagcgc cgcaccagcc ccggcaccgg     12720
     catgcagcgc atccaccacc gccgcggcaa gggccgaggg cccgagcagg gcctgggccg     12780
     gtgagggtct gttcgccgtg accgtgcacg accggcagcc cgacaccttc ccgtggcggg     12840
     ctgccccagc tcatttgaag acccgtcgcc agctgcgtgc ggccggcctt tcgcctggcg     12900
     ggcaggacgt cgccgcggtg atggtcggca agcgccgcgg ccgccgcctg atcgcctacc     12960
     tgttcgacgt ggggcgggcg cggccgaagc ggacgccctc acccgcccag ctggccgcga     13020
     tcgagaaggc gacccgcgag caccaggccc gcgccgccgc ccgccgcggc tacacccgca     13080
     ccgatctgac caccctcacc gatcccggcc cgggctggga cgaaaccacc acccaccagg     13140
     aggaacccac catgcccaac accgacacca acaccggcac cgtgcccatc gtcgagggcg     13200
     ggcccggcgc gccgacgcgg ctcaccccga gcgggcgcgg gcagcggctg gccttcctgc     13260
     gcaccgtcgc cgcggtcaac caggccaaat accaccgcga gcagctggat cagctggtcg     13320
     tcgaggccga aaacgctgga cggagcgagg atttcggtcg ccggttggcg cagcagctgg     13380
     ccgaggccga ggatcagctc gccgccgagg acccgtggcg caacccgcac gcgctcaccc     13440
     acgccctcgc cgaggccctg tactggtcgc cgggttcgga cctcgccgcc gcgcgggtgc     13500
     agcagatcgg tgagcagctc gcgcaccgtt ggggtgtggt cctggacggg gtcgatcccg     13560
     agacctgcac cgtcggtatc gatcccgcct tcgatgccgc cgcggctcag ctcgccgtcg     13620
     accgtgcggt ggtgcgggcc cgtgagcgcg ccgtcgccga gacgctgtcg cagatcccga     13680
     tgcccgagcc cagccaggac cgggtggtgg ccgcggtcac cgcctggtac gacgccgagg     13740
     gcgccggtac ggccaccccg cacgacagcg acgccctggc cgcgcgcctc gaggagctgc     13800
     acggcgacct gtccgcgctc gacctcgccc agcccgaacg cgaccaagtg aggttcacgg     13860
     tcgactacct gtggcgtgac gtgggccagg tcgacctgct cgacaccccc gtgatggtcg     13920
     accccggcca ggaagtgcgc gggcgggtgc cgcagctgct ccaagccttc gccgagcagc     13980
     ggatcgcccc ggccgagatc ggcgccgaga tctcggtgat gaccgtggcg gatcagcagg     14040
     ccgtgcgcga ggccggccgc gccatccgcg ccggagacga ggtcgatgtg cggctgtggc     14100
     ccggctacgc cgaccgggac cagctgcgcg agcagctcga aacctacgcc cgcgacgccg     14160
     tcgaggccgg tcgagaggcc gactacctcg ccgagaccga cctggccccc ttcgacgccg     14220
     ccctggtcgg catcaacgac gacatcgagg accgcatcga gcggatgtcg ctgagccacg     14280
     accagctgct ggccgccgcc gaggccgcca agggcctggc cccggccgag cggcaccaga     14340
     tccgggcagt cctcgccgat gtcgaagccg gggtcgccga ggactacgaa ctacccgaac     14400
     tgatgtgggt cgacgagcgc agcaaagccc agctcgacac cgaccgcagc caccggcagg     14460
     gcgccgtgct ggcccagacg ttctgccgcg aggcgatgca ggccatcgcc gacggcaaag     14520
     cccagcccag caacgcccac acccagaccc tcgagggcgt gctgtccacg gtgggcgaca     14580
     acctctactc ggtcgcctcc ggcagcgtcg acgacgccca ccgaacccaa ttcgtcaagg     14640
     accgcaccgc actcgggcgg gccctgaccg ccgccggggt ctacgccgag accaaggccg     14700
     acatccgcga actggtcgat acccgtgctc gccaggctgg gaaactcggg cgcggcgccg     14760
     tcgaacgtga gcagcggtgg aagacccgca ccgccgagat cctcgcccgc cgcgacgacg     14820
     ccatcgccca acgccgcgcc gccaacgcca gcgtcgcgcc cagcgcccgg atctgcacca     14880
     cccgacccga ccgtgccacc gggcagagca ccgccaccgc cctgccctcc tacaccgtcg     14940
     gggttcagca gaagcacagc cgcgaggtgg agcggtgacc gacgccgacc tcgtcgagct     15000
     gctggtcatc gcccgcatcg acaccacgac cgcggtcgct gacctgttca gctgccagac     15060
     ctactacgac gccgacaccg ggaccgaaac cggacccgcc gtagaggcga tgtgggagac     15120
     gctgaccgtc gaccccgccg ccccggtctg cctggactcg ctcgaccagg cactcaccac     15180
     ctccggctac cggcgcacca gcgcctggcg caaacgcgtc accgccgccg gcgccacccg     15240
     ctacttcgcc cacgccacca tcgcgatccc cgacctgccc taaacccgca ggcgcgagtc     15300
     agccccccag agcgcgaacc tggggggctg actggtgtca acggatggct gacgactatc     15360
     cgcccgagca acagcacggg tttctcctgg gcagggagcg ttggggtgcc cccaacacgt     15420
     gccggaatga aaggaacccc ggtgatgtgc ctgaccgccg aggcggccgg tagggatcgt     15480
     tccggggttt tctgcgccca gtataacctc agcgaccgtg acgacaattc ccgcccgatg     15540
     gtcagctgcg gatctgcggc gattcttgtc tgctggccgg ttcgaccgct acgtgcaggt     15600
     cgccggctcg gatgcggcgg gcgagcagct atatgagtgg aaccaactcg cctctggagc     15660
     ctggcacgaa acgctcggct cgttcgagat cgtgctgcgc aacgccctcg acgcccagct     15720
     gatcagctac caccagcgca tccgtaaggg caacggtgat tggtacgccg acccgaagat     15780
     gccttggggc acaggcacca ggctggcaca gtccatccgc aaggcacgca gccgtgcaac     15840
     cctgaacaag accatccccg aggtccacgg aaaagtcatc gcagaactca acttcggatt     15900
     ctggcggtac accctcgccg gcacctacca gagcactctg tgggcccagg cctaccggca     15960
     cgccttccca cacctgcgcc cgcggagccg gaccgctgtc tacgatccaa tcgtcgagct     16020
     acacgagttg cgcaacagag tcgcacacca cgaaccaatc cacggcgtcg atcacaccgc     16080
     acggctcaac gacttgctgc aagtcctcgc ctggatcgac ccagccgctg cggcctgggt     16140
     cgaagacacc acgcggatcc cggcagtgct cggcagccgt ccctgaacct cgatcacacg     16200
     acgtcgctac ctctcctgag tcctgatgtg caacttcagg atgtcaatga gcctcctcgc     16260
     ttgatccgga tcgatgtaga gcccgatcgt ggacggctcg cggtttccga cctgctgcac     16320
     ctcgataggg atgtgcatgc ccgagggcag gactccgttg gagcgccagt tcaccgaacc     16380
     gctggtgatg gcgcccaccg acttcaccgt gtacttttcc aggctcttga tctggtcgcc     16440
     caccaacacg agccaccccg agctgccgtc ctcctggtca cggcagaccc agtcgacgcc     16500
     tgcgtcgatc gcggctgagt gaggctcgca gagggcaact tcataggggt agctcgacca     16560
     gccaccgatc ctttgcggat cgaggtcctt ggttcccgcc gccgggctgt ggcagttctt     16620
     cacgaaacac tccattcgag gattgtcggc cctgcatgtg tgcgggaacg caccgccacg     16680
     ccgaaacctc gaaaatctgt tcgagatgcc gccaccccgg cgtcgatttc cgactcgacc     16740
     gctgcggctc ctcgtccgcc gtaatcgggc aggttgtcgg tatccactgc gacactcggt     16800
     gttccgtcgg tcggttcgca aaaggggtag ggggcgaagt ggcacagcgc aggccgtgga     16860
     tcaagcgaaa agtcggccaa gcgaggttgt gggtttggat gccgtacgag ggcggctcga     16920
     accgggagtg gatcctgggg gaactcggtc ggcgggtgcg gccagagtgg aacaagcagg     16980
     atcggcggtg ggaaatcgcc cgtcgtcacc tgtgggtgct cgccgaggcg atggctcaac     17040
     ggttcggtga ggtcgacctg ttcatggagt tctccgagac cgagaagtgc gaccggcgct     17100
     gccaagaagc caccgagacc gatgtcagcg agtgcgtctg ctcatgtttc ggcaagtacc     17160
     acggcggatt tggtgacccg cgtgctgatt ggaaactcgt tggcgccacc accctggtcg     17220
     cgtcgggtcc tttgcaggtg aagcacatgg tgatccgccg cccactgccc cggggtccag     17280
     acaatgcctt cacctcccag ccgcttcctc agcagccagc agtatcgacg cagctactcc     17340
     atgatgtgcc tgagccttcg gcctcgggag catccactgc tactgggtcc accgatgtcg     17400
     gccgagacgg cgaaggctcc gagcgtgcgg ccgagccgcc accggttcaa ccggtgggtc     17460
     gggcggctga agcggagagg cttccggcgg ggtgtgggat cgcgatgttc ctcaccaccg     17520
     taatcgtgtc ggctatcttc gccctggccg tccacgggct gttctggatg ggggccgctc     17580
     tcgcgatact cttcgccgtc gcgttcggcg ccgagcgaat cggcctgctc tagcgccggg     17640
     cctgccttcg aggaccgagc tacccggtgg tgcatgctcc gagttaggca gacacgcacc     17700
     acctgtacag cccactactc gccgtggtgg ccccgcaaga acctcagctc gatctcacgg     17760
     cactgtatgc ccttccggaa ctgggcagtc ctccggtcga tctccggctg gatctccctg     17820
     gcgacctcct cgaggatccc gctgtcggcg aggaccttgt gcagcgactc cttcaccgat     17880
     tccagcacca gtttgtcgaa tgtgaacacg ttgttctcct tgtgcggtcc agcggttggg     17940
     gccgcgcccg acgcacggtg gatctgccgg accgtgaatc agagcctgct cgggcgcgcg     18000
     gagcgcacgg tagagaccag gggcgcaacc gggctgctgg cctcggtcgc cgcagcgtgc     18060
     gagctgcccg cggtcgaggc caccgggcgg cggccgcctc agctcgcccg tagggaactg     18120
     ctaatcggca ggttagtggg ttgcgctctg gcccagagtg gccgtggcgg tgaggctgcc     18180
     cgacgatggc ggcaaccgcg cccgagctgg cggtagctgg aggctagcag ctcgtcgacg     18240
     caaccgtgtc tccgactttg cctgataact gacgttatcg ggcaagatag gctcggaacg     18300
     gctccggcga gctggcacaa cacctcccgg cgcgagacgt tcgattcctg gttatcgggc     18360
     aacctcggcg aaggggagcg agatgggcgc gacgacggcc gacatcgacg acgagacgac     18420
     actgcccttg gcggtgcaca tcgagcagtt cctcaccgac ctcgccaacg ccaaccggcc     18480
     cgccaacacc ctgcgcgcct accgcggcga cctcaccggc ttcgccgaac acgtcgacgg     18540
     cgggatcgac ggggtgaccg tggcggcggt gcgcgggttc ctgtcgggga tcgcggatct     18600
     ggcgccggcc acccgcaagc gcaagcgggc cgcggtcgcc gcgttctgcc ggtgggccgt     18660
     tcgccacgac ctgctggccg cgaatccgat ggacaaggtc gacaccatca ccgtccccaa     18720
     gaccctgccc cgcccggcgc ccgcggccga catcgccaag gtgttcgccg cgatctgcgc     18780
     tcgccggccc cgcaaagatg tcgccctcga cgtgctgcgg gaccgggtgc tgttcgagac     18840
     cgcctacgtc tgcggcgccc gggccagtga ggtctgcgag ctctacgtcg aggacttcga     18900
     cctgcgcctg gacgatgaac acgtccgctt gcacggcaag ggcggcaccg tacgcaccgt     18960
     cctgctcgac gaccgcggct acgttgccat gctgcggctc tacctcgacc gcaccggcta     19020
     caccgccgga cccatgttcc gcgccagcat caacggccgc ggcggaccgc tctcctactc     19080
     cgccgcccac caccggtgga gccgctactg cgccgcggcc ggggtggaca tcgacatcca     19140
     ccagctccgg cattcccacg ccaccgaact catcaacgcc ggcgtctcca tcgaagtcgt     19200
     ccgcaaacgc ctcgggcacg cctccaccga aaccacccag atctacgccc tgctcgccga     19260
     ccaagtcgcc gacacagaaa tccgggcagc acggcggcgg cgggatcgca gcctctgagc     19320
     tgacaccccc ttacgggcag gtaccggcgt cgttcagcga agcgagtcca cgattctcat     19380
     cgtctcgacg gcgaccgtgg tcacccgttt gatcaggtcg acgatgtaag tgggggtgtc     19440
     gtgttcgtca caccagtcgt tggggtcgtt cacgattccc gacgctgggt cggtcttgac     19500
     ctggtaacgg tcgatgaccc acgccaacgc cgaccgggat ccgagtacgt agcggtcggc     19560
     gtcctccggg atcccggtga tggtgacctt cgggttgtag acgatggtgg tgcggtcctc     19620
     gacgttcttg ccggtcgcgg ggtccttctt cttgccccac ttcatcttcg acacccgcca     19680
     ggtctcccga tcgtccgggt cggcggcttt gacctggaca tccagtggat acggctccac     19740
     ggtctcgtag ctggtgtgca ggtccgccag ctggcggccg gcatcggcga gttgctcgaa     19800
     ccgctcccgt gaggtcgggg tggggatgtg cggcagcatc ttcttcaggt ctgcggcgta     19860
     ggtctgccgg taggtcggat cgtggagctg gccgtagacg tagtagaaga tgtcatcctt     19920
     gctgacctcg tcgccgagca catcgcgata cagcttgagg atcccgtcgg tgatgttgtc     19980
     gattctgcgg aagccgtagt catcgatatc gctgctcgtc gcggcaccga agtcgagctc     20040
     cccctcgggg gtgacgacct tctcgtaggt ccaacggggg aagaactgac caccgcttcc     20100
     cgctcctgtg acatggagat caggaagcat gttgagcatg agcaccgaga acggcacagc     20160
     ggagccattc cccacctggt aaaagccaag atttttgtga tgcggggtcg ggaacatcga     20220
     cgggagctgc gaccgctcat ggttgaggtg cttgtcgaag taggtgtgct gtttagcgaa     20280
     aggccggtag aggctgacgg tatggccttc ggtccggtat gtgacctgcg tgcgacgggc     20340
     aaggtgggtg cggagactgc gcgaccactt gatgtagtca gcctgcgctg cagttgggtt     20400
     ggcggtcagg tagtccgtga cggcggcttc gttcggccgg gtgacccctg cggtacggca     20460
     gtagtcagcg aacgggatgt gctggtcgtt gtagttgccg atgagccgct gcacgttcgc     20520
     ggccagattg gtacgcgagt agttgtacac ccacgcatcc ctggtcgtct caagcccgcg     20580
     ggagaagttg gagaagacgg tgacctgttc ccgggaggcg tttttctccc cgatggctgg     20640
     ccaggcctgg tattcgtcgt tgcgttggtt ggcccagtcg ccgtgggtgt tgggggtgat     20700
     ggtctgccag tcgatgctgg tgagggtgct atcggcgatg atgcggagtt tgtcttcgcg     20760
     ggtgaggtag tcgccgatgt cgcggtagta gatctggcag gggccggtgt gggcggggtt     20820
     cttgatgccg atgaagatgg caacggtgtt gcggctgccg gagccgaaga tcttgccgcc     20880
     ctctttacgg gacagttcgc ctgcggtgcg ttggttgccg cggaggttgt aggcgtagat     20940
     gcgggagtat tcgtcggcga gggacaggcg gatgccgtcg gcggtgttgc cgtcgatcca     21000
     gccgccgttg gagacgaagg cgacgatgcc tttgttgccg atgcggtcgg tggcccagcg     21060
     gaaggcccgc aggtaggagt cgtagaggct gttcttgttc gttccggtgg agcgtgcggc     21120
     gtaggtgtcg gcgatccggg cgtcgagggt ggggtaggag atgttggcgt tgaggtcgtt     21180
     ggcggaggtt tgcccgaccg agtagggcgg gttgccgatg acgacgttga tcggggtggc     21240
     gttctggcgg gtgatgcgtt cgttgttctg ggggaagatc atcgagtcga ggctgtcgcc     21300
     gttctcggtg atctggaagg tgtcggcgag cacgatgccc tcgaacgggc tgtactcggc     21360
     ggccgcttct ttgccgagga tcgcgtggta ggtggtttcg atgttcaccg cggcgatgta     21420
     atacgcgagg agcatgatct cgttggcgtg cagctcaccg gcgtatttgc gggccagatc     21480
     cttcggggtg atgagtccgg attgcagtag ccgggtcagg aaggtgccgg tgccggtgaa     21540
     ggggtcgagg atgtggacgt cttgatcggt caggccgcga ccgaacgcgt cgcgggaggc     21600
     ttggtcggcg gcgtggagga tgaagtcgac gacttcgacg ggggtgtaga cgatgccgag     21660
     ggcttcggat tgtttgcgga agcccagccg gaagaacttc tcgtagagct cggcgatgac     21720
     cttctgtttg ccgtcggcgg tggtgacctc ggcggcgcgg acccgcaccg aggcgtagaa     21780
     cccttcgagc ttgatggttt cggcttccag gccggagccg tcgagggtgt cgaccatggc     21840
     ctgcatgacg cgggagaccg ggttgtggga ggcgaagtcg tgctcggcga acagcgcgtc     21900
     gaagacgggt ttggtgatca gatgctgggc cagcatgctg atcgcgtcct cgcgggtgat     21960
     ggagtcgttg aggttgtcgc gcaggccttg gacgaacttc tcgaactcgc cggtcacctc     22020
     gggggaggcg ccggcgagca gggcgcggat gcgggtgatg agggtgttgg cgatgtcggc     22080
     gacgtcggcg gcccagtctt cccagtaggc gcgggtgccg accttgtcga cgatgcgcgc     22140
     cacgatcgct tcctgccatt ccgacaggga gaacaacgcc atctgctgcg ccatccgagc     22200
     accctcatcc ggcgccggac tcccctccgc tgcgttgtcg ccgtggttgg tggtgctgtt     22260
     ggagagggtt tcgtggtcgt cggtgacggg cccgatgtgc ccgcccatca gcatgtcgct     22320
     gcctttgccg gttttctgga cgtcgctgct ggtgttgagg gcgatggagt tgaccatcgc     22380
     gttgaaccgg tcgtcgtggg cgcgcagggc gttgaggacc tgccagacca ccttgaagcg     22440
     ggtgttgtcc gacaaggcct tcgcgggtga gacgccggcg ggcacggcga cgggcaggat     22500
     gatgtagccg tagtccttgc cgtcggcctt acgcatcacc cgcccgaccg actgcacgac     22560
     gtcgacgacg gagttgcggg ggttgaggaa catcaccgca tccagcgccg gcacatccac     22620
     gccctcggac aggcaacggg cattggtgag gatccggcac tcaccctccg gcaccggcgc     22680
     cttcaaccag gccagctcgg cgttgcgctg cagcgcattg aacgtgccgt ccacgtggtg     22740
     gaccgagcag gacaggtcca ggttcgtcgc ggtgatctcg tggccgtcgt cctcgcggtc     22800
     ggcgagcagc tcccggtagg catccaccac cgcgggaaac acttcggcga cctgtttgga     22860
     ggcggcgatg tccttggcga acaccacggc ccgccgcatc ggcggctgcc ccggcgggaa     22920
     ccccaccccc tcgggggttt tcccggcacg tttggccagc ccgttccagc agcccacgat     22980
     cttcgacgca tcatccagcc gcagctcgct gaaccgcccg gccaactgct gctgcaaggg     23040
     cgcggcgacg aggtcttcgt cgacggtcag cacgatcacc ttgtaatcgg tgagcaaacc     23100
     ccgctcgacc gcggcaccga aggacaggcg gtggaactcg ggcccgtagc gggtttcgtc     23160
     gtccatcgac gacagctcgg cggagtgttc ggcggccttg tccttgacgg tctcgtcgaa     23220
     gatccgcggc gtggccgtca tatacagccg ccgctgcgcc ttcagatagt cgccgtcgtg     23280
     cacgcgcacg aagttcgact cgtcatcgcc gaccagggtg acaccggtgg tgcggtgcgc     23340
     ctcatcgcag atcaccagat cgaacggctc caccccatgc tcagcctgcg cgccggccac     23400
     ggcgggcagg gactggtagg tggtgaacac caccgtcaac cccgccgcat ggcggcggcg     23460
     ctccatctcc gcagccagca ccgccgagct cgtggtcacc gggatcgcga cgtcgtggac     23520
     cgagacgtcc tcggccgagc gggagacctt attgtccgag cacaccgcga acgcccgcag     23580
     atccagctgc gtctgggccg tccactcccg caacgtttgc gacagcagcg agatcgacgg     23640
     caccgcgaac agaatccgcg cgttgccgcc gttctcgacg gcggtgcgtt cggcgatctt     23700
     caacgccgtg aacgtcttgc ccgtcccgca cgccatgatc agcttgcccc ggtcgtggcc     23760
     ggcggcgaaa ccgttgaaga cggcgtcgat ggcctgggcc tgatgcggtc ggggctcgtg     23820
     gcgcttggcc tccgacaggc tgacctgcag ctcaccagcc ggccaggcga tgtcccagtc     23880
     gatcggggac tccgcgatct cggccagccc gatccgctgc accgggatcg tctgatcctg     23940
     cagggcgtcc tcggcgttgc ggccccaccg gtcggtggtg gagatgatca cccggttggt     24000
     gaacggcttc ttccccgaag cggtgaagaa cgagtcgata tcgcccttgg ccagcacatg     24060
     agtgggctcg taaaacttgc actggatcgc cgtcaacgcc ccggtatcac gctcccgggc     24120
     gaccagatcg atcccggtat ccggtttacc tgcccggtcg ggccagtcgg tccaccgcca     24180
     caccttgtcg tactgctggg ccagcatcgg atccaactcg aagtagcgga ccatcaactg     24240
     ctcgaacttg gtgccccgct ccgagttcga cggcgccagc cggaacgcct cgatgacctc     24300
     gtgaacagaa cccataaccc actcacacct tccccacgcc aacaaccgac ccggtcatct     24360
     tgcccaggcc cgcgcccaca gccagagcgg cataggcggt caggacggta tacggcacag     24420
     taccgcgcaa cctcgggtcc gaagccgcaa gtggtgggtc gccgacgtca gcaggtcctc     24480
     cgccagcaac ggcaccgccc agcgcgacgg cgtctggcac gacaccatcc tgctcgaacg     24540
     ccgctccccg gtccggtaac cgcagccctg gcggacgggc cggtgttcac cggctgttcg     24600
     tttgcctccc ggtatcgata tcggtcaata ttggcgtatg tcgaagtcga agttggtggt     24660
     gacgcctgtg caggcgtgct cggccgcgcc cctggtgcgc gagccgctgt ccgaacccca     24720
     cgccgtcgag ctggccagcg tgttcaaagc actctcggac ccggttcggc tgcgactgct     24780
     cagcgccatc gcctcgcgcg agagccagga agcctgcgtg tgcgacctgt ccgcgggcat     24840
     cgagttgacc cagccgacca tctcccatca cctcaaggtg ctgcgcgaag ccgggctgct     24900
     cgacagcgaa cgccgcgcct cttgggtgta ctaccgcgtc gtccccgaag cgctgcaacg     24960
     actctcggaa gtcctgctcg tggagagcgg caccgcgatc ggagcccccg catgagcgtg     25020
     aacaccaccg accaacccgc cgtggtcgcc aaactgtcca ccctcgaccg gttcctgccc     25080
     gtctggatcg gcgtggccat ggccgccggc ctgctgctcg gacgcatgat ccccggcctg     25140
     ggcgacgggc tgtcggcggt ggagatcgac ggcatcagcc tgccgatcgc gatcgggctg     25200
     ctgatcatga tgtacccggt gctggccaag gtccgctacg accgcctcga caccgtcacc     25260
     ggcgaccgca aactcctgct cagctccctg ctgctgaact ggatcctcgg cccggctctg     25320
     atgttcgccc tggcctggct gctgctgccg gacctgcccg agtaccgcac cgggctgatc     25380
     atcgtcggcc ttgcccgctg catcgccatg gtcatcatct ggaacgacct cgcctgcggc     25440
     gaccgcgaag ccgccgccgt gctggtcgcg ctgaactcgg ttttccaggt gatcatgttc     25500
     gccggactcg gctggttcta cctctcggtc ctgcccggct ggctcggcct ggaacaaacc     25560
     acgatcgaca cctcgccgtg gcagatcgcg aaatcggtgc tgatcttcct cggcatcccg     25620
     ctgctggccg ggtacctcac ccgccgcttc ggtgaacgcg ccaagggccg tacctggtac     25680
     gaatcggcct tcctgcccaa gatcgggccc tgggccctgt acgggctgct gttcaccatc     25740
     gtgatcctgt tcgccctgca aggcgaccag atcacctccc atcctctcga tgtcgtgcgg     25800
     atcgcgatcc ccctgttggc ctacttcgcc atcatgtggg gcggcggcta cgccctcggc     25860
     gcggtcctgg gtctgggcta cgagcgcacc accaccctgg cgttcaccgc cgcgggcaac     25920
     aacttcgagc tcgccatcgc cgtcgccatc gccacctacg gcgccacctc cggccaggcc     25980
     ctcgccgggg tcgtcggccc gctcatcgag gtccccgtcc tggtcggact ggtctacgtc     26040
     tcgctcgcgc tgcgcaaacg cttccccgcc accatctccc cggcggcgtc gtcgggcacc     26100
     ggggagatgg cgccgcgatg agcacgaccc cgtcggtgct gttcgtgtgc gtgaagaacg     26160
     gcggcaaatc ccagatggcg gccgggctga tgcgcgccgc cgccggtgac ctcgtgcagg     26220
     tccattccgc cggaacgaaa cccggcaccg cgatcaacgc cctgtcggcc gaatcgctgc     26280
     tcgaagtcgg tatcgacatc agcggcgaga ccccgaaacc gatcgacccg gccctgctgg     26340
     cctcggtcga cctggtcgtc accctcggcc gcgaagccca catcggcccg gtcgacgggg     26400
     tgcggatcct caactgggac accgacgaac cctccgaacg cggcatcgac ggcatcgaac     26460
     gcatgcgcct ggtccgcgac gacatcacca cccgcgtcaa caacctgctc accgaactca     26520
     ccacccccat cgagcaacgg acacacccat gaccgacagc ccctcccaca cccgccacga     26580
     cctgaccatc gaccagcaac tcgcgctgaa aaccgcggcc acccacttgc aacgtgagtt     26640
     caacggaacc ttcggcgtcg agaccatcga gcggttcctg cactcctcct acgaccagtt     26700
     cgccggacgc gcgaccgtgg tcaactacct gccgctgctg gccgaacgct tcgcccgcca     26760
     acgcctgcac gccctggccc gcgtcgaggg caaagcccac accggcacac ccacggtgtt     26820
     gttcctgtgc acccacaacg ccggacgctc ccagatggcc ctcgggttct tcacccacct     26880
     tgccggggac cgcgcggtgg cgtggtccgg cggcagcgaa cccggcgacg agatcaatcc     26940
     cgccgtgatc gccgcgatgg ccgaggtcgg catcgacatc accggcgagt tccccaaacc     27000
     gtggaccgag gagatcatcc aggccgccga cgtcgtcatc acgatgggct gcggtgatgc     27060
     ctgcccgctc tacccggggc gccggtatga ggaatgggac atcgacgacc ccgccgacct     27120
     cgacctcgcc gccatccggc ccattcgcga cgagatcgaa acccgcgtcc gtctcctgct     27180
     cgccgaactc gacctccccg cccactgaaa ggcccacccg cacatgacca ccaagcccag     27240
     cgtgttgttc gtctgcgtcc acaacgccgg acgctcccag atggccgccg gattcctgtc     27300
     ccacctcgcc ggcgacgcca tcgaggtccg ctccgccggc agcgcacccg ccgatcagat     27360
     caacccggcc gcggtcgcgg caatggccga actcggcatc gacatctccg accagacccc     27420
     gaagatcctc acctacgacg ccgtggaaac ctccgacgtc gtgatcacca tgggctgcgg     27480
     ggacacctgc ccgaccttcc ccggcgtcag ctaccgcgac tgggtgctcg aagaccccgc     27540
     aggcaaggga gtcgaatccg tccggccgat ccgcgacgaa atcaaggctc gcgtggaagc     27600
     cctcgtcgcc gaactcctgc ccgcgcgcgc ctgaggcccg ccccgcccgg aggccgcggc     27660
     cacacacggc tgccggcctc cgggcgggag tccgatccac tacagggctg taggaactcg     27720
     tgagatgacc actcagcgca accgtcacca cagcactgca cgcattctcg tcacctacgt     27780
     cgccgtagcc acagcgctca ccgcagcact gtccgagctg cgcgacgacg catggccccc     27840
     acacgcgaaa ctccatgccg cccaatacat cctcgtcacg gtcgggctca gtgtgatcgc     27900
     gatggtcctg ctgtggcagc gcggaagcgg ggcacgaaca cccgtgatca cggcctgctc     27960
     gatcctggcc acgccatggc tgggcctgct ggctgcacca ctgtttcccg gcacctcctt     28020
     gcacaaaccc cgaccggaca accccctgct cctcggccta cacccgcagc tactcctggc     28080
     cactgtcatg ctggcgctgc tgctcgccgc cgtcgcgctc accacccgag catcaacgac     28140
     cggaacggcg gcgcgctgac gggtcgctgt cggcttggaa ccggcgaagc ccctcgtcgg     28200
     agacccgcgc gtacttcacc aggctgcgca ccgaggtatg cccggacagt ttcatcagca     28260
     ccggcgtcga ggcaccgtcc tccgcggcgt gggtcagccg ggaatggcgc agctggtgca     28320
     gcgtgtaggg gccgtcgtcg aaggcgaggg tgtgcgactc gaacagctcg gccgcccgcc     28380
     gatacgacag ccgcgcccgc cccgtactcg ggtcgacatc gttgaccgct accgagggcc     28440
     gggccttgcg gtcggtcagg aacaccggcc cggacttgcg cccggccagc atcctgggca     28500
     gtaggggtag ccgtagcatc cgccgaaaat caggcggata tggcgtagcc gcctggtagg     28560
     catcgggttt cgggttcggc atgcgctgtc ggctggttgg tgcttggctg ccggtgatgg     28620
     tgttggtcgg cgctggtgga ggctggggtt cgtggcgacg cggatgttcg cggacgagga     28680
     attggaacgt ctgcggggat tcccggagat cagccgcgag gagctgtttc gatacttcac     28740
     gctcacgtcg gcggatctgg cgttcgtgga tccgggccgc ggccggggac cggccgaacg     28800
     gctgggcttg gcgatcgcgt tgtgtacgct gccgtggctg ggattcgtgc cggatcggct     28860
     ggtcacggcc ccaccggtgg cggttgctcg tatcgccgag cagttgcggg tggatccggt     28920
     ggtgatcggt gcctatggca ggcgagccaa gacccgcacc gagcatgtgc gcctggccgc     28980
     gcggtacctg ggatggcgtg cggccggtgc gctggagttc aaggagctcg atgagttcct     29040
     gctggcgcgg gcgatggagc acgattcgcc gactctgttg ttccggctgg ggtgtgagta     29100
     tctgatctcg gcgaaggtga tccggccggg ccctgtcacc gtggtggagc gggtcgccca     29160
     cgcccggcac caggcccaga ccgaaaccta tgatcggctc gctcacgagt tcactgcggc     29220
     gcggtgtgcg gagttggacg gcttgctggt gaccgacgcg tcgctgggga tttcgcggtt     29280
     gcggtggctg tcgacggggc cggtggaggc gtcggcggct gcggtccgcg ctgaggtcga     29340
     caagctgggg tttctgcggg gtttgggtgc tgatcggctg gatatgtcgg tgctgcccgc     29400
     cgagcggcgc cggttcttgg ccacgatggg ccggcgtctg agtccgcaag ccctggagcg     29460
     tcgggatccg cagcgccggt atccgatcct gctcacggtg ctggcccagt cgggcaccga     29520
     tgtgctcgat gaggtcgtgg cgttgttcga tcaggcgatc tcggcgaagt tcggtgccgc     29580
     cgaacggaag atgcagcagc agctggccga gcgcggcaag accggcgagg accgccaggc     29640
     gctgctggac gatctcctgg aaatcgtcac cgacccgacg gtggctgatg aggagatcgg     29700
     cgcgctgatc cgcggcgaga agatcgggtg ggagcgcctg cgcgcggcga tcgcccaggc     29760
     cgaacccagg ttgccgcgtg atcacgggca tctggcagcg ctggattcct cctacaacta     29820
     tctgcgccag ttcacccccg cagtgctcga ggcggtgcgc ttcgccggcg gcaccgccgc     29880
     taccgagctg ctgatcgcgg tgaacatgct gcgggagctg aacgcgaccg ggcggcgcaa     29940
     ggtcttcgac gacgccccga ccgggttcgt gccgatgaaa tggcgcggct acctcgacga     30000
     ggccgcccga aaatcgggca gcgccaccgc gtatcggcac tactgggagt tgtgcgtgct     30060
     gctgggtttg cgtgacgggc tgcgcagtgg ggatgtgttc gtgcccggct cgcgccgcta     30120
     cgccgacccg gccgcctacc tgctcaccac tgggcagtgg gaaccgcaac gcggagagtt     30180
     ctgccgcctg gtcgggcgat ccgccgatcc cggcgtcgcg ctggcggccg tggtcgccga     30240
     actgcacgat gcggtcggtg agctggaggc ggtgctggcc ggcggggacg gcccggtcag     30300
     ggtggacgag ggcggggatc tggtgatctc gccgctaagc gcggaagatg ttcccgccga     30360
     ggcgatcgcg ctcaaggccg agctgaccga gatgctgccg ttcgcgccga tcgtttcctt     30420
     gttgatcgag ttggacaagc gcaccggcta cctggactgc ttcacccacg ccggcggcca     30480
     ggccacccgc acaccagagc tcaaacgcaa tctgatcgcg gtactgctgg cgcactcgac     30540
     gaacctgggg ttgacccgga tggccgaggc gtgcgggatc acctacgaca tcctggcctg     30600
     gaccgatgag tggtatgtgc gcgaggagac cctgcgcgcg gccaacctca cgctgatcga     30660
     ctaccatcag cggctgccgc tgaccgcggt gttcggtgcc ggaacgctgt cgtcgagcga     30720
     cgggcagcgg ttcccgacgc gcgggaaatc aaccacggcc aggccgttga gccggtattt     30780
     cgccagcgag ggcctgtcga cctacaccca tgtcaccgat cagcatgcca cctacggcac     30840
     caaggtgatc gtggcgacca aacgcgaagc ccattacgtg ctcgatgaga tcctgggcaa     30900
     cgccgcggat ctgccgatca ccgagcacgc caccgacacc cacggggtca ccctggtcaa     30960
     cttcgggttg ttcgacctgc tcgggatgca gctctcgcca cggatccggg atctgggccg     31020
     gatcaccctg taccggccgg gcccgcgcgc gcaggccgag gcccggttcc cgcacgcggg     31080
     cccgctgatg acccgcaagg ccaacctggg tttgatcgcc gagcactggg acgatctgct     31140
     gcggttggcc ggatcgctga agttcgggca cgccaccgcg tcgctgctgg tcggcaagct     31200
     gtcggcgtcg gggcggcaga acactctggc cgcggcgctc aaggagtacg gagcgctgcg     31260
     gcgcaccatc tacgccgcga ggtacctctc cgatccggac tatcggcgca agatctcgcg     31320
     gcagctcaac aagggcgagt cgctgcacgc gctgcgccgc gacctgctct atgcccacga     31380
     ggggatgatt cgggcgcgcc atctcgagga ccagaccgag caagcctggt gcctgacctt     31440
     ggcgaccaac gctgtgatcg cctggaccac agagtattac gggctcgctg tcgatcagat     31500
     gcgccgcgcc gggcagcgta tcgatgacga ggtcctggcc catctttccc cagcgcacag     31560
     tgccaacatc aacttcttcg gcgcgatcga ggtcgacatc gacgccgagc tggcccagct     31620
     gggcccgacc gggtaccggc cgctgcgggt gcgtgacacc ttgttctgac tgcgcggccg     31680
     atctgtggtt acggtctgcc ggtgccggtc gggctggttg atgcggtggc tgttgagtga     31740
     gcggtgagga agttgtcgac gagccgggcg cagtcgtcgt ggtcgatggt gcgtagtccg     31800
     gtgaggcggg cgaacacgat cgggccgagg agttcgatga tggcgaaggt ggtgtcgagt     31860
     tcgccgagtg tggcgcgggc gtcggggctg gtgaggatct ggtcgaacgg tcggcggtat     31920
     tgctcgatga cgcgggcgcg tagtgaggtg agcgcggccg ggtcggtgtg gttgtcgtcg     31980
     atggatccca tggccagcca ggccagggtg gtcatctgta ccggggcctg ttcgatgagg     32040
     tcggcttggg tggtgagcag cgtgaggagc tgctcgcgta ccggggtggt gccggtgggg     32100
     gcgtcgacgt gggggagcag ccgttcgaag gtcgccgcga gcagatgggt ggtgctgccg     32160
     aagtgccggt agagggtggc gcgcgcgact ttcgatacgc gggtgaccgc ttcgacggtg     32220
     accgcctcga caccgccggt ggacagcaga tgggtggccg cgtcgagcaa ccggttgcgt     32280
     gagcgtgcca gccgcggatc ggcctgctcg tcgtccgcgg ggtgcgggtc ggtcatggac     32340
     gcgtgttcct ccggttcgtg ccgtgcggct gtgggtgtga gtggactcta tcccacaccc     32400
     cgacccctat gatacgaatg gtctcgcaca gagactatcg gtctctaaag tcgggaggtg     32460
     ccggtggaca cgcctgggac ggacactgtc gagatcgccc ggtggacccg ggccgagtgg     32520
     tggatgctga cggtgtcgtg cctggcggtg gcgctggtgg tcgcggcgat ggcggcgttg     32580
     tattcggcgt tgccgcagat cgcggtcgcg accggggcca cccaagctca gctgacctgg     32640
     atcgtcgacg gctacacact ggtgctggcg tgtctggtgc tgcccgccgg cgccgtcggt     32700
     gaccgttacg ggcgccgtgt ggtgctggtg gcggggttgg tggtgttcgc cgccgcctcg     32760
     gcgctgccgc tgctgctgga cgagccggtg tggctgatcg cgacgcgcgc gctggccggg     32820
     gcgggcgcgg cgctggtgat gccctcgacg ctgtcgatcc tgaccgcggg gttcgcccct     32880
     gttcatcgcg gccgggcggt cgggatatgg gccggggtcg ccggatccgg ggcggtgctg     32940
     gggatcctcg gtgccggggt gctgctcgaa cgatggtcgt ggccctcggt gttcgtcggg     33000
     ttgaccgtgg ccgggacggt gctggcggtg ctggcgtgca ccatcgccga atcccgccac     33060
     cgtgagcatc cgccggtgga ctgggtcggc gcgggcacgg tggcggtcgc ggtcgccgcg     33120
     atcgtgttcg ccgcgatcga ggtccccgca cgcggctggg ccgacccgct cgtcgccgcc     33180
     gcggccggga tcggtgtggc cgcggcggtg gcgttcgtgg tcgtcgaact gcgcagcgcg     33240
     gcgccgctgc tggacgtgcg gttgttcacc cgccgcggtt tcggtgccgg gtcgctgtcg     33300
     gtgaccatcc agttcctggt caccttcgga gtgttcctgc tgctggtgca gtacctgcag     33360
     ctgatcttcg gttacgggcc gctggcctcg gcgctggcac tggcgccgat ggtggtgccg     33420
     ctggtcgcga tctcggtgat cgcgccgtgg ctgtcgagcc tggtcggatt acgggtgatg     33480
     accgtgaccg gcctgctcac catcgccgcc gggctggtgc tggtgagccg gttgaccctc     33540
     gccgcaaact atcccgacct gctgtggccg ctgctgatca tgagcgcggg cctgggattg     33600
     tgcaccgccc cggcaaccta tgccatcgtc gccgacaccc cagaggccaa acacggggtc     33660
     gccgccgcgg tcaacgacgc cgcccgcgag atcggcgccg cgatcgggat cgccgtggcc     33720
     ggcagcgtcc tcgccgccgg ctacacccac cgcatccagc ccgccttggc ccggctaccc     33780
     gagcccgccc gcggcccggt cgccgattcc ctggccgccg ccctgcaagt cgccgaccag     33840
     gccggaccgg tggccgcgcc gctggccgag ttcgcccaag ccgcgttcgt gcacggcagc     33900
     ggccaggccg cgctcgcact ggccgccctc accaccgcca cagcgatcgt gctggccgtc     33960
     ctggcccccg gccgcacacc gcgcccgcac accaggacgc cctcaccggc accgcactcc     34020
     cctcctggtg aaagacgccc gtcatgatgg gctaccgcac gagcatcgtc ggcaccgacg     34080
     gatccggccc tgcccgtact gcgccagttg gctgtcacca ccgccggtca ccgctgctgg     34140
     cccggctgct gtccacccca ccgatcgagc tcgacggcaa agcccactgc gacatcctca     34200
     tcaccgccta aacacactca cagaaagcgc ccatgaccga gaacacaccc agcactgaca     34260
     cacccgagcc ccggcaggtc ccggactgga tccccgcctt ccccgtgctc gcacccgact     34320
     ccgtcgacct gccgccccac cacgaccact gcctgggctg cggaccggcc aatccccacg     34380
     gccaccggct acgcgcccga cgcgacgcac acggcgtcta cgcccaccac cgcttcgact     34440
     cccgccacgt cggcgcccca gcgatcgccc acggcggcgc ggtcgccacc gtcctcgacg     34500
     aactgttcgg actcctgctc tacaccgtcg gggaacccgc cgtcacccgc cacctcgcca     34560
     tcgactacct cgccccgatc ctgctcgaca ccccctacac cctccgcgcc cacatccact     34620
     cccgcgacgg ccgcaaactc cacctgaaag ccaccatcga aaacgaccgc gcccacgtgg     34680
     tcaccaccgc caccgccctg ttcctcatcg tcgacgtcaa ccacttcctc accccacaac     34740
     acacccccac acaccgataa cacccccctg acctgttccg taacccgatc cgtaaccgga     34800
     acaccacgca gaacgaacat cggcccagca caccggtgtt ccgtagaggt gttccgcaaa     34860
     ctgtgccggt caacccccgc catctggaac actttcggca tgggtgagcc gttccgcatc     34920
     ggatactgcc gctgctccac cgacgaacaa gacgtcgaga tccaaaccga acaactactg     34980
     gcgctcggag tgccgcgcga gcggatcttc atcgacaaag ggttctccgg gaccacccgc     35040
     aagaaccggg ccggcctgga caacgcactc gccgccgcca cctccgccgc agcggccatc     35100
     gacgagcgac aggtagtgct gaccacgacg aagttcgacc gattcgcacg caacatggcc     35160
     gaagcaggcc agaccctgac cgaactgcgc gagcgcgatg tgctgttcgg actcgggagc     35220
     tcgatctacg actgggcaga cccgttcggc aagctgttcc tgcaaaccct cgccatggtc     35280
     gccgaattcg aagccaacct caaccaccta cgcacccgcg agggcatggc caaagcccgc     35340
     gcaaaaggca gactcaaagg caaacagccg aaactacctc tcacggcacg gaaaacaatc     35400
     caccgccgct accacgaccc cgccgacgac gcgagcctcg ctgacctcgc cgaggaatac     35460
     agcgtcggcc gctccaccat ccaccgcatc gtcagcaatg ctccaccacg agcctgagaa     35520
     ttcaccagcc tgtcgtaaag accccgctac ttcgcacttc ctgacaaccc ttgggttgcg     35580
     ggcccttacg tcccacacga gtcctgaccc gaatcggatc gtcggcgagc tgggcggata     35640
     cgccgcgccc accaggagcc ggtggcgaga cagacgatcg tttcaaccca acaggccgag     35700
     cggatcatcg accagacaca acgccatatc cgcccgattt tcggcaaatg ctacggctac     35760
     cccggtgtgc gctgctgggg cgaggacggc atgaaggcgc tgtggtcggc ggcgaatgtg     35820
     aaggtcatcg gcggcggcct ggacgacgaa gcgttccttc gcgcccgctc ggagttgatc     35880
     ggcccgcact acgagcagtc ggtctcggtc agcaaagccc agggcgggca ccgctcgcac     35940
     tcggtgtcgc ggaccaccga aatcaccctg cacccgagtg atctggcggc gatgccgcgc     36000
     gggcggtgcg tggtgttcac ctccggcaac cgggccacgc tcgcccagac cgtgccctgg     36060
     atggaccgcc cctacgccgc ccaaatcgcc gccgctctcg acgaactcgc caacgccacc     36120
     gagcccgtgc ggccgcggtt gcaggtggtg ccgccactgt ccgaccagaa aggcaaaacc     36180
     gcatgaccag caccgatatc ccgaccagca gcagcgacat cgacatcgac ctcaccaccc     36240
     tcgacaccga caccgacacc ggggcagggg ccggggcggg ggtcggtggg gtggtggagc     36300
     tgaccgaggc gttgaccggt gcggtccgca aagcgatcgc ttcccaggtc gccgaggccg     36360
     cccagctcat cgccaagggc gcactcgatg aggtcctcac cgaggaggtc gccgaggaga     36420
     tgcgggtcgc ggcggtgcgt gacgcgctgg ccgcggtcga cccccagcag ggtgaggacc     36480
     cggtcgagaa gctgaagtac cgcaacctgg agctgttcgt ctccgagttc ctcgcccgcg     36540
     tctaccgccg cgaggtcacc cgggagggga gccagaagaa ggctcgctgg tgcccggtgt     36600
     ggtgggacca cggtgaggcc gtggcccggt tggcggcgtt gtggcggtcc ttcgagcgga     36660
     tgcgccaggg cgacggggtg gagatgtcgg tgtggtggct gcaccacgcc gacccgatga     36720
     tggaccgcct gctcgatccc gagaacgggc cgttccgcta ctgctcggtc gccgatgggc     36780
     atgtgcggcg cctgaccaag ctgccggtcg tggagatccc cgacgcgctg aagttcgccg     36840
     acggctacat cgaggaccag cagcccgaca ccaccacggc ggcgctgccg gtgacgagtc     36900
     tctacctgcc gcccgccacc gggcaggccc gccgggtggt catccgggag tttccctgat     36960
     ggccgtccca gcacatgagg cgggtcgggg gtcgtgggtg cgggtcacca ccgcgctgga     37020
     gcaggtggtg ggcccgggcc gtccgtcagg gtcgtggacg aagtactgct gcccggtgca     37080
     cgagggtgat ggtcgtcatc atcggccgtc gttgtcggtg aagtatttcg gcgacgccgg     37140
     ccgcacgaag gtccgctgcc aggccgggtg tgaggacgaa ctggttctcg acgcggtcgg     37200
     gctgcgggtg gccgacctct acgacacccc gttgcggcgc ggtgagcgtg gggcgcggtc     37260
     cggtccggcc cggcgcccag ccaagcgggc ggaatcccga tccgatcgtg ccctgcgcgc     37320
     ggcgggcatc ccggcgcaca aacccaaacg tgacctcggc gcgcaggttt cgccgtggag     37380
     gtcgaccgcc acctacacct acgtccgcgc tgacggcacc gtcgccggtg aggtcatccg     37440
     ccgcgaggcc gatttcgagg gtgggcggga caagtcgttc tcccaacgct cctggaactc     37500
     ccggcacggt ggttgggagc gcaccggttt cgacaagatc ccgttccagc tgccgcaggt     37560
     tcgtgaagcg atcgccgccg ggcgcaccat ctacctcgtc gagggggaga aggacgccct     37620
     caacgccgcc gcagcggggt tggtggccac caccaacgcc ggcggcgcct cggggtggtc     37680
     gcccgagcat gccgagtggc tgcgtggggc gcgcaccgtg gttatcgtcg ccgaccgcga     37740
     cgcgccgggc tttcaccgcg ccgaccgggt catggccacc ctgtccgggc tggtgggacg     37800
     ggtgcgggtg gtgcaggccg ccaccggcaa ggacctcacc gaccatctcg aggccgggca     37860
     tcggatcgct gatttggtgc cgatcccgta cctggacccc tacacccgcg ccctgaccgc     37920
     cgtgcccacc ccgccggcca ccacgaccgc ggcggtggcc ggaccggccc caccgccctc     37980
     tgcggtgtcg cccgcgcccg agttccccgc cgaaacgccc tctccccaag gacatccgat     38040
     gcctgaatcc ttgctcactc ccgccgccga gacgacaccg cattccgacg aggtcgacca     38100
     catgcacagt cagtggtcgg tgttcatgaa gttgctgatg cagcagatgc tgctgatggc     38160
     gaccaaagcc gtccaccagc gcgcggccgc cgccgccgag gcggcccgca agtccgaaca     38220
     agccgcccgc gacgccgagg aacgcgccgc cgcggagatg gccgctgtcg aagtccggct     38280
     gcgcaaactg cgccagaagg gctacgacac cgcctcacgc accgagatcg ccgacgcggt     38340
     gcgcgacgcc gcgacgtggg gcgatcagag cgaggtcgcc ggaaacgaac tcggccacct     38400
     ggccctgcac gtctcgcgcc gttggggtgt ggagctcgac ctcgacactg ggcaggccag     38460
     tatcgccccc ggcaccgatg cccagcggtt ggccgagatc gagcaggacc gcgccgctgc     38520
     cgcccgcgcc cgcaaagccc aagaccggat ggtcgagatg gtcgcgcgtg aagacgatct     38580
     cgacgagtcg gcgaaggtgg gaatctacgc cgcgatcgag tcctggcgcg ccgatcccag     38640
     cgccgagaag ctcgacgcgc tgacccgcca gctcaaagac cgcaaggtcc cccagcagac     38700
     ccgcacccgg ttgcggttcg tcgccgccta cctcggcacc cccgccgcga tcggtgatga     38760
     ggaaaacgcc gacatcaaga cggtgtcggc ggctgaggag ttgagtcgtc acgccacacc     38820
     gttggtggat ccaggggagg aggccaagcc gcgcatcgac aaactgctcg agacctatca     38880
     ggagcagctg aaggtggggg cggacaccag cgaggtgcgt gaggaactcg cgcgtgaggt     38940
     cgcggtcctg accgtggagg accaggaagc cgcccgcgcc cgcgggaagg cgatccgcgc     39000
     caaccccgcc ggggcctatc cgcggatgtg gcccgatcac gtcgaccgcg acgaactcga     39060
     cgaacacatc cgcgtctacg cgctcctcgc gccgaaagcc gaacaagccg ccggtaaggc     39120
     cggagacctc gacgatgtca ccgccaccca gctggccaag caggccgcca gccacaagac     39180
     cgcgatccgc aaagccctca ccgacggcaa aggcctccac gatctggagc gcgatcagat     39240
     caaggccgtg ctgcgggatg tggaggcagg caaacccacc gtgccggagc agttgttcgc     39300
     cgacgaccgc tccgcggcga tcgtcgacat ccaacgcacc cagcgcatcg cctacaacac     39360
     ccaccggacc cagcgccgcg acctggacga gatcctcgat accggggcgg tacccgaacc     39420
     ggtgcgccag caggtccgtg agcacctcga caacaccacc ggtgcggtcg agatggccca     39480
     ccgtggggtc gctgacgccg ccttcaagtg ggcacgacgc cgggaagcgg tcatcgtctc     39540
     ccgcaccgcc gccgtcatcg aagccgatgg cggctacgac agcccgcaac gagcccaagc     39600
     gatgcaggag cagctgcgcg ccggcgggct cgacgacgac cagatcgccg aacgcatggc     39660
     cgccgaatcc tccttcgcca ccccgccctc ggccgcggcg aagccgccca agctcaaccc     39720
     gcgcaccacc agccccggcg ccggaatgca gcggatcaac caccgcaaca agaacaacgg     39780
     ccccgaacag ggcaacggcc gctgaggccc gagctgcacg aagccgatga ccacgcctga     39840
     ccagcagccc gccacctacc cgtggcgggc tgccccgtcc cacctgaaaa cccgccgcca     39900
     actccgcgac gccggcctgt cacccggcgg ccaggacgtc gccgcgctca tggtccgcca     39960
     gcgccgcggc cgccgcctgg tggcccacct gttcgacatc gccctcgccc gcccgaaacg     40020
     agtgccctca ccagggcaac tggcggcgat cgagaaagcc acccgcaccc accagctccg     40080
     cgccgccgaa cgccgcggct acaccgccac cgaccttcac acccccaccg acctcggact     40140
     gacctggtcc gaaaccccca ccctccagga ggaaaccact atgtccacca acggatccac     40200
     caccgggcag gtccggccgc aggggctcgg tcagcgcagg gcgtggctgc acgccctggt     40260
     cgcgaccaac caagcccgcg accgccgtac ccgcctcgac accgacctcg accatgccgc     40320
     ccgcgccggt ggtgaggtcg aggccgggta cctggccgga ctgcgccgtg acctcgacgc     40380
     ggccgaaaca cgactgtcgg cggtccgggg gatcggtgac ccctacaccg acaccgcgct     40440
     gctggccgat gccctgtact ggtcgccggg ctcggacacc gccgcccggc tcgccgaaca     40500
     gatcaccagc gggctggccg ccgagtgggg tgtgcacgtc gatcccgaat cctggcaggt     40560
     gagtatcgat cccggcttcg acgcggccac cgcccagacc accgccgaaa ccagcgcgat     40620
     gcgggcacgg gaagccgcga tcgtcgacgt cgtctcgggg ctggcgctgc ccgaccacac     40680
     cgctgccgcg gtcgaccagg cggtccaggc gtgggctgag gcgaccccgg cgggcagcaa     40740
     cgacttggcc acgcggcggg agcagctgcg cggggagctg gctggcgtgc ggtgcgccga     40800
     caccgaccgg gcactgatcg agttcaccgt cgactacctg accgaccaca ccgccggggt     40860
     cgacctgctc gacaccccgg tgctcgtcga ccccggacag gaagtccggg gccggatacc     40920
     gcgactgctg gaacggttca ccgagggccg tatcgccccc gcgcaggtcg cggaagagat     40980
     tgcggtgatg accgacgccg atcagcaggc cgtgcgggag gtcggcgccg cgaccgtgca     41040
     cgagctcgaa cagatcgggt tccaggtgtg gccgggctgg gccgaccgcg accaggtctt     41100
     cgagcagctg cacgagtacg cgaccgaagc ccgcgagcat cacagcgaca tcgactacct     41160
     cgccacccaa gacctcaccg acgacgaacg cgaaaacctc ggggtcagcg acgacatcgg     41220
     tgcccgcatc gaacgcatga ccgccgcccg caccgaactg ctcgacaccg ccaccaccag     41280
     caaaggattg accgcggccg aacgccacca cctcaccgcc gtcatccgcg acatcgacac     41340
     cggcaccatc aacagcgaat ccgaactgcc ggagctgatg tgggtcgacg aacgcagcaa     41400
     agccgctgtc gatgagaaac gcagctatga acctggtcgc cgcctgtcca aggcggtcac     41460
     ccaggaagtg acccgactgc tcagcgacgc gggtgtcgac ctgagccacc gtgatcacgg     41520
     caaactcgca tcctcggtgt cggcgatcgg cagcaccctg gacagcgtgg cttatggcgg     41580
     gtcgctgctg ggtttggact ccgaccgcga ggaattcctc acccgacgca cccgcctcgg     41640
     acaacacctg cgcgacaccc ggatcggccc tgaggccatg accaccatcc gtgaggtcgt     41700
     cgacggtcac gcccgcgacg ccggccaggc cgggcaggcc gcgatcgaac gccgcgggcg     41760
     gtggaaggac cggatcaccg cgatcgccgc cgcccgcgac gacgccatcg cccaacggca     41820
     agccgccacc gccggccact ccaccaggcc ccgcgcctgc accaccagcc cggccatcac     41880
     cacacaggcc accggcccga cccgcccacc gcgcatccgg cacctgcacg gtgaagagat     41940
     cggacggtga tcgaaagcag gtagtccgcc acccgtgaca tagatcagcc cagggcgcga     42000
     acccctgggc tgatctacgt tccgggtcgg ctacttcttg ccgccgtcct tggctgcgct     42060
     ggactgggcg cggggcgcga acccggactt cgccgacgac gattccgggt tcttcgcggc     42120
     cgccgattgg atgcgggagg ccgcctcagc ggtcatcttg ccgccgtcct tgtctgactt     42180
     cgacacgatc ctctccttcc tcggttcccc tacccttccg gtgtagcacc tcggcgcggg     42240
     tctcgacagc ctgctcgaaa ccggaatcaa cacaggtcag aggcaggttc gaggcagggc     42300
     ggagccggtc cggcagcgat cgccggcgga gatgtcgttg cctgcgtgca tcattcagtc     42360
     atggggacag ggcgggagcg tgtcggcgcg gtgtggtgcg agagcgatta ccggttgttg     42420
     ttcgaggcgc tcgcgctcgg catgaccgat gaggagatcg ccgcacacat cgaccgtgaa     42480
     gtcggcgggg tacgtagtcg ggcactgctg ctggtggaca acgccaccag caagaagggt     42540
     gccctgccga tgctgcggcg gctggccgaa gcacccgact tcgactggga cacctgggta     42600
     cgtgaagtcc acacccgcga gaacctgccc tactgggaca ctgccgccga cgaggccctg     42660
     atcggccact gggccgccga accgcccccg cgtatccagc agctgtgcga gcagttcggt     42720
     gtcggtcagg acgtcatcgc ccgccgggcg atcatcctcg ggctggcgca gacccgcgcc     42780
     gaggtcgtcg accggttcgg cgccgcaccc ggcagcggcc tggccgtcaa cgctgtcctg     42840
     gccaaggaca aactcgcggc agcggtcgcc gtcctggtcg tcaccgacac caccggtgag     42900
     gtcctgtacc tatcgctgca cccgaccacc gacgaggcca ccaccagcct gcaagacctc     42960
     accacgaccc cgctggccgc gatccaggga cgctggacga tcggcacccg ggtcgtcggc     43020
     gaaggatcag tccgccccac cgacaccggc acgtggccgg ccaccaccga gtacatcccc     43080
     gcaccgcagg aaaggccgtc gcggtggcgg cgcctgctgc ggccggtccg gcagggctga     43140
     gcgaacggtc cgacaccgta agcaagaccc accagccctg cccaggccga gaccggatcc     43200
     atcaccctgc agagcagtgc atacggcggg cccggctagc tgccaacagt ccagaacgcc     43260
     gcgggcgggt tcaaggtgcc gtgatagagg acaaccttgg cgacctgatc gtcggctggg     43320
     acctcgaagg aaatgtagcc ctcacgtcgt tcaccggcga tcaaggctcc ggcgaggctg     43380
     agctgcccgc cgctcgcaga gtaggggttg aactgctcga ggcggcgtcc agccgtggtc     43440
     aacacctcga acgtgcccgg tacatagcca tttccctgcc tgcatgcgat gacgacatcc     43500
     accgtccagc gcccatcgag cgtccgagga ttggacacgg tgtactcggc caactgcgtc     43560
     ttgtcggaca gattcgcccc accccatatc ttcagcgtcc cgcccaaagg actcgtcgga     43620
     ccggactcca aaccggcgct cggcgccgct accggcgcgc tcgtcgcgga ggacgtactg     43680
     gtcgtgtcag aggatccgca gccagctgtc acgatcacca gcacggcaag taccgctgta     43740
     gcgacatcct gctcatccag acaattattc gcctcagcta taaattttgg aaccatcgat     43800
     cgtgggccga cccgaacgcc gaacagagcc cgacctgggt cgcagccgcg ttcgggtctc     43860
     ccgcgcgctt ctctaccgct acctcaccga gaccaataca gcctgacctt cagaccggtc     43920
     gtccgtcgtc gacgtcgcac gccacgcgag aacgggcacg gaagtaccag gccaaggcac     43980
     cgaccaccgg caccaaccac accaccgcca accacgcgac gcgacgtcca gcagtattcg     44040
     ccacggacaa gatcgagaca gtcgctatcg ggaccgagac gaaccagacg atcaggaaca     44100
     accccagcgc aacaagttcc accagaaaca tgccgaaacc gggcatgcag tccacccccg     44160
     cctcagtgca gtcgcttatc cctgctccag cccacagcct ggtcgtcact tcgaaatcgt     44220
     agagtgtggc ccgcgccctc ccgcgctggc gcatcgctgt ggatttggag tacaccccag     44280
     ctcgacaccg gtggcgggtt tgctgcgggc cgacaacaga gccaggcgtt ccccaacggc     44340
     caaggcgaca agaattcgac ggcgacgggg ccccgctcct ggccgccggt aaggcgccca     44400
     aaccggaggt agccggtcgg acatgcctca ggtcgacatc gtcgaggggt tttgcgccgg     44460
     gtcgtggtgt cggtctcccg tatgacgttg ttgtgcggcg tttctcggtt aggttgtggg     44520
     tgttctggct ggtggtcggc cgggtgtcat gtggggagac ggttatgagt tcgggatcgg     44580
     ggtcgttatg gccggtggcg gtgccgatcg cggtatcggt ggtggtgaac gtcgtggtgg     44640
     cgatagtggt gaacctcgcc accgggggcg ggccctggtg gatgtgggtg ctgatcgcgg     44700
     tgttgaccgt ggtcgggatc gcgaccgcga tctggcagta ccggaagcag cagtcgtcca     44760
     cgcccctggc cgagccagca cgttcagtcg aagcatcggg tgctcgcagt gtggcggtgg     44820
     gcggtaacgc gggttggatc agcaccggcg acaactcgac cgcaccccag acagttccga     44880
     caccaccacc atccacggct tcgcctgcac cgggatcggt gacagccagc ggggagcgtt     44940
     cggcggcggt cgggggagac gccggcggcg tcaccaccgg cgaccaatag tgaccgggcc     45000
     tcgaatatgc ctgcccccga cggtcggaag ccctccggga ctgtggtcgg tggcgtgcac     45060
     gcggaaggtg cgcgctcggt cgcagtcagc ggagacgctc gcctggttca gaccggagac     45120
     aacgccactg cccggatagt tgagctcccg gcggaggcgt accgccccat ctccgaggtc     45180
     gacgccccac ctggcatcga caacctgccc atccggccag cgaacttcgt cggccgcacc     45240
     accgaactgg acaagctcga caccatgctc gcgagtgcgg ggcaggtggt ggtgcaggcc     45300
     gtgcacgggc tcggtgggat cggcaaaacc accctggtcg cacactgggc cgccacccgc     45360
     acccacggtt gctccccgat cctttggctc accgccgaca cccctgccga gatcacccaa     45420
     ggtctcgcgg gtttcgcggc cgcactgcag ccagccttat ccacggtgct ggaggtcgaa     45480
     caactcgccg agcgagggct gcagtggctg gccacccaca ccggatggct actcgtcctc     45540
     gacaacgtcg aggacgtcac cgacatcaac cccgtcctgg cccgcgccgg gacaggtggg     45600
     cggatcgtgg tcaccagccg ccgcgcgacc ggctggccga cgggcaccgc agtcatccgt     45660
     ttggacgtgc tcgaccccac cgagtccctg gaactactca ccggtctgct caccgccagc     45720
     ggtcctcgcg acgaggacgg ggctgtcgag ttgtgcgccg agctggggca tctgccgctg     45780
     gcgatcgaac aagccggcgc ctatttggcg cagaacccgt tcctcacccc acgggcctac     45840
     ctgcagacgc tcgacaccta ccccgccgaa acactcgggc acggcggcgt ggacaccgat     45900
     gccgaacgca ccatcgccca gatctggcgg gtcaccctcg accgcatcac caccatccag     45960
     ccgatggcgg cagaactgct gcgtgtcctg gcctggtatg cccccgacgc catcccgctt     46020
     tccatgtgcc agagcatcac ggacccaccc acactcaata ccgccctcgg ggtcctcacc     46080
     gcctacaaca tgatcacccc cgacctgacc accaacactg tgtcaatcca ccgcctcgta     46140
     caggctgtag cgtgcacgcc tgatcccacc gaccctcacc gtgacccgac cgcgattgaa     46200
     caagcccgag accaagccgc agacgtcttg cttgcctgcc tccctgatca tcaagatccg     46260
     ggcacctggc tgacgtggcg ggctctattg acccacgtgg acaccttcac gggaaaggtc     46320
     caaagcacct ctgttaccga cgccaaggcg cagatcctca cgcgcgccgg gcaattcgtg     46380
     ctcgatcagg gtatgcacac aagcgcgcta atctactatc gccaagcttt gaccgaatac     46440
     gagcgggtgc taggtgccga gcacccccac actctggcct cccgtggcaa cctcgccggc     46500
     gcctaccagt cggtgggacg gctggacgag gcaatcccgc tctacgaaca ggcccgcacc     46560
     ggtcaggagc ggattctcgg acccgaccac cccgagacca tggccgcgcg caacaacctc     46620
     gcctacgcct accagtcggt gggacggctg gacgaggcaa tcccgctcta cgaacaggtc     46680
     ctcaccgact ccgaacgcat actgggcacc gagcaccccg acaccctgaa atcccgtagc     46740
     aacctcgcct acgcctacca gtcggtggga cgactggacg aggcaatccc gctctacgaa     46800
     caggtcctca ccgactccga acgcatactg ggcaccgagc accccgacac cctgaaatcc     46860
     cgtagcaacc tcgcctacgc ctaccgatcg gtgggacggc tggacgaggc aatcccgctc     46920
     tacgaacagg tcctcaccga ctccgaacgc atactgggca ccgagcaccc caataccttg     46980
     accttccgta gcaacctcgc tttcgcttat gagtcaacgg gacgactgga ggcggcaatc     47040
     cctctgctag agcagacact ggcggatcgg gagcgcatat tgggcgacga gcacccccac     47100
     accttgatct cccgtggcaa cctcgctggc gcctatcagt cggcgggacg gctggacgag     47160
     gcaatcccgc tctaccagca gaccctcacc gatcgggaga gaatcctggg cgtcaagcac     47220
     cccgacacct tgatctcccg caacaacctt gcctacatct acaagtcggc gggacggctg     47280
     gacgaggcaa tcccgctcta ccagcagacc ctcaccgatc gggagcgcat attgggcgac     47340
     gagcaccccc acaccttgat ctcccgcaac aaccttgccg gcgcctatca gtcggcggga     47400
     cgactggacg aggcaatccc gctctaccag cagaccctca ccgatcggga gagaatcctg     47460
     ggcgtcaagc accccgacac cttgatctcc tacaacaacc ttgccggcgc ctaccagttg     47520
     ctgggacgac tggacgaggc aatcccgctc tacgaacgaa ccctcaccat ctccaaggag     47580
     cttcttgggg cggagcaccc caccacccgt ttgattcgtg gaaatctcgc ggctgcgcgg     47640
     gaggcgactc actgacctga cgctaggcgt atcacgttcg tcgcgacgtc aatttggggt     47700
     agagcccaac tagacacccc tgaccgagac gtcttgcgtc cgaatagagt ccgaaaccga     47760
     atttcttgac actcgtccga tgagttctta gattccaacc tgacaaccag ccgcagtcgc     47820
     ggccggatcc ggacaagcag ggggagggcg cggtgcgcgt cggctacatc agggtctcga     47880
     ccgtcgacca gaacaccgac cgacaactcg acggcatcga cgtcgagcgc gtcttcaccg     47940
     acaaggtcac cggcaagaac gccaaacggc ccgccctcca ggagatgctc gccttcgtcc     48000
     gcgacggcga caccgtgctc gtgcactcca tggaccgcct cgcccgcaac ctcgacgacc     48060
     tccgacgcct cgtccgacag ctcaccggca aaggcgtacg cgtcgagttc gtcaaagagg     48120
     cactgacctt caccggcgag gactccccca tggccaccct gatgctgtcg gtcatgggcg     48180
     ccttcgccga attcgaacgc gccctgatcc tggaacgcca gcgcgaaggc atcgccacgg     48240
     cgaaggcccg cggcgcctac aagggccgaa agcccgcact caccgccgac caggtgacgg     48300
     cgctgcgcga gcgcgcggca gccggcgagc cgaaatccgc cctcgcgaga gagttcggag     48360
     tcagccgcga aaccgtctac gcctaccttc gcgccactgc ctgacaccgg cctacgtggc     48420
     acatcgacat cttcggtcgt ggtcgctatt gttccggcga atctgcggca ggaggtggtc     48480
     gtgaagtacg aagacaccgg atcggcgctg gaggagtact ccaacgagcg cgacgccgac     48540
     ggctactggg agccacaact actcgaggag cccggccgcg tccacgcctt ctggcgacgc     48600
     cctccagcgc tcgacttcat ccagagttgg gacgggttgt ccgcagtctg ccgccatccc     48660
     gttcgtgtgc tgctgccgct gccgttcgac agcaacggcg cagacgcatg tcctgagtgc     48720
     gctcgaatac tcgctgcgcg ggctgccgac cctgagggct gggaggaacg ccgtcgtgag     48780
     caccagcgcc gccggatgag agaagaggac tacgaggagc tcaaggtgcg gcgtgtcctc     48840
     caacttcgtg acgagaaccc cgacctcact ccagaggatt tcgaccacct gagtttcgaa     48900
     gagctcttcg atctcgtcca cagctccgac ccgtttgacg acgatgacct ctccgacgac     48960
     gtagggccgc tgggcggcgc ctggtagatc ccgccatcgc atggggacag ctccaccact     49020
     gttcgatacg gtgtgccgcc atggtgcatc tccgctactt caccgactgc gacgaagcga     49080
     tccgggcacg agtcctcgaa tgggtgcgca ccgacgagtt catctcccgg atcgggatgc     49140
     ccgaccacga actcaagcac gtccccggcg ccgaaacgcg cactggccgg gtccacaact     49200
     gggtcatctt cgtcgacgag caacccgtgg ggttgatatc ggcacagatc caggaccagc     49260
     cacgcagcca cagcccgctt aaccgagaac ttgatgatcc tgccgactac ccgttgctcg     49320
     ggacggtgac ctacatcgac cgacagcacc gcagccgcgg atacgcatcg gcggcgaaac     49380
     atgccatcag cgaacacgtc gccgcagccg gagttcaaac cttcggttgc attgtcgccg     49440
     gcgacaaccc gcagagcctg agatcgatca gtagagctgg atacgagcgt gtccacaccg     49500
     agaaggtcga cggaaagccg gacaagctct acttccgacg gcggcggtaa ccacattcgc     49560
     taccgccaac tccgggcctg ccgcttcgtc agtgacccct gagggccgtt gcacgggatg     49620
     tgccgtttcc tcccagctag gccttgcggg cgcgacgacg agaggtctgc cccgcctccg     49680
     agactccagc tacccaagca cccgtttttc cactcgggac acggagctgc ttgtacttag     49740
     tggaacttcc ccgcatcttc gtcggtttgg agctgcgcgg agatggagat tctggttcct     49800
     tggcgtctgc acccctacgg ccgggccgcc ggtcccacct gctcgcgaat gccttgatcg     49860
     cacgagcatc ccaaaccggc cccgtcctca gccgatacag aggctcagga aacccgacag     49920
     tgccctgaag ctggtgcaca cgctgacgcg agacctccaa ctcgtccgca acctccgccg     49980
     cagataccaa ctgcggcagg ttgggcgcgt ccgcctcggc gaagtgggtc tcctcatcga     50040
     ccacttcaac cgccacagga gacaggccgg tgacaggccg aacaagcgca gcagcgagtc     50100
     cggccgcctc caccggatcc tctgcttcga tatagacgct caacatgacc gcaacaccgg     50160
     ggagccgtcc cgccgtggca tcgacatccg cgagctcttc ttcccacatc gtgagctctt     50220
     ctcggtcgat ctcagccgag ctatagcgca aggtcactac ccagatcact gatctcacgc     50280
     tccttccgtc gatgccttgc ggcgtacagc acgctgctct ttcttgctgg ggggcggaac     50340
     ctgaaggccg gcagccttca atttcacttt caggtcagcc atccgacggc gaggattgct     50400
     cggtgtagcc ggatactgcg cgatgtactc cccgtccgga tcaaagaact gcgtatatcc     50460
     cctcgtggtg tccactaccc gccagccctg agagcgcgcc caagccgcaa ggtcgctgat     50520
     gtcactgttc aagcggtttc tgtcccctcc agactcgcct aaatattgcg atacgtcaag     50580
     ctttgaagac tatacaacgt caagatttgc atcagcaaca atcctgctga tcggtccgaa     50640
     ctctgggcca gatactcgct gacatgcccc tgctccagcg ccgcaaggga ggctctcccg     50700
     aggcgctcgg taatcggttc ggatcgctct acttcagtca gtaggccatg aatacctctc     50760
     gtcgagggcc agcatcaggc tcgtggccac catgaccgcc aggactgcgt tctccggggt     50820
     gaagtgatcg gggtgcgcct ggtgcgcgac gacgtggcgc gaaaggggca ccggcctcgg     50880
     cttgccggac ttcggattcc agtccgtcag caggttcacg accggcgcaa caccgagcac     50940
     gtaccgcaaa cgatcctcct ggaatgccac ttccaggttg gtcaccctgc actggtgctt     51000
     cgccttgccg gatttgttgt cgatgtgcgc ttcgatctgt gtgttgcaca cgcttacgcc     51060
     gagcgcttgc gccgcttcgt ggtgcccgtc ggcgagggca gcgatggcct tcaggagcag     51120
     tggccgctgc tcggcgacca gtgggtcgag ctgggagtcc accgctgctg cacagtcgtc     51180
     caagatctcg gatgttcggg ccaccaggat ggcatcgcgt ccggcacgat ccggggcttg     51240
     cgcaagttcg gagacgatat ccgcccgcgg aatgtacacg atcgggatgc cctcgttctc     51300
     gacgatctgc tgcgcgagat ccaagtccag agcctcctca cccataggcc agttggccgg     51360
     gtatcgcgcg aagagcgagt cgatgagctc ctggactccc ggcggaatga gatcgcccgg     51420
     cgccgggatg tggtggcgaa gcattcgctg cacatcgacc gccggaagct ggggcatcgg     51480
     ccgggcgaca tcgaaggtcg gaatatccag cctaggcaga tggacgccgg ccaggattcc     51540
     gtcgaagacc gccgagcgga gtgagtgggt gacatcgatg gcggcttcca tgtgctgaaa     51600
     caggccagga tccagcctta tcggctcaag tcgcggccat gggatgtccg tcggcaagct     51660
     cgactgcagg gaccccatga ggtcgatcgt cggccagtgc ggcgcggtgg cccggaaagc     51720
     gcgcgcggcg atctctgcca gttcacgcct ctgtgcatcc gtcatcttcg ggaaggtcac     51780
     ggatcgagat tacgggcggc tacaggtagc tcgcctggtc atttccggct ggctccgagg     51840
     gcggacaagc ccctaggaac ccgtacccat cccgagcagc agcccgccgg gacctgggcg     51900
     gctgccccac ctaacggtgg gcgagcggcg gagtaggaga acggccgcgg caaccaccaa     51960
     gactgacgcg gggcatcggt tcggaggttc gttcctcctt cgccgagttg cccaccaacc     52020
     aggaatcgaa cggtccgcgc cgagagtcgt tgtgccagct cgctcgaccc gttcgggccc     52080
     tatcttgccc gataaccata gttatcaggc aacagtctcc gatggcatcg cgcggcgccc     52140
     ggtgtcccaa atccgccccg cagacagccg gtggcgacgc cggcgcggtg cagggcgtcg     52200
     atctggtggt cgcggttctg ctcggcggtg gagacccgcc cgtatccgat caacaggagg     52260
     aagaagcatg ggagtccggg cgccggacgc ggaaaggcca atgccgagcg actcgggcgg     52320
     gagaagttcg cgcggaggcg caccgctgcc ggaccgccga gacgacgcag cctgaacccc     52380
     ttcctgcggc gccccaccac ccgcacgcgc cgtcacctcg tcggcatcac cccactcggc     52440
     aatcaccaca ccggcatcgt cggaccggag cacagtccgc ccctggcgtg gtcgcggtcg     52500
     gctcgcagtt agcagcgtgt ccattgttgt cagacgtaac tgctatgaca gggcagtcgg     52560
     gaacctgtgt ggagcaaagg agtagaaggt ggcggttttg ttcactcatc ggcgtatgtc     52620
     gcccgggggg accagaaacg agcacatcac ccacgtgaag tggcgccaag agcacgatgg     52680
     ggagacaggt ttcatgacca agccgcaagc ggtggagtgg ctggacgatg gcaacagagc     52740
     cttcgtacaa ggcccgcact cccgcgtgga agtcggagtg gtacgcgaag ccggaaaaga     52800
     gccgtacctg aggacccatg ccaacggtaa gtgggacgac aacctcttgt ctctcccgtt     52860
     gttctaactc acggcgatgg tgagcacggg ctcgggcacg acgtggtaac tgtcgacgac     52920
     gaagccgacc cccacctggt gagactgcat acggccagcc ttcacgacga aaaccgcccc     52980
     gcttccgaga cggaagcggg gcggttgcgt gtggggccag gctacatgcg gatccccagg     53040
     accgaggcca tgcaccactt gaggatgccg ccgccgaccg ggcccaggcg cgggatccat     53100
     gccttggcgg ccgcaaccgc gccgccgggg ccgccgaaca tgaagccggc gacgatcggg     53160
     gcggcgacga agccgaagcc gccgaggcat ccggcgaaca tggccgtgtc ggccgcccag     53220
     ttccgcttca ccggagtcac ttccggccgc aggttggcaa gcgccggggc ggcgacggtc     53280
     tccgcggccg cctcctgcgt ggcgccgagc ggttcgccga ccacctgcga caccgccgga     53340
     gcggtggggg tggtcggtgc ggcgatggcg gcggtggtgc cgctgagcag gatcgccgcc     53400
     gtgctcacga cggtgatgct ggccttacgg atggcgctgg tcattgctgg ctaccttcct     53460
     tctggcggag gtcgaggtgt ggttccgccg tcgttccggt cgccggtgcg cgaccgtgaa     53520
     ctacaacata tttgtattac aaatatacgt caagtgtgtc tatcaagatg ctttgctgtt     53580
     gatgagacaa gcggctcggg tgtacatatt caggcaggtt gtaggccata atggacgtat     53640
     gaccacttgc gagtgatcgc ggcgactcga cgaagggatg acgccatgcg cggcgaaggg     53700
     aagagcaaac cggccgggaa gaccaagacc ttgcaggtcc gcgtcgacga ggagacagcg     53760
     cggcatttcg ctgcgatcgc gcgggcgcgg cggatgaccg agtcccagct gctgcgcgcg     53820
     acgatctcgg agatgctgcg cagttcggag agcaatgtcg atgtgctcaa ggccgagctg     53880
     cgggcggagt tcgaggcggc cgaggccgcg ctcgatgaat tgagctcgga gtccaggcag     53940
     gccgccgtcg cggcggggtc ccgtcagcgg tcgactcgct aggagcctcg ccacggggga     54000
     cacggagacg atcgtgaggg cgggatactc acgatcaggg gcagctcttg agcacataga     54060
     ccggcatggc cgtcaccagg accgggctgt tgccgtcccg gaccagaacg ttgatcgggc     54120
     gcagattgta gccgcagaag aacagggcgg gatcggagct gacggcgagc tcgaactggt     54180
     agacgatctc gccttcttcg tccatcgcga cgggggtgta ggtcgtggcc agctgcaggg     54240
     cgccgatgcc gggggcggcg ttggcgtcgt tgacgagcat cgtcgtgccg ggcgtgatcg     54300
     tcagtcccgc atcgagcccc aacgccagct cgatgttctg atcggtgccc agggcgggat     54360
     cacgccagcc caagtggatc tcggctctca gccggtgatc gaccccggtc acgaacgcgt     54420
     cgtcgggaag gtctccggcg accgactgca tgcggggatg gggctgctgc tcgctttcgt     54480
     ggacgagcac acgggccacc acattcggca ccgccggccc gacataggtt tccgggaacc     54540
     ccggtgggag cgcgatctcg gtcgcggtga cgatgtccgg gttctcggtc gggccgtgcg     54600
     aacttcccgc aagatagcca gcgacaatcc ccgcgatcgc cagaccggcg gtgaaggcga     54660
     gccttgtcgg caggctcagg ccgttgatgc gccgctcgag cagggccacc ttgttcttga     54720
     tccggcccgg cggaaggatg ctctgcaggg agaacgggtc cggcacagac gcttcgggaa     54780
     tcgtgaaacg gcgcaggaca tcgaccagcg cgggcaccgc ggtctgggcg ctgtagtcgt     54840
     cgtggggaat cacttccgcc aggcagtgga agtcccgggt cgcggccggg tgagtggtcg     54900
     gctccatcgt cgccgagttc ggccccgcgg ccgtttccac gaccagggtg gccaagatca     54960
     gcgccgcgcc ctcgatgtag gtcaatccca gagcgaccaa tcggggatcc cgcagctcca     55020
     gcgccgggtc caagacgatc tcattgcctc ggcgaagcat catgaacgcc acgtgcccgc     55080
     ccagcaggag aggccaatcc ggcaggttcc cgcccgactc cttctccatc ccggcattca     55140
     agcgtgcggt ctccatcgcg gtgctcaaca ccgccacatc gatggattca tgagtcactg     55200
     tgtccgggag actcactatc tcaaggactt tcagtgccag cgtcttcagc ttggcagtgt     55260
     tcatctcgac caccgcgcca tagtagtggc gggtcacatg cctgtcggcg gtcttcgtaa     55320
     cgcccgaccc ctccccagca gatcattcat gcaataccgt aatacattca tcaatgcaac     55380
     ggagagtgca gacatgtccg agagccgtcc gagaacaaag atcctgaccg tcttaggtac     55440
     cgtcgccgcg gccgccctct gcacagcttt tctcggctgc cccaccgcgg ccgccgccga     55500
     cgtgccactg gacttgcacg cccaatgcgc aacccaatac cccgaaaccc cccacgccta     55560
     cgccggccac cccatcctga tcgcacccgg caacgcctac tcctggcgct gcgaacaacc     55620
     ctccaaactg cccggcggcg gcctgctctc cagccttttc ctcgacaccg acgccttctg     55680
     cgtcaacaac cgtctaggcc acgcgctcgc cctcgacacc gacaaccccc acagctgggt     55740
     ctgccgccaa taaccggcac accgccgcca ccatctccag cgcaggcaat cggactcctg     55800
     atccgacgcc cggaggctcc aacgcaggcc cggcccggta ttcgacgccg accgaacgca     55860
     tcccaggtct cagcctagag gcttgggact cagctcagca ggccgctcaa caggtcgatg     55920
     agacgcacaa ccgtctcgat gcgctcgatg aaggtgcctg tggtgatcac aacgcgtccc     55980
     gctcggcgca gcctctgcct ccacctgcca tgagggttcg ccgggctggc gtcagaaggc     56040
     tcgggatcac cggaaggtgc tggtgttcgg tcgttatcgg acatgagcgg gcaccgtaga     56100
     caggtggggt gcagcgaccg atccgacgag aaaagtgaca gttcgcgcag tgccgggaca     56160
     tccgggctcc tcagcagaag gatctcgccc ggccagaggc cagcagcaac agcgccacca     56220
     acaagagcct gcctaccgag ccgctacacc cctgtgcggt ccgatacagg atttatcccc     56280
     gcgctccagc gaccccgacc atccgaacta ctcgccttgt aagcgaaagg gcgtcgttgg     56340
     tccggtcgaa ccgggtgccg aaaacgtctg caacactcgt aatgaaaagg tcggcagttc     56400
     gcctctacta ccggtctcgg gccaggctcc tctgtggcag agtgcctggc cggaggccag     56460
     tgacaggtgt acgcgaacac gataaccgcc gcgtagtaat cgaagtcttt gccacctccg     56520
     acacgcggag gcgtgccccg gagcggggac ggctcggtca gaaggtcggg aacatggctc     56580
     cctgaaccca gacgaccgcg gcaaccgcgg tcggcggcag gctgaggacg aactggttgc     56640
     cctcgttctg ggacaggacg atcctgagcc agccgttgtc ctgcgggacc gcggcgtcga     56700
     catcgacgtg gcagatcgtt gggcggttgc tgtcccactg gagcgggagc gtgtgcggca     56760
     aggacgcggc ggcttcgggg gtcaggtaga cgcgttcgtt cgacatgaag ccacacgata     56820
     ggagcgcggg ccgaacacgc cccggcatcc cagggcgtgt ccatgagcag tgccgtggat     56880
     ggtcgcaagc ccggtagctg gttgaatgtc ttcgccacac ctgcctgccc ttcggccgcc     56940
     ctggctcggc gcaggtgtgg tgttcggata ccggcagcgt cgccgggcgc ggtcaagcac     57000
     ccggcccatc cggcgacgct gcaccgatcg acatttcttc cgatcggaga cagcccccac     57060
     cggctgacct cgcccagcgg gcgtggagat ccgcggtgtc ggtcaccttc cgcccgaccg     57120
     ttgtgcagct gtcgctgcgt tcaggcaggc cctgcagcac agggatcgtc ggcggcggca     57180
     ccggcctcgc gctcagggcc gcatcaggct cccccggcca gaggacatcc cgcccgctca     57240
     gtcctgagcc tcggccttca tcgcgggcga gtcaccggcc ggggaccgca caagcccgtg     57300
     ctgcctgtgc tgctgccact gcccggctcc acggtgcagg cgagtatgtc cttgtagatc     57360
     ccgggggtgc cgggatctgc ggtgatgacg tgcggggttg cagcacccgg ggcgggggtt     57420
     tgcccttcgg caccggcgga ggcggtggtc atgatggtcg ccgcagcgat ggccgcgagg     57480
     gcggcgacgg tgcgattgcg tgctgtcgga ttgttgaaca tggcaggtgc gctccgtttc     57540
     ggcgtgaaga gttccaccaa ggtagcgact atgaagtgtt tcagtttcga aaaggatgcc     57600
     cccggttctg ggggccggat caccctgtac cgggcggcgc cgcgagccca ggtcgagtcc     57660
     gcgttcccgc acgcgggccc gcttttgacc cggcggtgca atctcgatct gatcgccgag     57720
     cactacgacg acctgctccg gctggccggg tcgctgaagt tcgggcacgc caccgcgtcg     57780
     ctgctggtcg gcaagctgtc ggcgtcgggc cggcagaacg ccctcgcggc ggcgctcaag     57840
     gagtacgggg cgctgcggcg cacgatctac gccgcccggt atctgtccga cccgggctat     57900
     cgacgcaaga tctcccgcca gctcaacaag ggcgaatccc tgcacgcgct ccgccgcgac     57960
     ctgctctacg cgcatgaagg aaccgtgcgc gcgaggcacc tggagggaca gaccgaacag     58020
     gcatggtgcc tcacgttggc gaccaacgcc gtcatcgcct ggaccacaga gtattacggg     58080
     ctggcggccg aacagatgcg gcgggccggg cggcgcatcg acgacgaggt gctgacgcac     58140
     atctccccgg cccacagcga gaacatcaac ttcttcggcg ccatcgaggt cgacatcgac     58200
     gccgaactcg cccagctcgg ccccaccggg taccggccgc tgcgcgtgcg cgacaccctg     58260
     ttctgacccg ggggaaaccg agagacaccc agccgagagg atccggcggc tgcgcggcct     58320
     tgaccctgta ctcgggtaca gggttgagaa tgtgtgcatg cggaccggtg agctggcagc     58380
     cagggcgggg atcaacgcgc agaccctgcg ctattacgag cgccgtggtc tgctcgcgcg     58440
     accggcgcgg tccccggcag gctaccgcag ctaccccgac gaggcggtcg cggtggtcag     58500
     gttcgtcaaa cgatcccagg agctggggtt caccctcgac gaggtcgccg aactgctgcg     58560
     gctggccgac ggcggccccg acgactgcga caccgcccgc gcactggccg agtcgagggt     58620
     tgccgagctg gaacggcgta tcgcggacct gcagcgcatg cgcggctcgc tggcagagtt     58680
     gatcgcgacg tgcgagctgc cccgcaaccg ccggtcctgt ccgatcctga cctcgctgca     58740
     cgaaggagac cacccgtgaa actggaaatc ctccaggtcc ccgactgccc caacgtggcg     58800
     gtactcgaac agcgcatccg gcaggcgacc gccggccagc cggtgcagct cgagatcacc     58860
     cgccgtgtga ttgacgatcc cggccgggcc gccaccgcgg gtatgaccgg atcacccacc     58920
     ctgctggtcg acggctgcga cccgttcgca acgccgggcc aggtcccgag cctgtcgtgc     58980
     cgcctctacc cctccgacac cgggcggctc gacggcgcac cctcggtcgc cgcgttgcgc     59040
     gccgcgttgc ggctcgtccc ggacggcacc gcggcactcg gggacgacac cgcatcctca     59100
     tgctgcaccc cacccgccgc cgaatctccg gcaacagtgc tccgcgcctg gcgcgccgcc     59160
     gcgcaaccgg cagaccccac cgaaaaggct gtgcaccagg cgatcctgcg tgccttcgcc     59220
     accgatgggc aggcgccgac cggtgacgat ctgaccgaga tggccgccgg gcccgacgtg     59280
     ccggtcgagc agctactgcg ccgcctgcac gacgccgaca tcgtccgcct cgacgcgacc     59340
     gggagcatcg cggcggcgta tccattctcg gccacaccga cgccgcatcg agtccggatc     59400
     gctggtggag ccacggtttc ggccatgtgc gcggtcgacg cgctcggtat ggccgcgatg     59460
     ctcgacacgc cggtgacgat cacctccgcc gacccggtga ccgccgaccc gatcacggtc     59520
     accgttgacg gcgggcacgt caccgccgac ccggccacca cggtcgtctt cgtcggcgca     59580
     caggccggcc caggcccgtc cgccgacacc tgctgccact acctcaactt cttcaccgac     59640
     cgcgccagcg cccagggctg ggcagacacc caccccggca tcggcggcgt tatcgtcgaa     59700
     ctccccgacg cccaccacct cggcaccacc attttcgggc acctgctgca cagctgaccg     59760
     cacccgggcg tgccacggat aacaccctgt tatctgtggc accatgaaac ccggcctgcg     59820
     acgactccgc tccggcggtg cgcgaagcgg ccctgttatc tgtggcaagc aggccaggga     59880
     ggtcacaatg ttgtcgtccg ggatcaccgt ccgcgccgcc ggcgacggct tcctcgactc     59940
     gatccgctcc ccgaacaccc gccgctccta cgccatcgcc gtcgataaga ccaccgccag     60000
     gctcggcgag gcccggccgc tggccaatgt cgccgacgac gagatcggcg aaaccctgga     60060
     aactttgtgg ggcgaggcgg cggtcaacac ctggaacgcc cgccgcgccg cggtcgcgtc     60120
     ttggctggcg tggtgccgcg agcacggaca cctcgccccg gcggtccccg cgtgggtgaa     60180
     acgctccacc ccgccggact cggccacccc ggtgcgctcg cgcaccgcga tcgaccggct     60240
     catcacccgc cgcgacatcg acctgcggga gaagacgctg tggcggatgc tctacgaaac     60300
     ctgcgcccgc accgaggaac tgctccaggt caacatcgaa gacctcgacc tggccgggcg     60360
     gtgctgcccg gtgaagtcca agggcgccaa gccccgcacc cgccgccgcg gtgccaccca     60420
     ccacgagtac gcgcacgagc tcgtgtactg ggacgcgggc accgcccggc ttctgccacg     60480
     cctcaccaag ggccgcaccc gcggaccgct gttcgtcacc caccgccgac cgggccccgg     60540
     caaggccgcc gccgaccggg acatctgccc cgacaccggc ctggccaggt tgtcctacgg     60600
     ccaggcccgc gccgtgctgg atgccgccac agcgacgaat ggccccggca ccggctggga     60660
     cctgcacgaa ctccggcatt ctggcctgac gcatctcggc gaggccggag ccagcctgct     60720
     cgagctaatg gccaagtctc gccaccgcaa acccgacaac ctgcgccgct acttcaaacc     60780
     ctcaccggca gccatgcgcg gaatcaccag cctcctcggt cccgaccgca gccaccgata     60840
     gcggccgcca acaacggctc gtccgtctac ccgctgacca ggcgctacgc gaacttcgtt     60900
     gttttttgcg ccattactgc cggaaccccg acccagtcca tggcagccgt cggctcctcg     60960
     gccgacaacg ctctggccga gtcgttcaac gccaccatca agcgcgaggt cctccaagac     61020
     gccgcctgct ggcccgacga ggccacctgc cgccgcgagg tcttccgctg gctcgtccgc     61080
     tacaacaccc gccgccgtca ctcctggtgc ggctacctgt ccccgtccac ctacgaggcc     61140
     cgccgggccg ctacgctgcc aaccgctgcg taatcaccca ccgtgtccaa gatccggggg     61200
     tagggcccag ctgaaggttc gcggtgaccg gacaacaggc agactccttc ctcgtgggga     61260
     aggaaccatc agccccggac cggggcggtt cagacggccc ataggtcggt cgtctcggcg     61320
     gagatccatc gcctgcggac tcatcatagc gttgcggtgc ggttcgctcc ctttcccgct     61380
     gcgtccgtga cggcgcgcct gtgacatcac ctttcgtggg agatctgtcc tgcgcgaggt     61440
     tgtgcagcag cttgctcgac cttgggccaa ccatccatgg cgtgatccag gcatcggcga     61500
     gcaagagtgg accgcgcgtc ggtggccagt ctcggcgagt ccggtcgggc aaacaactcg     61560
     gtcgccgatc agcagcaggt cagggcgctg gtggtaagcg aagaccggag atgcgttcga     61620
     tgtcgatgcc gatgacctgg tcgtggggtg tggtgaccca ggggcgtcgg gggatgtcgg     61680
     cggcggcgac gagttcgtcg atgtcggaga tggctgtggc gggtccggtg atcagcacgg     61740
     tccatccgct gtgggagtcg ggatcgatgc ggtccacttg taccgccacg gtctggccgg     61800
     tgaccgcgct gccgtgggcg cctggcacgg tccacaccac gatgcggtca ccggcgacgg     61860
     tgaagttgat cggccggatc gccgggaccc cgtcctcgag gtaggcgatg cgggcgaccg     61920
     ggaccgaccg cagcaggacc cggcactcgg tgtcgctgat tgtcgacagc tttttcatcg     61980
     cttgagttcc tttcggcggg aaggttgtct gcccggatcg gtcctgttcg cggccggtgt     62040
     ccggtcagtg ggagcggtgc agggagtcga tggctgctcg cagtctggtc gtggcgtcgg     62100
     cggcgatggg tgccagcgcg ggttggttgg tgagctgcac catcagttgg gggttcatcg     62160
     cctcgatgat gatgtcggtg tcgttgtcgg gtgagcggcg cacgacgacg ttgcagggca     62220
     gcagcagtcc gatctggcgg tcgatctcga ccgcgcggtg ggccaggggc gggttgcagg     62280
     cgcccaggat gcggtagtcc tccatgtcgt ggccgagttt ggctttcagg gtggcctgca     62340
     tgtcgatctc ggtgagcacg ccgaagccct gttcggccag cgcgcgcttg gcggcgtcga     62400
     cggcgtcgtc gaagctggcg gtcacggtgg tggacagtcc caggtcggtt ccggtgtcgg     62460
     tcatgtgcgg gctcgctttc tcggttcggt gacgctgagg ggtggccggt ggtcaggtac     62520
     gcgcgaccgt gcaggtcgcg gtgccggcgg gcaggccgag gcgggccatg agcaggctgg     62580
     ccgggcacca gccgagcgcg ctgtagagca gcaggttggc accgaccagg gcggtcagta     62640
     tcagccacca cggtgagagg gtcgcggcca gggcggcgct gagcaggatc agcgttcccg     62700
     ccagcaacgg caccactcgg tcgatggtcc aggtgcgcgg tcgcgtgggc agcgtcatga     62760
     cgtgttatct ccttgtcctc ggtcccggtc caggaccgag gcgggtaggg gtcaggccag     62820
     ggtgaggaac agtttttcca gttcctcgac cgtcatcggg tcggcgcctt cgccgggttg     62880
     tccggccagg cattcgcgca gcccggtggc gacgatcttg aatccggccc ggtccagggc     62940
     gcgtgagacc gccgcgagct gggtgacgac gtctttgcag tcgcgtccct gctcgatcat     63000
     cgcgatcacg cccgcgagct gtccgtgtgc gcggcgcagc cggttcagta ccggtgcgat     63060
     gctgttctcg tcgccgacca tggtggtgtc tccgttctcg tgccgtaccc ctcccaagat     63120
     acccgatggg gtattccggg aggggttcgc gcacgtcagt ggtgagcgaa gctgatggtg     63180
     ggcagcaccc gggtcagcca cgccgggctc caccaggcag cgtgcccggt caggcgcagc     63240
     atgaccggca acagcaccag ccgcaccagg atcgcgtcga gcaggaccgc gacaccgagg     63300
     atgatgccca tctccttggg aggcagtggg tcggccaggg cgaaggtgaa gaacaccgcc     63360
     accatgaccg ccgcggcggc gaagatgacc cgccccgaat gcgcgagccc gtcgacgtgc     63420
     gcggcgtggg ggtcgccggt gcgttcgtag tgttctttgg cggtagccag cagaaacacc     63480
     gtgtagtcca tggcgatggc gaagatcatc gcgaagaaga acaccggccc ccacccgtcg     63540
     aggaacccct gtggagtgaa gccgagcagt tcggcgccgt gcccgtcctg gaagatcagt     63600
     ttggccaccc cgaacgcggc cgcggtcgag agcaggctga ccagggtgcc cagggccgcg     63660
     atgagcgggg cctgcaacgc gatcagcaac aacacgaacc cgagcaccaa gatgatgccc     63720
     accacgatcg gcagatagtc gtcgagggct tgttgcaggt cgaggttttc cgccgccgcg     63780
     cccccgacca ccgcgtcggc gggcaggtcg gcgcgcaact ggtccaggat ttcggccatc     63840
     tgcggtgcgg agggatcgac tgcgggcatg gcctgcatca tcaccagatc ggcgccgtcg     63900
     gcggcgggct ggggcggggt gagcatgacg atgccgtcgc tggcgcgcgc gatggtcgcg     63960
     gtggccgccg cgtcggcggt cggggtgatg atcgagagca tgcccggggc gcccgggccc     64020
     atctgctcgg cgatcagttc atagccttgg cgcaccggcg cgtcggtggg cacgacggcg     64080
     atcgagggca tcgcggtttt gagcccgaac accggtgcgg ccagcccgat caggatggcc     64140
     agtgccaccg cggcgaacgg ccacgggtgc ttgtgcagga tctggcccca ccgcgcgaag     64200
     accggcgagc ggtgctgctg gcggcgcgcg tagggcagcg cggcggcgtt gaccttggtg     64260
     ccgagcgcgc cgaggacggc gggcagcagg gtcagggtcg cggcgagtac gaacaccacc     64320
     gcgagcatga tcccgaccgc catggtccgc acggcgggag cgggcacgat cagcaccgcc     64380
     gacaagctca ccagcaccgt cagccctgag agcaggacgg ctttgcctgc ggtgtccatg     64440
     gtttcggcga ccgcggcgcg gggatcgccg gtgcgggcca gcgcgtcgcg gaagcgcgcg     64500
     accaggaaca gcgcgtagtc gatgcccagg gccagggcga acatcatggc gaagttcatc     64560
     gcccacaccg agatcggggt gatctggttc agcagcacca gtccacctgc ggaggccacc     64620
     aagcccgcga gggtcagcag cagcggcagc ccggccgcga ccagtgaccc gaacgccagg     64680
     accatgatcg ccagggtgac cggccacgac agcatctcgg cctggatcat cgcgtcgtgg     64740
     ttggcggcgt tgaagtcgct ccacagcgcc gaggccccgg tcggatacac ctcgatcccg     64800
     tcttcggaca gcgcggtcaa cgcggctttg tgctcgtcga cggctttgac catgtcatcg     64860
     gtggaggcat tggcgcccgc gatcacgatg ccggtgtgtc cgtcagggct gatcgtgaag     64920
     cccggttgcg gggcgatcac ctgcccgatc cgctcgtccc cggcgaagac cgccgtgacc     64980
     tgctcaacca cgcgtgccat cgccgggtcg ccgatcgtgg cggtgtcgga atggatcacc     65040
     acctgcaccg cggccgagga gttaccgccg aagtgctgct gagccagctc tctggcgcgc     65100
     accgattccg agccgttggc ctgccacccg gccccggcca gggaggtgaa cacactcggc     65160
     gcggcggcgc ccagcgcgac cagcaccagc agccatatcc cgatcactgc ccgggtgcgc     65220
     ccggccatga acgcgcccca ccggcccaga agccccggac tcgagtccgg gtgctggccg     65280
     ccagcggcgg tcccagcgag tctcgtctcg accatacagc cctccttaga tacccttggg     65340
     ggtatattca atcccgcgac gacaataccc tatggggtat cgtggtgtgc aagtccgtcc     65400
     gccgagcaga ggagtttcac cgtcatggga atcgtcgaat tcatgcgagg caccgcgggc     65460
     cgggccgccc gcatcatcgc cgggatcgcg ctgatcctga tcgggctcgc cgctatcggc     65520
     ggacccgtcg gcatcctcgt cgccgtcatc ggagtgatcc cgatcgcggc aggagcgttc     65580
     aacttctgcc tgctcggccc cgtcctcggc ctggacctgc atggtcagcc acgccgccag     65640
     gccggtcact gaactcgggc cggtcacaca accgccgagt ccgatccgtc ccgcgcatcg     65700
     ccgacaccgc accgttgtag cgatgcgcca caacacgcag gagtttgtcg atggccgata     65760
     tcgagctgtt tgtcgatccc gtctgcccgt tctcgtgggt gagttcgcag tggctgctca     65820
     ccgccgccga ggacagtgcg cacacggtgc ggctacgcca gatgagcctg gccgtgctca     65880
     acgacggcca cgacgtggcc gccgaccaca agccgatgat cgatcgctcg cgccgcctgg     65940
     ggcgggtgtt cgccgcggct acccgcaccg gcggcgccga agcgttcgca cgcctctatg     66000
     acgtcatcgg cacccgactg cacatacagg gcgatgatct cgggccgcag gaggtggcga     66060
     agtcgttgac cgaggcgggc ctggatccgg ggttggccga gcacctggac agcaccagcc     66120
     tcgacgacga catcaccgga acccacgagg tcagccaagc tgcgctcggc ggccgcggcg     66180
     gcagtccgat cgtcgtcgtc gacggacgcg ggttcaacgg tcccgtcctg accgaacaac     66240
     cccgcccgga ccgcggccga gatctgctcg acgcgctcgt caccgccgcg accacccccg     66300
     gattcgctgc cctgcagcgc ccctatcaag gcccgccgaa aatcgatgcc gccaccgagg     66360
     agacccactg atgtgctcac cgacccgatg ccgcacctgc ggcaaaacca cctggtccgg     66420
     ctgcggcgcc cacatcgagg ccgtccgtgc ccgggtcgcc cccgacgact ggtgccccgg     66480
     ccacccgacc cagcaagcag gccaaccctg gtggcgcctg cgcaggaact gaccgaccac     66540
     ctcacccctg ccggagcgga cacgctcgac agtgaccccg gtcccgcacc tcggtgtgta     66600
     tcgagctcgc gacgccgatt gcctgcggcg cagaagggta aggcttgcgc atgaaacgtt     66660
     ctgcgccggg ctttgccggc ggcggggacg agcggcaggc ggcgttgatc accgccgtgg     66720
     gcttgtccta ccccgaacag catcgccgta gggtccgcaa gtacgtggtc ctatggcgtg     66780
     tcgggtgccg tcgttgctgt tggccaccgc cgtgtacgcc gctggtggtc ccggctgggt     66840
     ggccgcggcg atcatggggg tgacactgcc gttgtcgtgg atggcggtgt tgatcgccaa     66900
     cgaccgccca ccccgcgaga aacgccgtcc ctcgctgctt cggcgccgtc ggcgccgtcg     66960
     ttgagctcgg cagtgatcgg gggtccggga acattcacga gaaaagtcac gctaaggagt     67020
     taccgcacat agtgacatac tatgtgcggc atcgcggcgg ccgagctgga gaagcggccg     67080
     agcagccagt ggtcgactcg cgaaactatg tgcggtagga ctcgcctgtc gactcacgga     67140
     gagcaatggg ggaccgctag cggaacattc cgcgcggatg ttcctcaatc cccttcgcct     67200
     acccggcgcc tgccgcgcca gcagtgtgcg cgccagagat gttcgggcgt gcggttgccc     67260
     gagcgagttc agaaggggac ggcctcgccc aggcgctgga tgacttcgcg ggcggcctgc     67320
     gcgctttcgt cggtggcggc cgcggtcacc cctgccgcga tgggggagag caggcccttg     67380
     atcatggtca agccacgttt gacgattccc ggatccggtt cctcatttac gacctcggcc     67440
     aggatcgtct cggtgtgctc gcgaacctcg gtggtctcgt cgtcggccag ggggaaccgc     67500
     ggcagtgtgg cgagcagctc ggcgagagtg gccgcgagct cttcgtaccc gggggcgatc     67560
     tgatcgctgt gggcttgtcc ctggtgcacg gttccgttgt tccaggccag ctgggcgtgc     67620
     gagccgtgga ccgtgacgat cggaccgttg tagttggtga tgttcgccgc gggcgggtag     67680
     accccgcccg cctccatctc gatcggcacg cggaccgggt tcttggcgaa ctcccgctgg     67740
     atctcgcggc tcatctgctg gatgccacgg cgattgatct tgaacccgct catggacagg     67800
     tcctccttcg acacgaatag ttcgatggcc cacgatctca tgcacgcccg acagctaccc     67860
     cgacagctac tccgccctac tcagacgggc gcgccgacgt cacgtcggtg tgggtcggta     67920
     cccagctgtc ctggcctggg cctcatcgcc atctccgggc gaggatcggt gtgacagcag     67980
     gtgccgtgat ctggaacgtc gaaaggtccc gcccggaggg cgagaccttt cgactcctgt     68040
     ttacggacgg tgcgctgctc taaccattga gctacgggcc ctcgtggtgg acccgacggg     68100
     attcgaaccc gcaaccttcg cagtgccctc gattctactg gaggggaccg acaggtctgc     68160
     ggcggtggtg cagcgtggag ccgcgcgcgc tatcgtcgat ggcagcacgc tgctggcctc     68220
     gggccgggca actcttctct aggtgatgag gagcctggga tgctcggtcg ctgcgcgaac     68280
     tgccacttcc tctcgccgga tctccccgga actgttccca gtccgcggtg cccgctctcg     68340
     accgagaggg gtcgtgcgcc cgcacgatgt gaagacgacg aaccgacagc ttcaccttgc     68400
     ccggaacctg tcgaagacac cgtcgtcccg ctgctgcggc agctgtgtcg agtcctggag     68460
     ttcgtgctcc atgtcgggtc ggttatggat tgggtcggac agttcatgga ttgggtcggc     68520
     cacgtgctgg agtcgatgcc ctagtgcgcc cttgtgctgc tcggcgtcgg tgcccagcag     68580
     cacaatcatg ttgtgcggtc ttggaaacct gaaacgatca tctgccagta ctgctcgatg     68640
     gaagtggtgt ggctgcccac tatctacggc gggaacaagc tgttcgacgc gaagatgtac     68700
     ccgacctccg agtcagctcg gggtaatcgg ttcgcagcca agcgcaacgg atcggtcgtc     68760
     gacctggacg acatccacag caatcgctgg ccggcggaat gtctccacct ccaccggtac     68820
     tcgtgttcgg agtacaacgc ggacatggag gcacggatct ggacgacgaa gcagtcgccc     68880
     ggacgggacg gacgacgcat cgccgagcct ccgttctgag cagcgccggg cagggtacga     68940
     accggccggg accccagagg gcgtgcgctc tgggggtccc gcgtcgatgg agctggtggc     69000
     gccgggttat tccgtgtccc accaggcttc cgtggcgaac cggtcccagt ggttgttcaa     69060
     ctccacgctc aatgaggact caccatcgtg gtggatggtg aactcgaagt ttgcggcatc     69120
     ggcgatcgcg cgcatgttca tccacgtcgc cgagatgatg ttcgcgtaca gctccgacgg     69180
     gagcggtttg tcgaactcga tggtcagctt cttgcgagcc acctcgcacc cccagtcgct     69240
     gtatggcacg cccgcccagt ccggctcatg ctggagcgat catagggcgg caggaccggg     69300
     tgtccgaagt gaaaagggtt ccggtggggt tcgcgggcac ctcggacgct accggtcgtg     69360
     cttgtcgatg gtgccgagct gggtgagcgc ggtgcgcagg tggcgggctt gctggtcggc     69420
     ggtgtcggca cctgcagcga gtgcggtcga tgccgtgtcg gctgcggtgg ctacgacggt     69480
     gtcctgggtg tcggcgagcc ggtcggtgac tgcggtgatc tcgtcgagca gttgtcgggc     69540
     gtgggtggtg gccaggagca ggtcggcgac gagagcgcgg gggttttcgg gtcgctcgac     69600
     ctgtgcgtgg tcgtagttgg ccaggcgggt cttccagggc tcgatgaccg cggcgccgag     69660
     ttcggcgagc ggggtgtggg tgcgggtggc ccatcgtcgt tcggcttcca gcggtgagac     69720
     gccggccgcg gcggcgatgg cctgccagct ggcgccctgg gcgcgggcgg tccgcacggc     69780
     gtcgatcagc tgtccctcgg cgcgcatcgc gttggcggcg gtgacctcga cggggtggac     69840
     gatcctgtcc agggtctcgt cgccgtgctt gtggttcatc cagggctcct cgaggtggcg     69900
     cggcattccg gcgaattggt ggtcggcaga actggtttcc gtgctgggtg ccggttggtc     69960
     gtgtgcgagt atgcgcgagg gccggggcat gtagccgatg ccccggccct cgcgggttgt     70020
     ggtggtcagg gtccggtggt gatgagggcg gcgatgccga gccagagcca gtgccaggac     70080
     tggtcgaggt gggcggcgcc ggtagcgagt ccggtgccgg cgcggtagaa gccgccggag     70140
     ccgagaaggt cggcgagcca ggccaaggtg gcgcggcggt cggcccagta gtgcgtgacc     70200
     gccgagaccg tcagtccagc cgcagcccac gccggttgga ccggcatgcc gagccaccaa     70260
     tcgacggtgg ccaggcacag ggcgagggtg agggtgtagg tggcgacgtg cttggtgcag     70320
     gcccagcgcc cgctccagcc gggtcggcct ttggtctggg cctggtggtc ggtctgcacc     70380
     cagtagtcgc cgacctggtg ggcgacgagg taggtgccga gaacggccgc gaacaccgcc     70440
     gcgccggtca tgcggtcctc ctggcggcgg tggggaactg gctccagatc acgccgtcga     70500
     gttcgcggcc ggcggccttg ggggtgcgtc cgccccactg cttgaagaag aacgccgtgc     70560
     ccgcggtgac gcactggtcg cgcaggtcgc gcacccattc cgggtcgatc ggccgcgcgg     70620
     ccgggccgga ttccccgccg acgatcaccc agtcgatcgc cgggcgcggc gcccagtccg     70680
     cacaggcgcc accgcaggcg cattcgttgt ggtcgccgtc gtcgggccac cggcacgagc     70740
     agccgtccgg gcaccggtcg gggaagagcc acgggtcgag gtcgatcggg cccagcagcg     70800
     gctcgcacga cagaaaacgc accgcggcgt cgatggcgag caggtcggtg atgcggtggg     70860
     tgaccgcacc gtgctcgacc gaggtgccga tccagacgtt gtcgggcagc accaggccgc     70920
     gttcggtcag ccgccgcgcc cgcgacgggc gcttggtcag cacctggtag gtgtgctgcg     70980
     gcgtctgccg catgacctcg acgacggcgt ggacgaaggc gtcggggaca cgggcgtgga     71040
     acaggtcgga catggagttg acgaacacca tccgcggtgc ccgccaccgc cgcgggatgt     71100
     cgagggcgtc ggggtggacg ctcacgccga acccgggccc ggaggtgcgc gggtcgccgt     71160
     cgcgctgata cttcgccgag cccatcgcct tgagccgttt ggccatcgcc agggcgtagc     71220
     agtggtcgca gcccgcgctg atccggtcac agccggtgac cgggttccag gtggtttctg     71280
     tccattcgat accggtggcg ctcatgcggc ggtcctttcg atcggttctc cggtgatggc     71340
     ttcgacgagg gcgcagccga tgacctcggg caccggtggg gtgaccgcgt tgccgtagcc     71400
     ggccgcctgg gtgcgcttgt cgccgatggg gatgtaggtg ggcgggaatg ccatcccggc     71460
     ccggatctcg tcgggttcga gcatccggaa cgtgcactcg gccaggattc tgtcggggtc     71520
     gatgccgagc aggccgtgcc ggtcgcgggt ggtcagggtg cccatcggct cggtgagcgg     71580
     gcgggcgagg ccggtgcggt agtagggcac gagcagctgc tcacgcgtgc ccgccagctg     71640
     ctcgacgacc gcggtcgatc cgggcggctg caccaggccg tggtgaaagc ccctggcgga     71700
     gaaggtgccc agcggttctc cgacgtggcg ggcggtcttc ctgctgccgc cgccgcgcag     71760
     gctggtgatg aacggcggga tggccacggc gagttcgcgg cgggtggtct gtgtcggcag     71820
     cggctggccg gtgctgcggg cggtgaggtc ggcgcgcttg ctggtctgca cgatcagcgg     71880
     cggcaccacc aggccgtcgc tctcgcgggt cgtgcgggcg ggcatcggcg ccgacagcgc     71940
     ggtggggtcg gcgcgccagg tgcccccggc cggggtcagg aacgactcac cagcgaattt     72000
     cgccagcccg atccggatcc gctccatcgt ggccgcggcc agcgggcggg cccgctcgcc     72060
     gatcttctct cccggatcca ggctccagtc gatggcggcg gcggccggga ccgtgaacgg     72120
     ctccacgatc tggaagcggc aggacttggc cgggcagcgg tagacgtact ggccgtggcg     72180
     ggcgccgtag cggcccatgt cgatgccggg ctgcttccag gactgcaccg cgtccaccac     72240
     ccgatcgcaa gtcgggcacc aggctttcgg gcgcaaccat ttgtcccagt ccgggcgtcg     72300
     ccccagggat ttgagccagt aggcgacata gagccggtcg cggctctgcg gtgcgggcag     72360
     gcaccggcgc ggcaccgcgt gcatgctgtt gagcgcgatc acccgggtct cgtagccggg     72420
     gccgatcgac tcgatcgcgc gcagccagcg gtcccactga tcccagcgac ggcactggat     72480
     gacgttctcc atcaccccgg ccagcaccgg ggtgccgcgc ccggccatcg cccgcaggta     72540
     gcgcgggatc tgctcgacca gcccgcgcga gcgggcctca gccggatcct cgatcaccgt     72600
     ccccagctcg tcgtcgctga gcagcgtgta ctgattcgac ttgtcgaagt accgtttgcg     72660
     gcccttggcg tcggtccagg ccgggcacgc cggcgacgcc cagaacaact cggtataggg     72720
     caaggtcgcc aggtcgatgg cttcgacgtc gccgggcgga agatgctcgg cgtccgggaa     72780
     gttcagtgtg tggacctcca cacacaccgg gttgtggttg gccgccagcc gcaactcgat     72840
     gccgggaacc tcctcccagc ccagcgaatc gccaccccaa ccggcgaagt agaccgtgga     72900
     tctcagagac atccgaaccc ccatcatgtg aacaaaattc gcgtactcag ttcacattga     72960
     ggctcggccg agtgtttgtc aactatgttc gcgaacagtg ttatgcgatg atggcgggca     73020
     tgagcgacga gaccgaccac gcggccgcga tccgcgccgc gcgagcggcc tacgaccagg     73080
     cccgctcgga gttgttcgcc accatccgcg ccgccctcga cgatggcgtc ggcccgtccg     73140
     cgatcgcccg atacagcgac ttcacccgcg agtacatcgc ccgcatccgc gatggcaagg     73200
     ggcccaaaga cattcggggg tagcccgcgg tgacgccagg cgccgaactc ggcctggcag     73260
     gtgagtccgg tgtcgccgaa ccaacgatct ttcgcttacg aggcgaatgg ttcggcggga     73320
     cggccttcgg cccgttaggg cagctgcgcc catgcgggca ggggttcttc caggtagagc     73380
     aggatgcgga tccaggcggc cagtaccagg gctgaggcgg tgctgtaggc gccggcggcg     73440
     atgcggacct gcgcgtccca gccgtggtgg tgccatgtgt tccagaccgc gtaggcggtg     73500
     aagccgaaca gcacgcagcc gatgcccatg taggtcacca gggtctgcac tttgagcagg     73560
     atcggttgcc ggtcgaggtc catcacctgc cgggcacggg cgccgccgag ttcgtgggag     73620
     gcgacgccga gcatcgggag tttcgtggcc gaatgcaggc gaacttccag gatgcggatg     73680
     gactggttgc gggtcaggac cgcgcccatg atcagcacgt ggaaggcagc gaccatccac     73740
     agcggcaccg gcaacaggac cggccacatc gccgcggctt tgacgtcttt ccacgcggtc     73800
     acgaccaagc ccaggtaggc gactgcaccg gcgatgaggg tcagcgccga ggtgttgtgc     73860
     tgggactgat cagcccgatc ggcctggtag agcgcagcca aagcggtcac ctcgaccgcg     73920
     tcgaccggcg gcaggctcgc cgggcccggc gagcctgcgc tcggcggcgg aacgggtgct     73980
     cccatactgt cccccgggaa gatcagggcg agctctgccc gccgtcaccg cccaggatag     74040
     aggcagcgca tccgcggccg atgtgtttca ccggacccgc ccaggcgcca cacgaagggc     74100
     cgtcacacct gcatcgtggc tcgacgcagg ggcgtccgag cgggaccgcg ttcgcggatt     74160
     acatggtggg ggtggagtcg tcgaggtcga caaccgctac cgcgggtgtg gggagggctt     74220
     cggagccggt gaggaaccgg ttgaagccga tggcgccgtc gccgatggtg cgttcgacga     74280
     tggtcgtggt cacgtcctgg atgcggccgc cggcgacgac gtggtcgagc aggacttcgg     74340
     ccaggcgcag atcggcggtg tcgtagtcgt ggtggaccga gacgtgccgc agacccggac     74400
     cggcggaacc gaactgggtc ttggcgccgg tgagcgcgcc atcgacgatc aggatccaca     74460
     ccgcggccgc gcaacggtcc gccgcgatcc gcagccgccc ggccagggtg ccgtgcgggt     74520
     cgcagccgag ccgctcggcg acgtcgaaca tgctctcggc cgctcccagc cgcagcagct     74580
     ggcgcgcgac gtcgatctcg gaggcctcga actcctcgca cagatcatcc agcggtgtcg     74640
     cccgctccca gccctgccgc agtcgatcca ccattcccgc gtcccagtag acggtgcggg     74700
     cacggcgagc cagctcgcgc agcggcgacc gccagtcgta gtccgggtcg gccagcaccc     74760
     cgcgcagggc ctcgacagcg gtgggtctgg tgtcgaagtc cggcgggagc atcttgcggc     74820
     actgcgtggc gagcgcgctc acgctccgac cggcctgctc agcgatcgcc tcgaccggca     74880
     gcccggcacg cagcaactcc accagctcgg cattgcactc gtcggtccac agttcaccgc     74940
     tgcggcggcg tcgtctcggt gtttccggca tcgacagatc cctccctgac cgaatcccct     75000
     gcgccacatc ctgttcccgg cgcacaccca tgatgacgcc gaccaccgac agaccaaccc     75060
     cgatcagatc cactcgcgca gcgcgggaat cagcgcgcga accacacaga ctcccagccg     75120
     cgaaccggtg atgcaggtca catcaaccgg tgacaccttt tgcatctggg gtgtcgttct     75180
     ggcatcgcct ggtggtgcgg acagcgctag cgcccgtggc agcagccggc cagcgcgcag     75240
     ttgctgccag gggacgcggt cagaagagga tgagcagcag gacgaaggcc acggccgcgg     75300
     tgacccacca cttccagtgc gtgggcagga tgcgtagctc gccggcctgg ccgagccggt     75360
     agatgtggtc gacggcgtcg cgttcgcgtg gggtcagcgg ccgtgttcgc ggcggtacca     75420
     cggtggtcag cggcgtgtac gggcaggtcg gcagcgggtg gtaggtctcc gggcagcgca     75480
     ggttcagaca ccggtacctc ggcggcgggt agtacgtcat cgcgtgctca ccctctctcc     75540
     ccggggtcgg ggtgtgagcg tagcgcttcg cgtgggcaca ggcgccggac tcggcggcgc     75600
     aggtacagct gcccgtgcac ggccagcacg atccgcaacc gtgccgccgc ccaccgcgcc     75660
     cgcacctgtt catcggtcat gtcgtgttcg acgcagacga tcacggcgag gttcccccgg     75720
     cgacgaggat gccctgaggg tgtccgcctg gcatgggcgg ggttcagctg gcgaggccga     75780
     gcagctcgag cagatcgtgg ggcccatcgc cgtcgctgtt gccggcgggg agctcgaaca     75840
     gagtcaacgt cgatgtggcg gccgcggctt cggctgctcg ctgctcggcg cgttcacgga     75900
     tcgcgcacgt cggcccgatc ccctgggcga ccgactccgg cgagagcagc cagccgtggc     75960
     agcggcggca gtgcgcgacc aagcgcaccg tgggtccctc ggtggcagcc atgcgttcct     76020
     ctccacggag tgtgccttcg ccgctcaggg tgacacgaca ggccgacacc ctgggcgcac     76080
     ttcgaggtcg atgcacccct gggtcatggc tcagctggtg ggccggtcgc aggaaggcgg     76140
     cgtccagtct gcgtgtggcg ccagggcctg ctccaggacg tcgggacagt cggtgtcggc     76200
     gggcaggcgc tgatgtgcgg tgagcagcag atggtcgaag cgggcgtgct ccgggccggc     76260
     ggcacccccg agcgcggcga cggtgtgcag gaactggtcg gccagcaccg cagtcggaag     76320
     accgcggtca cggctgtggc ggcgcagcag ttgctcggcc gcggtggagt cgaggccgta     76380
     gacgagcatc agcgccccct tggcctgctc gacgcgcccg cgcgatcgac gcaccccttc     76440
     cagaacctcc gcccaacccg gccagtccgc tcgatcgctg ccctcgacat cctcgctcat     76500
     ctacgccgtg tacccgcctc agcgcgcccc aacgtcaggt tcaattcgct cgcacacctc     76560
     tactactact tatctcgtaa cggtcttgca tccaagacaa cggcccgata acgggcctga     76620
     ccaccgtttt tccaccacgc gtgagcggcg ggggtattcg tccggcgcaa caggccccaa     76680
     atcccgtcac accttctgca tctccatccc ctccaggcgc gtatttcgtc cgccgaaact     76740
     cggtacggtg gggagaatga cccgtccaga ggctcccgaa ctctgcccgc gctgcggcga     76800
     gcccatcgtg cagcttccgt tgggtcgccg ccgcaagtgg tgctcggact actgccggcg     76860
     ccgcgccgac gaagagggcc tcaaggtcca tgaggtcgtg cgcgaacgcg aacgggtggt     76920
     gtaccggccg gagcgggtct cccgcgagca gcagatcgcg cgactgctcg atgatccaga     76980
     ggccaccgag cagctgctgc gcgccctggc ctaccggtgg cgtcacaccg ccccggaccc     77040
     ggccgcccgg cagcagatcg ccccgacgct gctggagttg tggcaggcat ttcacgcccg     77100
     catcgacccg cacaccgccc agcacccacc ggcgaagatc ccgaccgtcg ccgctgaaca     77160
     gcgcgcggcc gtcgaacgcg ttctgtcctc acctcgctcg acggccagcg tcatcaaccg     77220
     cgtcaccgac cggctcgacg caggagaact acgaagcggg cgcgatgaag cgatcctcaa     77280
     cgccatcgcc tacctgacca cgcgccggcg cttcccacgc cgctgacgcc cggattcagt     77340
     ccagcaacag ttagacaacc gtcttgttcg ctgccgtccg gcattactcg aatgtcggtg     77400
     tcgtgcagcg cagcagtcgt ttctacctat ccgtgcacgt cgtggtgacg aatgaagttc     77460
     tgtcactgtg gtcggcggga tcgctgccct ggtgagggaa tttcatccac gatgaacatc     77520
     gaggggttgg gttggcactg gcggtagtgc ggtcgctgcg cgagacgcgc agtttggtga     77580
     ccgacgagga gctggccgat tttgagctgg atgtgctgtc ggagttcgtg ctcgcgcggg     77640
     cctcatccgg cgttggagac agcacgatcc ggggcgacac cacgcatctc gggcaggttc     77700
     ggcagtggtt cggccggccg ttgtgggaga tggaaccgca ggacgcggat cggtacttcg     77760
     gcacggtgct gcgccgggtg tcgtcgtcga ccagggcggc ccgagcccgg accgtggtgt     77820
     cctatttcga gttcctcgag atccggtaca aggtcgtgtt gcacgagatg accggccgtg     77880
     tggtcgagtg cccgatcgac gaggtgaacc ggccccgaat gtcggtggac acgatggtgc     77940
     ggatcccacc gaccgaggcc gagctggagc agctgttcac ggggtggcgc gaggatctgg     78000
     tgacctgccg caagttcgcg ccgagcgccc gcaactacat ggtcgcccgt ctggcggccg     78060
     atgtcgggtt gcgggtcaac gaggcgtgca tgctcgacct cgacgacatt cgatgggagc     78120
     tgggcaggtt cggcaagctc aacgtccgcc acggcaaggg cgcgttccgc agtggaccac     78180
     ggcaacggct cgtcccgctg atcaacgggg cggacaccgc gctgacctgg ttcgtcgagg     78240
     acgtgtgggc ccagttcgac gctgacgaga ccttgccgcg cgcaccgttg ttcccgtccg     78300
     agcgccgccg ggcgggcagc tcgggcaccc gggttacccg ggacgtgatt cgtcgcgctc     78360
     tgggtggtgc ggttgatcgc cacctgccga cctggtccgg gcggctcacc ccgcacgtgt     78420
     tgcgccacta ctgcgccagc cagctctacc ggaccggtgt cgacatcctc gcgatccagg     78480
     aattgctcgg gcattcgtgg atcaccacga cgatgcgcta tgtccacccc tacggaaccc     78540
     gggtcgagga cgccgtcacg gccgggcaca aacgcgccgc cgcacgctgg gaaggactga     78600
     tccgatgaag tggaacctgc gcctggtcgc cgcgaaccgc ggcatctgga agtccagcga     78660
     actgcgccgg atgctcgccg cgcgtggcct cgagatcagc accggcaaga tgtcgggaat     78720
     gtggtcgagc acgccggcgg tgctgcgacc ggaggaactc gacgtgctct gcgcggtgct     78780
     caactgtggg atagccgaac tcatcaccgc cgaaccggac accgtcgcgg cgccgactga     78840
     tgccggggag catgtccggg cggtcggaga tcagggcccg gagtcggtcc ggcggatcgt     78900
     tccgaagccc aggacgggcc ggtccctccc gccccgatga ccgccaccag ttgccgggaa     78960
     tgcggcggtc ggatcgaggc gagtacgtgt ccacgtggcg gccgccctcg ccaatactgc     79020
     ctgacctgcc gaccgtcaaa gacggcagaa cgacgagccg aaggcgcgaa agactaccga     79080
     gacggttcgt gtgttgggtg cggcacgcag ctcgaacgcg ccgcccgcac gatcggacgc     79140
     ccccggatct actgcgacgc atgccgcggc cgccgggccc gcaccccatc ccggtcccgc     79200
     cgacgcaacg acgccgggcc tgcccaggac aaccgttcgg aggcatatcg ggatcgtcga     79260
     tgcactcgct gcgacgcccc gatcgaggtc gacggtcaac gaaagggccg tccccggatc     79320
     tactgcgacg gttgtttcgg ccgccgggtc cacgaacagc gccgccaccg aacgaggccg     79380
     cgctcgctcg atggtcttcg gttcgccgag gtcttcggca caatcactgg ccgcgtcgag     79440
     cacgaagttc tggagcgact gttcgacaca gcccgggtcg gccgctggag cgtcgcaacg     79500
     gtgcagcgca ggagcgagga gttgcgccgc gtcttggcca ccgccgggga cgaaccgatc     79560
     tccctcagcc aggtccgcgc cgaactcggc aacgtctggc agtcccggat cgcggctcgg     79620
     gtgctcgacc agtgcggtct gcttatcgac gacaccgagt caccgacacg gcagtggatc     79680
     gaccgccgca ccgccgagct cccgccggga ttccgtgacg atgtccgagc ctggctggtg     79740
     gtgctgcacg agggcggaca gcgagcccgg ccacgggcgg aggcgacgtt gcacgcctac     79800
     tacagtcgcg tacttccgcc gctgaccgaa tgggggagca cccgatcgca cctgcgtgag     79860
     gtcacccagg ccgacgtgtc cgtagcgctg aaccggctga acgggcacaa gcgggtcggg     79920
     acgttcgtcg cgttgcgttc actgttccgg ttcgccaaac gacaccggct gatcttcctc     79980
     gacccgaccc gtcgcctccg tgctggcgcc gcaccgtcgc gggtgctgct gccgatgacc     80040
     accggccagg tcgacgcggt caccgcaaca gccgtgacac ccctccagcg cgtcgtcgtc     80100
     gctctggtcg cggtctatgc cgttcgcgcg cacgcgttgc gacagctcgt gctcgacgat     80160
     ctcgacctag cgcgtcggcg gatccggatc ggcggctctg ttcaccagct caccgagttc     80220
     acccacgacg ttctcacgga ctggctgacc taccggcaac agcgatggcc gggcaccccg     80280
     aacccgcacg tgctggtctc ctccgattcg gttctcggca attctccggt cgaggactac     80340
     tacctgacct ggcatctgag cctgctcggc atccagcttg aacacatccg cggtgaccgg     80400
     atcctcgaag aagcgctctc gacggacacc gacccgctgc acctgacgat catgttcggg     80460
     ctctccgaga agtccgcggc cgactacgcc aggcttgccc gcggcatcac ggagcggccc     80520
     atcgaggccg tcagtcacta ccccgccgac tgggactgat ggaggcggcc cgctgccgcg     80580
     gccgcctccc tgccatcgtc tcgatgccgg ttctgccgaa accggacgcc ttctcgcacg     80640
     ccggatcgcg aaacacgttg ggttcccgct gaaacacctt cactctccgt gaacccactg     80700
     ctttcgagtg agcaagatat cccaaaaccc cggggttttg gcgtgagccc ggggacgggc     80760
     ggaagggggt cggtgactac ccgtccgcgc tgggctcgag ggcaagcgag cgaagctcgt     80820
     gcggcagcac caccgccggg accccgttcc gaccgccctg ttgattcagg gagtcggcag     80880
     cgagttccgc agcgccggtg cgagcaagtt ccgcaggctc ggcgtcgcga gtcggcagcc     80940
     gaggtggttc cgccgctttc gggggcccga ggacgggcca ccgcgcccct gcgtccttgg     81000
     cccgttcgcc acccccttgc ccatcggccc cgggcagggt cagcgctcga atccggtgtc     81060
     ccggttgttg ccgcgcgctg gtcggggcgg cgttatcggc gccttggtgc tgcgagtgga     81120
     tgtgcgacga ggcgtggcca gtcgttgcag cgtcgccgcc tcagcggctt ggcgatctcg     81180
     tgcggcgcgt tcgtcctcga tcggcagcca cgggcgcggc cgtgacgggg tcatcggctt     81240
     ctgcactcgc cggttggtgt tggtggcgtg cagcgccttc tggttgagga tcgtgttggt     81300
     ggtgattgcc gggtcttccc cggtgacgtg ggcatgggcg cggtaggccg cgacccaggc     81360
     cggcgagcct ggagtcgact cgtatggacg gtccgggttg atcccggcgg cgcgcatgtg     81420
     gacctcggtc aatgcttggc gggcctggga gtacatcgcc tctgccgcct gtgcctgccc     81480
     gaccgcgcgc cgtgcctccg ctaccgccag gaagcagtcc atcatcgcct cgatgagcgc     81540
     gatctgagag gcctgccgcg aggtcgtcga ccacagcagc cgcgccgccg cccgcaccga     81600
     ggccgtgtcg gcacgctctc ggcgcggcag ccgccgagcg gggtcggtgt caccgatccg     81660
     ggcgagctga cgcgacagcc gatccatcgg gcccggcgcg ggctcggtgg atacgctcgc     81720
     ggccgcgaac agtcctgccg tcgccgaggc ggcgcggcgc accgcggcgt ggtcctcggc     81780
     cgggatcgcc tgaatccgct ggcaccaccg ggacacggcc gcgagcgcct cggtctgggc     81840
     cgccggatcc agcggcctgt gcgcgccggc gcgggcgccg cgccggtcgc tggccgccag     81900
     cagccgccgc cactctgctg ccgcctcctg ctgcgcggtc tcggaggtct cccaccccgc     81960
     ccagctgcgc agcgcgggca gggtcagatc cttgcccagt tgcagccccg agtacccgcg     82020
     tggtgtctcc cacacgccgg tctcgacgtt gcgctgggcg ggcatgcgca ccgagtagcc     82080
     gacgacctcc tcggtggagt ccttggcgaa ccgcggccgc accacgatct gctgggtgcg     82140
     caactcccgc agccactccg cctcactgcc cgtggccgcc gccgcggccc gcactcgccg     82200
     gcgcagcgcc tcccggtcgg tctcgtgtgc gccgacgcgc tgcatgtacg cgcgttcggc     82260
     cggtgtcgtg gccgcctcgg tctcccctgt ctcccgcgac gccaacaccc gcagcccgtg     82320
     cttgcgttcg acccggcccg ccgcccgctg cgagcgcggc cggtcataca tcatgtccac     82380
     cagcgacccg tccgcacgca ccaccgacat ggcgatgtgg atgtggtcgc agccgttgcg     82440
     gttcggcccg tgatgcaccg ccgcccaccg cacatccggc accgcgtccc cggcgtcgac     82500
     gaaccccatc tcgcgcatga agtcggtcgc aatcgcctgc cacttctcat ccgagagcgc     82560
     accctcgtcc gggtgcagcg ccagcgaaca gtgccaggtg ttctcatcgc tggtggcggc     82620
     ctcgaacgcc gccttgcggc tcatgccctc cgccatcaac gcgcgagcct tctgatagct     82680
     ggtgaccgac accgggtcac cgcgcagcag aacctggcgc ggactgtcga gcagcttgcc     82740
     cagctcccac gcccgcgcct ggttgatccg gccggcgaac accgccatcg tcaccgcatc     82800
     ccccgccaac acccgctggc cgacgtgttc gttgtagcgg cccggacccg ccaggtacca     82860
     caacagccgc ttgatgtccg agcccttcgt cgagttcgga atcatcgcgg cctcacaccc     82920
     cgccgccgtc cacgtcgtcg atgtcttcgt cgatgccgag caccccgagg ttgtccaccc     82980
     gctccaccca ctcctgcgcc gcggccagct gatcctcacc gatcaccgac ggcgacaccg     83040
     acggcgtctc tcccatcacc caccgcgcca acgcatccat ctgcagcgcc gcacgcacca     83100
     ccgccgccac cgccaacggc aacccctcgg ccagctcccg gttctggtgg ctgtagcgca     83160
     ccagctggtt gaggttgttc agcgcccgac gatcctgctc cccctcctcc agcgcccgca     83220
     gcgccgcagc tgcccgcccg acctctgggg tcgccttgcc cagcgtcgtc tccaccagca     83280
     gccgcggcac cgtcatccca gccgcctctg cccgcacggt gaggtcggcg tactccgaat     83340
     ccgacagctt caccacgcac cggtgcgacc gcccgccggc cacgttcgcc tgccgcgtcc     83400
     gacgcacacc ggcacgctga ttccgcgact cccctgccat ccgcagcctc ccaacagcca     83460
     gcgcagcgac cacccgacac ccgggcgggg tgcaccattg gtgcacctaa acgttagctc     83520
     gctcccactc aatttgtccc agactaccga ccggaccgta cgaggccgtg tcgctgaacg     83580
     gtgaccacac cgggagagtg gagcgcaggt gccggacggc ctctcggcac ggatcggggc     83640
     gcggatccgg gtgacgcttc cgagttgggt ggtgggtgcc cccggtactg tcgcggcggg     83700
     gtccctggtt tgttcgcgct gccaggggct ccgcacacag aaggaccccg ccgggtaccc     83760
     gccggcgggg tccttcgcgt tcggtgctgc ccggggttca gaccaggcgg ggtccggaga     83820
     ccttcgtagc ggcttccagt gcgcggccga ccgtcgagtg cggcaggccc atcgtggcgc     83880
     cgatcgcgtt cggggtcgcc ccggccgagg ccgcttcgta gatcgcggtg agctcctcga     83940
     ccgacttgcg cgagagcttg cgatcgacga ccgcgcgcgc gatcaccgtc gcctccgcgc     84000
     gcgacaacgc gcgatcgaac gggccgtgcc caccgagtcg cgcgcgcggg gcgggttcgg     84060
     tcgcgcgcgc gagcgccccc tcgatcactg tcgatcgcgc gcggcccgcg cgcgatgggc     84120
     gcgcgcgatc ggcgtcctcg cgcgcgatcg gcgagaccgg cttcggatcg cgcgcgatcg     84180
     acaccaccgc gcgccgatcg cgatcgacgc cctcggtcgc gcgcgcgacg ctcgcgcgtt     84240
     cctcgctgcc gggtcgcgcg ttcgacagct gctcctcggg tgtgtgatcg gcgcgcgagt     84300
     cgcgatcggt gtccagctca ggaccggttt gcgcgatcgg cgcgcgatcg accacctcga     84360
     cctcgcgcgc gatcgactcc gcctcgctgc cggactccgc gcgttcgaca ctggcgtccg     84420
     cgcgcgcggt cgagacctcg cctgcgatcg acacggcgtc ctcgcccgcg cgtccgtcac     84480
     caatgtccgc gcgcgaacgc gcgatcggct cgcgcgcgat cgacgcgcga tcgaccggat     84540
     cgctcgcgcg cgactcgtcc tcaccgcgcg cgagcgatcg gtccgcgcgc ggaccgccgg     84600
     ccaccgcctc gcgcgcgcga tcgatcgcgg actcggccgc gtgcacaggc gcgtgatcct     84660
     cgtcgccgcg cgcgagcggg gctgtcgcgc gggcggtcag ttcgcgctcg acctcgcgtt     84720
     cgagagcggc gatctccgca cgcaccgcgg ggtcggattc gatcgtgtcg agcgtcggcc     84780
     gcggcgcacg ggcggtgtgg tcggcccagt cggtcaccgg ccggtagttc ggcagcgtgt     84840
     acgccgagaa acggccctcc aaatgctcgg cgagctgagc gcgcactgat tccttgccga     84900
     gagcgatgcc gtcggcggtg gccttgtcga tggcgcggtg cagacgctgc atggccttgc     84960
     gctcagcccg gccgccgccg ttgatgcggg cgatgcggac ggcgtcggcc gcgagggcca     85020
     ggtcggccag gcgccgctcc acagccacct cggcgacggt gcggtcggtc ggatcggcga     85080
     tgccccactt caccagcagc cgctgcggtg tccaccgcca gttcatgccg ccggcgcggc     85140
     cggtgagctg gcgacgctcc agcgccatcg accgctccca gccccatgcc gcgaccagcg     85200
     gggcggccag gcgcagcacg agcagcccga cgtcgttggt ggcgtgggag gcggccagga     85260
     cgccggacag gatggtcagc acccacatcg cgatgccgtc gacgccggca gatccggtgt     85320
     cgatctggga acgccgcgcc cgcatcgccg aggcgacgac catgagctcg atgaacgcga     85380
     agcacagcgc ctgcagggcc gggtgcatgt gcagcgactc ggagaacatc acgtacatgc     85440
     cctgcgcggc cacgaccgag gcgatgcccg cggtgaacag ggtgacgctg cgttcgatct     85500
     tggcgctgcg ctggtccttg gccttccgtg cgaccgcttc ggctggcgtg tggtcggggg     85560
     tcatttctgc tcacctttcc ggcgtgccat ctcgtcttcc aggcgcgaga tggtcgagtg     85620
     ggcggtgtcg agggcttggc gtagcgccgc gacttgggcg ttggccgctt cctgcgtgcg     85680
     ggccagttcg gcggcgtggt cggtgcgcat ttgctcgcgg tcggcgcgcg cctcggcgcg     85740
     cgcgctggcg agttcgctgc gcagctgctc gcgctcggcg cgagctgcct gagtcagctc     85800
     ggtcagctct gcgcgggcga cctcgaggtc gcggcgtagc tgctgggcct cggtgcgcgc     85860
     gtcggcggcg gcctgctcag ctccggcccg ctcggcttcg gcgtcgcgtt gagccttgct     85920
     ggccgcgcga acacgggttt cggcggcgcg gatctgctcg ttggccgctg cctggatctg     85980
     ctcgatctcg gtcgcggtct cggtgcggat ggcgtggacc cgctcggcgg cggcctgctc     86040
     agcggcggcg atccgcgatc gagcgtcggt gagtgcgtgc tcaagttcag cgtgcgcggc     86100
     cgcgacgtcg gcgcgtgcct gctcgatcac ggtcgcggcc tcagcacgtg cctggtccac     86160
     ctcggcggca gcttcggcag cgcgggcgtc gcgatcggcg atcgcgtcct cggccgcgcc     86220
     ttcggccaag gtcttgtcct cgatcgcacg cgccagctca cggcgagcgg acagcgcctc     86280
     gttctcggct tctgccgctg cggcgcgggc cgcgtcgatc tcggcttgtg cttcggccct     86340
     gatgcgggcg acctcggcga cagcggcgtc cggatccccg gcggtggcca cgatctcggc     86400
     caccctatcg acgatctcgg cctgctgcgc gcggtgtgca gtggtcacca tctcccactg     86460
     cgccagcagc tcggccagcg acgcccgcgc cgaggtcacc ggtcgcggca caggacgatc     86520
     cggccgtgcc gtcgcaccgc cagcggcttc gagctggagt tcccgcttgc gctggaaggc     86580
     agccgcgcga tcgtggcgac gccgcacccc gtccggatcg acgtggaact ccccgcagta     86640
     ctcggccttg cgtccccgtc caggcggcgc gggcggcaac gggtgaccgg ccaccgcgaa     86700
     ctcccccgag ccggggtcgt aggcgacggg gaattggcat acgcgccggt cggctccgtc     86760
     atctgccccg acagcggggc cctgctctgg attcgtcacc ctccaatcct accataaacg     86820
     ttttcgttta tcgttctacg attacgttct atcgttttaa cgaaaacatt tgtccggaat     86880
     gtccccactt cgtttggatg gtggacatgc ggggcgcggg tcgtgggctg gcgaggcgtc     86940
     gggcaggcgg tagggtctgg ctgaaatccg ggcgcttacc tcgctttggg cgagtgggtg     87000
     aaggcggacc ggggccgttt cagtcgccga agggtgtgcg gtggaaagac tctttccacc     87060
     gcacgcggcg agatagcgag tggagttgca gcg                                  87093
//