Dbfetch

ID   AP006619; SV 1; circular; genomic DNA; STD; PRO; 184026 BP.
XX
AC   AP006619;
XX
PR   Project:PRJNA13117;
XX
DT   10-OCT-2004 (Rel. 81, Created)
DT   26-AUG-2017 (Rel. 133, Last updated, Version 9)
XX
DE   Nocardia farcinica IFM 10152 plasmid pNF1 DNA, complete sequence.
XX
KW   .
XX
OS   Nocardia farcinica IFM 10152
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
OG   Plasmid pNF1
XX
RN   [1]
RP   1-184026
RA   Hattori M., Ishikawa J., Yamashita A.;
RT   ;
RL   Submitted (26-SEP-2003) to the INSDC.
RL   Contact:Jun Ishikawa National Institute of Infectious Diseases; Toyama
RL   1-23-1, Shinjuku, Tokyo 162-8640, Japan
XX
RN   [2]
RX   DOI; 10.1073/pnas.0406410101.
RX   PUBMED; 15466710.
RA   Ishikawa J., Yamashita A., Mikami Y., Hoshino Y., Kurita H., Hotta K.,
RA   Shiba T., Hattori M.;
RT   "The complete genomic sequence of Nocardia farcinica IFM 10152";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(41):14925-14930(2004).
XX
DR   MD5; d15e4b3834e166eb04d3d0c6edbe07e0.
DR   BioSample; SAMD00061069.
DR   PubMed; 15466710.
XX
CC   This work was done in collaboration with Jun Ishikawa, Yasutaka
CC   Hoshino, Haruyo Kurita, Kunimoto Hotta (National Institute of
CC   Infectious Diseases) and Yuzuru Mikami (Research Center for
CC   Pathogenic Fungi and Microbial Toxicoses, Chiba University), and
CC   supported by the Research for the Future Program of the Japan
CC   Society for the Promotion of Science.
CC   The genomic sequence assembly and annotation was carried out by
CC   Jun Ishikawa (jun@nih.go.jp). The complete and fully annotated
CC   genomic sequence is also available at http://nocardia.nih.go.jp/.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..184026
FT                   /organism="Nocardia farcinica IFM 10152"
FT                   /plasmid="pNF1"
FT                   /strain="IFM 10152"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:247156"
FT   CDS             1..714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="PNF1_10"
FT                   /old_locus_tag="pnf110"
FT                   /product="putative plasmid partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_10"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60526"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60526.1"
FT                   /translation="MAYVEVVLNQKGGVGKSTVAVNLAATTADALTSSEPGTISPVAAV
FT                   SIDPQGSAVWWADRVEDLPFHIVQAHNDIDGLRALRNSSSIDHFYVDTPGWIGQDEDDQ
FT                   AAADPLGKGPAAEALRAVLESADHVIVPIEPEPLAFDPTARTIEKVIKPRGLDFLVVVN
FT                   NWDPRDGVADLEQTKDYVKANGWPLANTVIRHYKVHARAAAEGIVVTEYPRNRVSMEAR
FT                   ADFSKLALELKAGAR"
FT   CDS             714..1631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="PNF1_20"
FT                   /old_locus_tag="pnf120"
FT                   /product="putative plasmid partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_20"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60527"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60527.1"
FT                   /translation="MAGRGGRANLADLVGSTGKNSTVDGVNARTSSPAKGPTPEVMVNG
FT                   APLEIKLEDLVANPLNPRETMDVDDLASIVEIQLQPALIIGREAYLKLWPELKSELGDA
FT                   KYVVINGCRRLEAARKFGRTTLECVRKDEVADSRASLRAASIRENVERENLDVIEEAKA
FT                   VEALVSDCDGNGARAGQILGKTKMWVSQRRALLKLTPELQAKLRAGELAIREARELGRV
FT                   PAEEQVARWKAQLEKKEREQAGETSGSNSSRRDVDTVKIVKTLKKWDADTAVLASALFV
FT                   HLDRSGVHELIEQLNQMATSNEAE"
FT   CDS             complement(2029..2970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_30"
FT                   /old_locus_tag="pnf130"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_30"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60528"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60528.1"
FT                   /translation="MSAALTARYRYDYARFADWCAVHGYRPIPADPSVIGEYLASAPAA
FT                   PSTQRGRLSAINWAHRNAGFPAPGRSPHVRDLLNPVRASRTERLHELIEAVLPNLPTWG
FT                   WPTGLFGRRDAVILHLARSGLSFPLIAGLDRSEVVIREDRIEIGAGPLLVLRAADDCPS
FT                   CPVAAFRRWSAVLAVVHRPTATYLLEQHLENETLPERTSPRSTGPLLFALDRDGNPALN
FT                   PSPLTPGSIGVITAAHILGRAPTHRPRQRRRGNGVDFVPDLTVGSRCPSLSNDHFDRGL
FT                   AARRRALESMADIDALLDAAEAEVDRVLARWG"
FT   CDS             complement(2967..4259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_40"
FT                   /old_locus_tag="pnf140"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_40"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60529"
FT                   /db_xref="GOA:Q5YMR2"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60529.1"
FT                   /translation="MRVWMSVYTAKLLHMTSKEIEVYRPAAAPALTDAEIDHIREVLKP
FT                   LGMADVDSGAELTVAPLPSLSSEDVRLIGESTATARARNTIRSYATDWRRFERWCAANA
FT                   ARGHQALPAHPLTVALYISEAAALRDSKGRRRYAPPTLTRWVAAIGDHHRAAGYPHPGS
FT                   ARIVAGVLTGIRRACRAKGERRPERAEPVLVDDVRELVTQARRQAESDAQRIAAHRDAA
FT                   LLLMGFTGAFRASEMTERWLEDITPHRLDGLHVRLRISKGSQEEEVVVALPRGSEPATC
FT                   PPCAWRRWLDLVAAHDAGGRVAVQQVLSKTGDGCEQHVCRGRWPELTNPRNPAFRAVDR
FT                   HGNIASTALTAEAVGDMLRRRLMAVGYDKETAASFAGHSLRSGFVTQSYRLGASDYEIQ
FT                   RQTRHKSVAMLRVYAREHAPLVGNAATRLPW"
FT   CDS             4365..4826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_50"
FT                   /old_locus_tag="pnf150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_50"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60530"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60530.1"
FT                   /translation="MELATHTPVPGQLALWEPEVEQPHAQPSQPHRPAGQHTCPNPECG
FT                   YPATGASARGRLREDVKVVWLVPDPDQPDTPAERRYCNRCRPRPPQQIADVECAACDHG
FT                   GPLLVGELAKALRTRGTVPVAVRAWLLDHGWREQEGGELLCPDHPAAVR"
FT   CDS             4982..5818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_60"
FT                   /old_locus_tag="pnf160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_60"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60531"
FT                   /db_xref="GOA:Q5YMR0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60531.1"
FT                   /translation="MMAADSPALSSVGESVNGSATTDHPIAGSRPPWSRVFFRGLAAVT
FT                   LVYPLVYCSSYAVVVGDTPLAVAVAFCFGVLASGVIGIGAFMVRPRSSMVTETRVVCGL
FT                   LGFRRPEPARWRRRPLLVWCVVVPVLLAAVHFGLDTVIGAVWHPVSDAEQLRANAERAE
FT                   ILTRNGALSAAVLYPFLVAAVPEEIRYRALVLLTQRAVGACTIPRWVGFLVVAAVAGLS
FT                   IALFAAAQAEYGPMNLVTSAIGGVIYTGLVLYTRSLWPAISCHGFYDLMAISLTIL"
FT   CDS             complement(5995..6498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_70"
FT                   /old_locus_tag="pnf170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_70"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60532.1"
FT                   /translation="MIPTVPTADHHAGPAANHNEGVGTLITLKEWAEQRGRSYGSIRNN
FT                   WTGRDDFPAPKQPRPRTGKGTPAPEYDSDELDAFAERWEAANRPAPFPMPDEPDEFRTL
FT                   GAIARLLGVDGKTVTQYRETFDEKVEHENRGARTVYRTRGVVEVLNERRGKGLTRPHLR
FT                   QSSE"
FT   CDS             complement(6670..7377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_80"
FT                   /old_locus_tag="pnf180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_80"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60533"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60533.1"
FT                   /translation="MTFTMFDRSRWTPADEDRARRGVAARAAGPTGPWTGDILVHPGGY
FT                   RSRLWVTAYSGELFACGDDPDYGFILDPDGSIDYTGTSGMYGNKRIDRESLTGVSGAEV
FT                   APFWLDRRDEEMPDDVLTFTTEVRVWQTTETVPSVYEAVAQRIYNHDSFDTVITEYEAR
FT                   IIAEGWAGEHYCPNLAEWVNGRRTGIDRAVLIAEARKLWDDLSLHVEDWPHAGEPEPSV
FT                   AAAAALTAFLEGY"
FT   CDS             complement(7419..8489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_90"
FT                   /old_locus_tag="pnf190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_90"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60534"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60534.1"
FT                   /translation="MKAREGARAQGPLPGLPLSSTPATTSGKDSSVDDLTTNHTEWGTP
FT                   APLAPPAPTTRVAVRAVTSGIVGVACEHTEAWRFVTIPTDALGCYDAEADAITTALDGR
FT                   SWVGDVIALDTVTGCDGQQFTAGCSTWTVFSDEVSDDPDHALPERLRAEIGHWNCEHAL
FT                   FGGRPAEGWTTESDPDELLALAVLERWTFETAGFRAFAERPEESPNLVRLTVFRDGAEP
FT                   LCEYIAFSTAEAAKEAAVALIVGAITADQATRLPTYAQRVAALPHPLPSSGVVFTARIV
FT                   TDDSVEPEHGPAQRADIVITADGDTDPVATYSLTSNPLDPIPDEPTDVLARHGWRMAGP
FT                   GHLDTDRYLIVRVERA"
FT   CDS             complement(8486..10171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_100"
FT                   /old_locus_tag="pnf1100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_100"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60535"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60535.1"
FT                   /translation="MLELMDWFCGAGGSTQGASKVPGVCVTRAANHWDKAIETHATNYP
FT                   EADHFLGDLSTEEAKAQIVKWPVADIFWASPECPQWSSARGKKRDFHNTLQGDLLDLQR
FT                   DEEADRSRALMEEVPMYLRGVIERGGRVRAGVVENVVEVRQWDQWHRWIGEIRALGYGV
FT                   RVIALNSAHAQPVRTPAAPQSRDRLYVAYWDLKLGRTPDWNKWLRPMAYCAECGWVQAL
FT                   QAFKRPGADMGRYRTQYFYRCPRYTCRNAVIEPPVLPAAAAIDWTLPGTRIGDRDKPLA
FT                   PKTMERIRVGMRRYASMVPMMVPAGGTWRDDATQVTGPMAARTTRENDGLAIPQPFLAL
FT                   LRSDRPRTIGLHEPLATVVADGSNHGLVVPPPLMIPMEGRDGKEAQLASMPLRTQTTRN
FT                   ETAVAFLPFVAELRGGSSDARPVTEALATVTASGNHHGLVTPPTPPTGMSPELWNSLLL
FT                   PYYGNSTARPVSDPMGTLSTRDRFALVDMITERDIENTRFRMLEPHEIQDAMAFRKDYI
FT                   VLGNKRQQVRQLGNAVTPPAAEILISALVEAITGEELDRYAPTA"
FT   CDS             10400..11080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_110"
FT                   /old_locus_tag="pnf1110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_110"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60536"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60536.1"
FT                   /translation="MCGRVSPRVRPPVNEAGRAANDVGPAASSGPRPLTAGRPAPVIRL
FT                   HPSVPGGRLVGTAWTNRAAAQLHRNGSTPPMTEVDRVQVVQEMWPTIGPHDADSLAAAA
FT                   VASREIFRMLAHATITRTDALKALPYMVDGYTVLGGLAEAASSERQGLEQLAVWAEHFA
FT                   NDPTLRHAEHRDQQGGGIAQAQQAALETAEDLREAAGHAEALMRALQRAQAHTSPLYHD
FT                   DEES"
FT   CDS             11077..11349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_120"
FT                   /old_locus_tag="pnf1120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_120"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60537"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60537.1"
FT                   /translation="MTSAHAAGEPTDYFAPVYAILDRWAADGAAAPDPVPVILGDGSHA
FT                   TMTRDWLTFPRTEGTISGKSMSLRLLEKARGTLTPSNRPTDEKDR"
FT   CDS             11346..11873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_130"
FT                   /old_locus_tag="pnf1130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_130"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60538"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60538.1"
FT                   /translation="MTASYTADELRTLLETGAAAADSRYQRAAIHLLNFTELPGRTALN
FT                   AYIETDTVTIDGRDVRAAWIRDWDGMGRLENLGYLSGGEERLVRRAASMAHGSPVDLCA
FT                   TLSSLGHAHARRVLEAVAICLGADEYYDITPTPALLENQRFEEQLLAGELSRRGLGPDG
FT                   QPVPNPQSGETE"
FT   CDS             11870..12118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_140"
FT                   /old_locus_tag="pnf1140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_140"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60539"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60539.1"
FT                   /translation="MTSLPTQEQIWTNAADAADRAALALSDVRDWLRSDWSDTKPLTDE
FT                   AVQARSAAYARLETLKDEIRDLEHQLRGGARSLRDRR"
FT   CDS             12149..12493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_150"
FT                   /old_locus_tag="pnf1150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_150"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60540"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60540.1"
FT                   /translation="MFDETPISWEDFKARRPSDAENAARLADLVRRARTVRAHGWDDYR
FT                   YVWSSGEVAGVAYLLDDEDVLRDADETADSVLSRYACDLFGVTGGHDDIAAGHPGTRAW
FT                   FDHARQEAER"
FT   CDS             12490..13218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_160"
FT                   /old_locus_tag="pnf1160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_160"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60541"
FT                   /db_xref="GOA:Q5YMQ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60541.1"
FT                   /translation="MSTLLADAEARVATLAQAHPEMYPQPVELRRRAHPRDPATETAIA
FT                   LYQWRTPVFKARRERRVVEHIVVDPDVYARLDGRGRDALLAVELTRADHVRRTLSAAPL
FT                   GLAATWQLDRLLRRSGTGRADTAVITGVLAAAAGAFLPLPVAPPVRLVLLAVVIATVVW
FT                   AFDAAITRGLHLHADRVAARWIGADAVRYMLMTLSADEHHPEGAAAWRVRWLGYQPTLR
FT                   HRLKSLNRVHAVTENLRPVE"
FT   CDS             13605..15275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_170"
FT                   /old_locus_tag="pnf1170"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_170"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60542"
FT                   /db_xref="GOA:Q5YMP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60542.1"
FT                   /translation="MAGDSSVADRGVLTAEEARWQVAVQRAEVIGRLAQGDRVSVAAAD
FT                   EAAAELGVTQRQVYALVKRWRAGEGVASDLLPRRSSGGRGGERLSDEVEEIVRAVLRAR
FT                   YLTRQRRSVAVICREIDRECKVRGLRPPSRSAVQRRISRLDPVKTVTAREGQGVARSRR
FT                   PAGGVAPAVTGVLERVQIDHTPADVIVVDEHHRLPIGRPYVTAAIDEATKCVPGLVLTL
FT                   EAPSATSVGLCLAHMAIDKRAWLERIGVQAVWPMSGKPVQLYTDNATEFKSEALRRGCG
FT                   QHGIAIDYRPPGAPHYGGIVERLVGTMMRMVHELPGTTFSDTRERGDYDSDAKAVLTLA
FT                   ELQRWMALAVACYHGEPHDGLGGRTPGGVWAEKVAAHGAPPTVTNETAFLVDFLPVERR
FT                   SLRRTGFVLDHVQYYSDALKPLIARREQLEKVVLRRDPRDISRIWALHPETGEYLEVPY
FT                   RMWSRPAISLWEQRAAVARLREQGRAEIDENALFAMVEQMRHITADATATSRRARRNTE
FT                   RRKATPARSRAQAIPPAPPVPTPGAAPVAVAPFEVIEQW"
FT   CDS             15272..16183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_180"
FT                   /old_locus_tag="pnf1180"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_180"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60543"
FT                   /db_xref="GOA:Q5YMP8"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60543.1"
FT                   /translation="MSIGEPVDLSHLHPSAQRPAMLPDAERIQYVRADRWIGYTRAREA
FT                   LARLEGLLSMPGKQRMPNLLLIGATNNGKSMIIEKFRRDHPPVSHEDREEIPVLTMQMP
FT                   SEPSVSRFYVAVLAALGAPIRPRAPRLAELEQLVLRLLRACGVRVLVIDELHNVLAGRG
FT                   DTRREFLNVLRFLGNELRIPLVGVGTRDAYLAVRSDPQLENRFAPFTLPLWEPGDQACA
FT                   LLASFAASFPLRRSSSIATEEMASYLFTRCEGTIGELTALLSDAAIAAIESGEEAINQR
FT                   TLLLASYAGPTERRRMFERELA"
FT   CDS             16180..17565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_190"
FT                   /old_locus_tag="pnf1190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_190"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60544"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60544.1"
FT                   /translation="MSPSPPRRWPLHPPPGALESLSSWLDRLARIYEVPVRELLGPNLG
FT                   VLVGIRDVLDEDPPPAVFTALAERTGVPAGQVRAMTLPGWVPWLFDAYPLPERDATDGF
FT                   YTYVRQYSVLLAPREAPRFEVTHRRRWRGPWIPERPVRRSCPQCAAGPDPARALIWQLP
FT                   LTVSCLEHRCRLALDTDTLAAEIAGQPYQPVPVGEPVAALDGYTRQALINAAVRLPGRT
FT                   VHAGVWFRLLRCLLDELSLAGSTGTRSSERLLEQIWDATGEPIRAGLAVWQPYENLEWT
FT                   TQEKLLTAAATALVLATDRRIQPRGTLAWLLTEPQPLPVYDGDPPRPPTPDPPAQTRRD
FT                   LMQTMNAWYARARIDADAARAMLRLLTALDTTPAHATRHRDVLISEGIPARFLRDDLLR
FT                   CPGRRTRDETETLLVAEGFDPGEVAYELDCCVAETIALWEVPDEGVLIGEDELGQIRAR
FT                   LEL"
FT   CDS             17569..18708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_200"
FT                   /old_locus_tag="pnf1200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_200"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60545"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60545.1"
FT                   /translation="MPRWPLHPQPGPIESLSSWVQRLATVYQLPVKVLVADLCADFSPN
FT                   MRAFANRLHHPPPALLDALAVRTGVPVPRLATMTLSGWVPWLFEKLWPREFEQQQLFDN
FT                   YVGRQSVLLLPGTIERDIVRRIKSRWDAPWLPYPRRPRACPVCATDPDSGRALVWDLPL
FT                   MLSCVEHRCRLERAGAVAGGDAPVVAVDETVTTMDGYTYQALTTGLVRLPGRTVHAGVW
FT                   FRLLRCLLEELCVSRLACSARTDAVLETIWDTIELPMRGRIAMLEPYECLDYDVAETLM
FT                   RAAALALALAAERSIPAVGELGSALAPVPYRPVPPGDPPVRRCAPSRLDLLNPPRWWPA
FT                   APVQAGTARDWSQVARRYALKRGFPAWVFGGLTDEPGLD"
FT   CDS             complement(18705..20003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_210"
FT                   /old_locus_tag="pnf1210"
FT                   /product="putative resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60546"
FT                   /db_xref="GOA:Q5YMP5"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60546.1"
FT                   /translation="MLIGYGRVSTADQNPAHQIDALRRAGVEPGDIHIDTASGAKASRP
FT                   KLDLVLTLARRGDTIVITRLDRLGRSMLHLVNLGADLRARGIGLKVLEQGIDTDTAEGR
FT                   AMFGMLSVLAEFQRELIVANTRDGLEAARARGRTGGRRPKLTVHQIEQAQRLYDEGRHT
FT                   VQQIADILGVKRGTLYGHLDKNSIGTRPHSGPATPLPTTSAPAAVVVDQADPAPGIAPA
FT                   ITETATATPQTLGVPAGDPTDGRPGSPGGSSAVVTEAAPTGLVDLGGLVPEPDPIRPLP
FT                   AADADEHAETNSSTREFARERPNLAWRLKQTARMNLPEPPAVCPNDACGYTAHETSERG
FT                   RLLEDIKVVWLEPADDGGLIEARHCHRCRPREVPIADIECAACDCGGPLLTGVYATELR
FT                   DTGEIPALVRRWLSVRRWRVTDAGPVCPDHPDS"
FT   CDS             20286..20993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_220"
FT                   /old_locus_tag="pnf1220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60547"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60547.1"
FT                   /translation="MAVRFKLGYYSPLTDDPLNRDYVGYFPRMTEEEAWTAGRGVWKAN
FT                   KERLSREKFALIIGDSRVCAVAEIRGVSVYEDRVAVDGEALGEGHPVRDAWIGKPDPVV
FT                   NASQNPVGYCDLPEEAEFRERPCGCGCGEISTRDFLPGHDVRAFQDRVRRMFAGSALEF
FT                   FRWVDRIGAEHGLPLLANPTGGTALPDEHREPPNPDPGEQSPHDPGISYAALSDSGDLL
FT                   SGNESRAESGEPV"
FT   CDS             complement(21272..22828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_230"
FT                   /old_locus_tag="pnf1230"
FT                   /product="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_230"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60548"
FT                   /db_xref="GOA:Q5YMP3"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60548.1"
FT                   /translation="MSSSQFPHSTPMTRRGFLALGAGVTAAAALTACSKNSTASRTLVE
FT                   PDSEAVRAAENRRRAAGAAVRQVRLRAEPATVDLGGVRVQTWAYGGTLPGQEIRITKGN
FT                   VLRAEFTNALSAPSTVHWHGIALRNDMDGAPEVTQPPIAPGGTFGYEFTAPDPGTYFFH
FT                   PHVGVQLDRGLYAPLIIEDPADGKDYDLEAVVVLDDWLDGVNGRDPDKELDQLRAKGMS
FT                   GMDMGGMDHGGMTMGGSSTMAMPTDPSAPLGSDTGDVRDYPYYLINGRIGADPVTITAR
FT                   PGQRIRLRIINAASDTAFRVAVGGHQLRVTHSDAFPVQPVTTSSLLISMGERYDAVVEL
FT                   ADGVFPLVASAEGKAGQGFALIRTGGGTPPPADVRPAELSAPPLTADRLVGAESVRLPN
FT                   RTPDNTLDLTLENDTAKYLWMINGKAFPDHSMLDVTEGQRVRLRLVNKTMMFHPMHLHG
FT                   HTFQVVSAAGTGPRKDTSIVLPMQTVEVDFDADNPGQWMVHCHNAYHGEAGMMSVVSYV
FT                   R"
FT   CDS             24477..25604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_240"
FT                   /old_locus_tag="pnf1240"
FT                   /product="putative pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_240"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60549"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60549.1"
FT                   /translation="MDKVVLDALADRSAALVGAPVAARYPHSLIGNTPVLWVGAPLAPQ
FT                   GRGFWAKLEGFNPGGMKDRPALHMVRKAEQRGDLAPGARIIESTSGTLGLGLALAGIAT
FT                   HHPVTVVTDPGLEPIVARMLTAYGTQVDVVTEAHPTGGWQQARRDRVAELLAGEPDAWC
FT                   PDQYSNPDNVDSYESLALELVEQLGEVDVLVCAVGTGGHSAGVARVLRRFNPGMKLIGV
FT                   DTVASTIFGQPAGLRLMRGLGSSIYPINVDYDAFDEVHWVAPSEAVWACRTLAATHHAT
FT                   GGWSVGAVGLVAGWAARTHDADTRIAAVFPDGPHRYFDTVYNDTYCEEHGLLDADPPVE
FT                   PDTIAHPAERVVRSWTRCTTVVDPRQFIHDREPAS"
FT   CDS             25601..26965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_250"
FT                   /old_locus_tag="pnf1250"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_250"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60550"
FT                   /db_xref="GOA:Q5YMP1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60550.1"
FT                   /translation="MTVVAKFRSFDMAARLLMINQFGINLGFYMLMPYLAGYLAGPLGL
FT                   AAWAVGLVLGVRNFSQQGMFLIGGTLADRLGYKPLIVAGCLLRTGGFALLVFATSLPGL
FT                   LIASAATGFAGALFNPAVRAYLAADTGDRRVEAFAVFNIFYQAGILAGPLVGLALMALD
FT                   FRVTAAAAAVVFAILTAAQLFALPTRRAETPAEHTSVLDDWRTVVANRRFVGFAVAMTG
FT                   SYVLSFQVYLALPLQAEFVAGAQAQALVSALFVISGVVAVAGQLRITAWFRNRWGTGRS
FT                   LVVGLGILAASFVPLVVVPDPDRFGVPPAAAALLVSAVLLAVGTAAVFPFEMDTVVSLS
FT                   GGKLVATHYGFYNTVVGVGILTGNLATGAVVGAARAAGMDWAVWAGLSMIGVLAAFALH
FT                   RLDRPQPVAEKGRSTRTRGRHRIPDQHTVGTAPAEQQFEYTGRGHWPTKIPAARR"
FT   CDS             complement(27064..27708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_260"
FT                   /old_locus_tag="pnf1260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_260"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60551"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60551.1"
FT                   /translation="MPLRSTALRRYLPGVAVLLFVLAGCGDSDEADKPTTTAGPSAPAI
FT                   STTVGAATSAPAGTYNDADVTFLQSMYPHHAQAIQMADLVPSHSQNQQLLDLASAIKTA
FT                   QEPEMAQIRSLLEEFGKPVPSPATGPMGPMGHDMPGMMSPQQMSSLQSMSGAEFDRMWL
FT                   EMMINHHTGAVQMAQTELDTGANDRAKQLAAAIVPAQQREIDQMKAMLEQR"
FT   CDS             complement(27961..28347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_270"
FT                   /old_locus_tag="pnf1270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_270"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60552"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60552.1"
FT                   /translation="MPPTPADLGDVDRDKLTKCIEECIACAQACTACADACLSEGMVGE
FT                   LTKCIRTDMDCADICNATASVLSRHTGYDANITRAILEACATACKACGDECSAHADTHE
FT                   HCRVCAEACRRCEQACTDLIQALG"
FT   CDS             complement(28776..31268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_280"
FT                   /old_locus_tag="pnf1280"
FT                   /product="putative cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_280"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60553"
FT                   /db_xref="GOA:Q5YMN8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60553.1"
FT                   /translation="MTTHSDTHLPPPKERATAVLDVRGLLFASQQNVVVARLARRPGVH
FT                   RVEVNPVAQTATVVYDQTQTTIAALRDWVVECGYHCAGRSVPAHLCDPLTEPDPPSGDG
FT                   YHEHTGHAGQLAPAEPIDDAGHAVAAPAHEGHPGGTGDLRSPHEAMGHGGHAGMSMAAM
FT                   VADMRNRFLVALLFSIPIVIWSPIGREVLGLDVPVPFGLREDIWALLLSLPVIFYSSWI
FT                   FFDGAGRALRARTLDMMVLVAVAIGSGWLYSLVITLTGGGEVFYEAATVLAAFVLLGHW
FT                   FEMRARGGANDAIRTLLDLAPPKALVLRDGEPVEIPTAEVAVGDLLLVRPGAKIAVDGV
FT                   VEDGDSEVDESMVTGESLPVHKAPGAAVVGATINSNGTLRVRATKVGADTALAQIVQLV
FT                   QEAQNSKAPGQRLADKAAFWLVFVALIGGGVTLAAWLLLSDRPFSAAILFAITVVVITC
FT                   PDALGLATPTAIMVGTGLGAKRGVLFKNAMALETSARIQVVVMDKTGTLTKGEPEVTDV
FT                   ITDGIGETEVLRLIAAVERESEHPLAQAVVRYAENAGVGQVRAEKFENVPGHGAIAEVE
FT                   GRRVVVGNRRLAEREGIDLGALAARRDELAATGRTAVIAAVDGKAAAVIGIADAPRETS
FT                   PAAVAALHDLGVEVVMLTGDNEATAKRIAERLGIDTVIAEVLPGDKATKIAELQRSGRQ
FT                   VAMVGDGVNDAPALAQADLGIAIGAGTDVAIETADVVLMRSDPLDVPTALRIGRGTLGK
FT                   MRQNLAWAIGYNTIALPIAAGVFEPAFGLMLRPEIAALSMSGSSLIVAVNALALKRLRL
FT                   PIPKPAHTGTSEATRVIA"
FT   CDS             complement(31273..32025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_290"
FT                   /old_locus_tag="pnf1290"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_290"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60554"
FT                   /db_xref="GOA:Q5YMN7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60554.1"
FT                   /translation="MALLVSRGAAVWSLIGVLALLNVTVAFGAMFASITGVTTGVASVL
FT                   SNSASLLVVLPAWWLFGERPRLLGITGVAVGFGGLVIIAAPSGGGRGAGLALLAAFGIA
FT                   VGALLARRLSSIDLLVLGAWQFLLGGTVLAGIACVVEGPPTTIAWSSRFTLTLAVLALV
FT                   ATALPYLLWFGELRRASLTAVTTWTLLVPVVGVILGVVVLDEPITLAGVIGDVIVVAGL
FT                   AVVARAARPSRAETLSATDTVDYRPLEE"
FT   CDS             complement(32554..32847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_300"
FT                   /old_locus_tag="pnf1300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_300"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60555"
FT                   /db_xref="GOA:Q5YMN6"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60555.1"
FT                   /translation="MMFWYGDGMSGWGYGLMTVGMVLFWALVIVGVILTVRYLAQPSAP
FT                   VGGAPIVRPSAEQVLAERFARGEIDADEYHQRLATLRGDIGSGRGTKSGGAG"
FT   CDS             complement(37033..39279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_310"
FT                   /old_locus_tag="pnf1310"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_310"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60556"
FT                   /db_xref="GOA:Q5YMN5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60556.1"
FT                   /translation="MNQQQQSAVTERSPQQPLPPDSPGLLYRWGVLMARRRRTALAIWG
FT                   VLLAVCAVAYPLLENRLGAMDFGVEGSESTEVDRLVAQHFPQFGAEQAVIVLQSGALTA
FT                   TDSDFRAVVARTVTAAEEVQGVVDVVGPYDGLPGSQISADGHVAIALAGMDGDMAERAR
FT                   VARDLQDAIASTGDDSIDVGLTGYSAVQNAATELQNADLARAEAIGIPVALILLVLALG
FT                   ALAAAAVPIGVAIAGLLTAVGVLFTLTTVTAFDSLTVAMATMVGLGVGIDYAMFIVSRF
FT                   REELAHHTVADHAAIAAAVGRSLATAGKTILVSGLVVMISLCALIIIQAPIFRGIAIGV
FT                   ATAVTSMLIVAVTLLPALLAALGPAINRGALPARWRPADSTANAPGALSGRWARWAYLV
FT                   MRRPVLFGTAAVAVLVIAALPVFGIRYGLDMGTTALDDTPTGRATTALTTNFPAGALSP
FT                   VEIIATGPGDTPLTGDPAAQVNRFLAEIADDDRIDTVLPAQLNDGRVLALALPSVAFDS
FT                   MEATDLIRDLRNTATDAAGAEIRIGGSTAEFVDLSDEMTSKLPLVVALVLTASLIFLIA
FT                   AFRSIALPIKAIAMNLLATGAALGITVAVFQWGLGENILDFTSPGFVQVYLPTVVFALL
FT                   FGLSMDYEVFLIRRIREYWDTTGDNEHAVAAGLTHTARPITAAAAIMIAIFASFLTADI
FT                   LELKQLGLALAVAVFLDAVLIRLVLVPALMRLLGDWNWWLPTRPSIRPDTNTGI"
FT   CDS             39395..39784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_320"
FT                   /old_locus_tag="pnf1320"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_320"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60557"
FT                   /db_xref="GOA:Q5YMN4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60557.1"
FT                   /translation="MTINADGGCLVETQGLDPAVALFHSLSDATRLAIVRRLACGEARV
FT                   ADLMAGLELAQSTVSAHVACLRDCGLVVGRPQGRQVFYSLARPELMDLLASAETLLAAT
FT                   GNAVALCPNYGTDATTTETTAEVRA"
FT   CDS             39898..41745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_330"
FT                   /old_locus_tag="pnf1330"
FT                   /product="putative cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_330"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60558"
FT                   /db_xref="GOA:Q5YMN3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60558.1"
FT                   /translation="MLLVAALIVGWTGGPSAVELGLEIAALLVGAYTFVPSTFKRLAKG
FT                   KIGVGTLMTIAAIGAVILGEVGEAAMLAFLFSISEGLEEYAVARTRRGLRALLNLVPDR
FT                   ATVLRDGTETIVSPAELRVGDRMLVRPGERVATDGVIAEGRSSLDVSAITGESVPVEAG
FT                   PGAEVFAGSINGNGVLTVEVTTTAEDNSLARIVRIVEAEQARKGDAQRLADKIAKPLVP
FT                   GIMIAAAAIAVIGAILGDPVTWIERALVVLVAASPCALAISVPVTVVAAIGAASKLGVL
FT                   VKGGAALEAMGRVREVALDKTGTLTANKPAVVEISAVAGTEQATVLAVAAALESRSEHP
FT                   LARAILAAVDTFTPATDVEAVTGAGLTGLVDGRPARLGRPGWIEPGDLAADVERMQHAG
FT                   ATAVLIELDGQVIGAIAVRDELRPEAHEVIDRLHALGIRVSMLTGDNTRTAAALATEAG
FT                   IEDVHADLRPEDKARIVGELRADRFTAMVGDGVNDAPALATADLGVAMGAMGTDVAIET
FT                   ADVALMGEDLRHLPRALEHARRARRIMLQNVGLSLGLITVLIPLALFGVLGLAAVVLVH
FT                   ELAEIVVIANGVRAGRTKPLASLPESTAKPAPVLAGASA"
FT   CDS             41742..42272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_340"
FT                   /old_locus_tag="pnf1340"
FT                   /product="putative signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_340"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60559"
FT                   /db_xref="GOA:Q5YMN2"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60559.1"
FT                   /translation="MTATASSAPTVSRWGRRLRWAITAAVLAGLDLALKAWAQTALDGA
FT                   PVEAGPVDLRLAFNPGAAFSIAADAPSWVMLSITTVITTGVAVGGWVLAPRASLLTRVA
FT                   LAAILGGAAANVIDRAPDGLVTDYLHTGWWPTFNLADSFIVLGAIALIITTLIGNSDER
FT                   EQLSPDHHTDKRD"
FT   CDS             42301..43800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_350"
FT                   /old_locus_tag="pnf1350"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_350"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60560"
FT                   /db_xref="GOA:Q5YMN1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60560.1"
FT                   /translation="MAALVVALLTVGLDLMVLNVALPTLAQDLGASTTQLQWIVNAYTL
FT                   VFAALMLPAGGFGDRYGRKRLLLVGLVAFVAASAWAAYSGSTGSLIAARAVMGIGAAII
FT                   VPLSLGILPTLFGPDQRRRAIAVWVGALGVGLPLGPIVGGWLLQHFWWGSVFLINVPVG
FT                   VAALVACVVLLPESADPHAPPLDWLGIITAVPGTAAVVFAVIQAPEYGWTDPIVLTTLA
FT                   AGVVLIVGFLVWERHTRYPLVDLGLFANPAFTWPTLAATAGTFTLVGVLFVLPQYLQIL
FT                   RHYDAFGTGLRLVPLVLAIIIAAAAVDKIVTRVGAKIPIVTGMLIAAAGFVLASRITAD
FT                   SGYGFVAVCLGVVGLGAGLALAPAVDAVMASLPEHRSAAGAGLLMAIRQVGAAFSVAVL
FT                   GTLLTLVYTRDLDPHLSALPEAVVGAARDNVAGAQLAATGVPGPAGADLAATSAHAYTE
FT                   AMSAVFLASAAVSAVLAAAIAAKLPKQTPPPIGTSPAPGPR"
FT   CDS             43864..44484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_360"
FT                   /old_locus_tag="pnf1360"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_360"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60561"
FT                   /db_xref="GOA:Q5YMN0"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60561.1"
FT                   /translation="MHSPRKASASMVTSILQAIGLFLVTNIDDIIVLSLFFARGAGTRG
FT                   TTVAIATGQYLGFGAILAASVLVSLGVTALLPEEAIAYFGLIPLLLGLLAAWRAWRNSG
FT                   DDDERFEGKKVAVWTVAAVTFANGGDNIGVYVPVFATVGTAAIVAYSVVFLLLVGVLVI
FT                   TAKFLTTRKAIAEILERWEHILFPLVLVVLGIVILVSGGAFGL"
FT   CDS             44525..45364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_370"
FT                   /old_locus_tag="pnf1370"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_370"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60562"
FT                   /db_xref="GOA:Q5YMM9"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60562.1"
FT                   /translation="MGAQQGDLPLPALELPTAVRPRPQTGRAEVSAPEHRWSGGVSLTP
FT                   GLMTFTGEIGDAPAHAHAAVQVLFVARGRLTLTDATGYTTPALAAIIPPGVVHQVHTEP
FT                   GTSGFLAFLDPDSATAHAALAQLDGQPRQAATTWVSAATPAPSLSVGDPVTRPVRRSSH
FT                   PVVAQALRRATDWVGGPPSLGELAADIGISVSRLSHIFTAQVGLPYVAWRRWVRLQLGF
FT                   AVVRGGGSLTAAAHAAGFADSAHLTRTCRDLIGISPTEALIATGWRPPPARDRAVTE"
FT   CDS             complement(45390..46679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_380"
FT                   /old_locus_tag="pnf1380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_380"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60563"
FT                   /db_xref="GOA:Q5YMM8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60563.1"
FT                   /translation="MSAVLLDPGRGEENLSAIAAPLTGGGPRVISRAQWGADESIRCED
FT                   PTYDDGLGGIVVHHTAGRNDYSKAESAAIVRGIYAYHAETLGWCDIGYHALVDKYGQIF
FT                   EGHFGGLDRPVQGAHTGGFNENTAGVAFMGDHESEEPTQAAITAMGQFIGWRARVAGLD
FT                   PRGTTTMISEGTEFTPYGEGEQVQLPVVFSHRDVGNTTCAGDAAYALMDRIRAIAAGVS
FT                   SGAGPRQAPGGQDSAPAPAQPDADADADVSALAVLTGKLLDLVDRNVLARRWVDAGGPQ
FT                   GRLGLAASEPVPTAEGGQYARFVNGYLFQAPDGQVYEVAGRIGQRFAQLGGDNGVLGAP
FT                   RSNEYPVPGGVRVDFGRGSLVFNEATGVVTTLGLPQPASDHPTQSAASPTPTRAEAPPA
FT                   PAPADAAPAPSPVPPGSVETVPGEVPVAGQ"
FT   CDS             complement(46772..47479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_390"
FT                   /old_locus_tag="pnf1390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_390"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60564"
FT                   /db_xref="GOA:Q5YMM7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60564.1"
FT                   /translation="MVGVIGGAGSVGWFGPAIAVSTEVGVLVPNYARKRTYVLPLVAVA
FT                   VVTAPVTAGFLGGGGQFRFSNDSEADGVSPTATTQVGLSGAPRVVLPLRELAGMQLPDL
FT                   RVADLRLVPGAPPLPEGSRVGPIGFVAAAGAAPISARTPALDPGVVPEQLVDRVGAQVT
FT                   ELTRESRFSMIGLTAPNLEGVTTMVRARQLDGSWGPWFEAGTDDSISARRPARGACRVV
FT                   NRCMWVTPTRCKS"
FT   CDS             47643..48563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_400"
FT                   /old_locus_tag="pnf1400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_400"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60565"
FT                   /db_xref="GOA:Q5YMM6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60565.1"
FT                   /translation="MTTLISPLIRYGYAPVMLLGINGTGIALAATGASKLWLIALLGLA
FT                   VAVSFTAERLLPYQAAWNNSHGDTGRDTAHTLVNETLILGSVAAIPVLAAVVPGDGIWP
FT                   GSWPFVVQVLVAILVADLGITLAHYASHKIGVLWRFHAVHHSVQRFYGLNGLMKHPLHQ
FT                   TIEMTAGVTPLLLAGISVPVAAVLSLAVAVQLLLQHSNADYRVGPFKYVLALNEGHRFH
FT                   HLKWAGIGDVNFGLFTLIWDHLLGTYSYDPHRRFSSADLGMAAKPDYPVGYLAQLAEPF
FT                   TRHGACEPTPEASVVLRATEQAKNA"
FT   CDS             48596..48955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_410"
FT                   /old_locus_tag="pnf1410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_410"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60566"
FT                   /db_xref="InterPro:IPR022172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60566.1"
FT                   /translation="MTMAKIRAAARARYHEEMQAANTTTDPARRWNHLERAHILSQPDP
FT                   WLHTANHIAMFALAVRQRDRREALGQIIRIIVAAPGSLAGLAPEGNTGRANVGLRQTMT
FT                   TPPDLAALLDPSPTR"
FT   CDS             49051..49728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_420"
FT                   /old_locus_tag="pnf1420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_420"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60567"
FT                   /db_xref="GOA:Q5YMM4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60567.1"
FT                   /translation="MTARSVSRRTRLLTTVIAVLVIVVGAVVLAAARTDDNRPGNSVES
FT                   TTGEPALAVRPDSHRLSGPTDARVTLVEFLDFECEACRAMFPIMEQLRADYSDRVAFVV
FT                   RYFPIPSHFNSGRAARAAQAAADQGRFEQMYQRLFETQADWGEQRAPADEVFRGLAAEL
FT                   GLDLGAYDLAYNDPATAARVRADFDEGLALGVVGTPSFFLNGEKISGGSYRDMAAALDA
FT                   ALD"
FT   CDS             complement(49747..50358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_430"
FT                   /old_locus_tag="pnf1430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_430"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60568"
FT                   /db_xref="GOA:Q5YMM3"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60568.1"
FT                   /translation="MTAWWALALYLLFAALGFGWRSWRQHRATGSTGFRGISGRPGSLE
FT                   WIAGVGFLLAIGVGVAAPLLQLADLVAPVAILTAAPIQGIGLVAALAGIAATVYAQNQM
FT                   GDSWRIGVDDTETTTLVRTGVFRLVRNPIFTAMLLFAAGITLLIPNPVAVAGFALLLTT
FT                   IELQVRIVEEPYLTRVHGPDYQAYLASTGRFAPGIGRARA"
FT   CDS             complement(50419..51342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_440"
FT                   /old_locus_tag="pnf1440"
FT                   /product="putative cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60569"
FT                   /db_xref="GOA:Q5YMM2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60569.1"
FT                   /translation="MGAGHSHGTSNPNQGSASARYTTRLAVAIGLGLVTFITQVVVGLS
FT                   TSSLALLSDSAHVFTDVFGVSMALVAIMIARHATRGGARSFGMYRGEVFAALFNAVLLF
FT                   AVAGWVLYEAIGRLSDPPEVPGLPVAIVAVVGLAMNVISMLILRQGAKDSLNVRGAYLE
FT                   VMADMLGSLGVLASGLITLFFGWRYADPAIGVAIGLFVLPRAFSLGRQALRILFQHAPA
FT                   ELDLTEIEQSLRGLDGVREVHDLHVWTLTPGMEVASAHVVIDRDADLDTVLGSAQQLLA
FT                   EEYHLGHATVQIETDGSTERCRNTTW"
FT   CDS             51565..52203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_445"
FT                   /old_locus_tag="pnf1445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_445"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60570"
FT                   /db_xref="GOA:Q5YMM1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60570.1"
FT                   /translation="MRPHIRWLVVFVIVFAALAAALWPRSDSTTALPERVFGQPDAATG
FT                   RIEDGPPQDQRVGAPALPPCPIPGGVSAGGGPLRGVLARCLGSAEQVDLGVALTGEPTL
FT                   INLWASWCAPCRSEIPVLNAYASDPDSIRVVGINVQDDPTTAAELLAELQAGYPSFVDG
FT                   GAVQKALPAPPVLPLSFLVQRDGTVRRITTPAVFDNPAQIDATIREMTR"
FT   CDS             52200..52862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_450"
FT                   /old_locus_tag="pnf1450"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_450"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60571"
FT                   /db_xref="GOA:Q5YMM0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60571.1"
FT                   /translation="MTHLRTTKAARHGHRYGRARHRQLRLLAAMALVIAAVTAVISCAS
FT                   GSDSVATGGGTFDFVSPGGQTDIFYDPPESRGKIGVLAGPDLMAEDKTVSVSDYTGQVV
FT                   VINLWGQWCGPCRAEADDLERAYAATKASGVQFVGINVRDQQRDKAQDFVIDNKVSYPS
FT                   IYDPPMRTLVALGGSYPTSVIPSTLILDRKQRVAAVFLRALLTSDLQPVIERLAAEQ"
FT   CDS             52859..53668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_460"
FT                   /old_locus_tag="pnf1460"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_460"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60572"
FT                   /db_xref="GOA:Q5YML9"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60572.1"
FT                   /translation="MTALAQGIGTSFQDAAATGPLFLALAACMVAGLVSFASPCVVPLV
FT                   PGYLSYLAGVSGASATLSQADDIGPGRSSDRWRVAGAATLFVAGFTVVFVLATASVFGV
FT                   ITALRLNADLLQRIGGVVTIVMGLAFIGLIPALQRDTRFAPVRVSSLLGAPLLGAVFGL
FT                   GWTPCLGPTLTGVLSVAAGTEGTTATRGVVLIVAYCLGLGMPFVVLGFGSSRALRGIGW
FT                   LRRNTRRIQTIGGILLILVGTALITGIWAQFVAWIRDEFVTAVVLPI"
FT   CDS             complement(53715..54521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_470"
FT                   /old_locus_tag="pnf1470"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_470"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60573"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60573.1"
FT                   /translation="MPHHRMTSGSLSVKELLGEVTDEPRARHRMAADSTDRFKGVAGVA
FT                   VAAGALLGTMAQAAPATAATTDLRAGGISDADADSDAAVSAAAPASTPATAPFGLGGLP
FT                   DELAAPLAQAEQIIKDLQTASPSVTAPAAAPAVLPVGREISSGYGSRWGAFHYGVDIAD
FT                   ALGTPIRSAMGGTVIEAGPASGFGQWVRVQQDDGTIAVYGHINEYYVQAGDRVSAGDVI
FT                   AAVGNRGQSTGPHLHLEIWDQDSNKIDPVAWLEGNGVLTEQRWGID"
FT   CDS             complement(54602..55297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_480"
FT                   /old_locus_tag="pnf1480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_480"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60574"
FT                   /db_xref="GOA:Q5YML7"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60574.1"
FT                   /translation="MTSESPTPEATPPARRRSSAIWAAALVAAVIVGLLAGFWVRGVLG
FT                   SDSSAPALDVVDVGFAQDMATHHNQAVEMSATALEQAEDPAVRTLAFDVLTTQQSQLGM
FT                   MRGWLMLWDRPLSSEQPMLWMRRGDSHTAGTDHQMPAQESMRMPGMATTEELAQLRRAR
FT                   GAAFDTLYLQLLLRHHEGGVSMARAARDNATVPAVAALAKQIDDAQTAESQAIRAMLAQ
FT                   RGAPTLPMN"
FT   CDS             complement(55294..56076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_490"
FT                   /old_locus_tag="pnf1490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_490"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60575"
FT                   /db_xref="GOA:Q5YML6"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60575.1"
FT                   /translation="MNNKSGARSSKRGPRAGKKATAAAIGGKQPPWLLIGAAAAIILLT
FT                   VGLALYYVPKYREYSEAQRYVPGSGQSDPSEMIDGVTKQEYPAGSHVRATQRVAYDQAP
FT                   PFGGPHDQSWATCTGEVYTTPIRSENAVHSLEHGAIWVTYNADRLSGEDLAALRGEVEG
FT                   KPYMFMSPYPNLDSAVALQSWGRQLKLDSVDDPRIRRFVTALRQNPNTHPEPGASCASG
FT                   GGFDPDAPPPFDPSPPGPDAVPLPPAGAGSTTPSGGRR"
FT   CDS             complement(56073..57158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_500"
FT                   /old_locus_tag="pnf1500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_500"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60576"
FT                   /db_xref="GOA:Q5YML5"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60576.1"
FT                   /translation="MISPELLAAIPLPDTPPSIGSMLAWNPPSFPVLPALALAASILYL
FT                   IGLVRLRRLQRAWPWWRTACFLAGCLLLAAITGLGIEAYGYQLFSVWMFQHLTLSMTIP
FT                   PLLVWGCPGLMLLRATPHRGLGRLVLAVAVSGLRSRTMRWMLHPGFTIPLFLFSYYGIY
FT                   LTPVFDNVASTVLGHQLLELFFLLSGLLFVVPILSVGPLPIRQTNLGRFFDLFVEMPLH
FT                   VFFGVILMMATTPLVEFFATPPPQWGIEAMRDQYLAGALAWSYGEPVALVVVIVFAIRW
FT                   RRDEMRDNAVADRRSDLVGDDELAAYNAFLNDLYPRRPDRSAVSRPVASLVREHDAAPA
FT                   SAIISTGHVTDAGSSARRNTA"
FT   CDS             complement(57166..57684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_510"
FT                   /old_locus_tag="pnf1510"
FT                   /product="putative copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_510"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60577"
FT                   /db_xref="GOA:Q5YML4"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60577.1"
FT                   /translation="MMLTALGLTLTAGSARAHSQLDSSVPAADAVVDTPLTLITLTFNQ
FT                   QIGTAFANVGLTDAAGTSWAAQVSKVEGKTVRVAVSPTMPAQKYTVAYRVVSDDGHPIT
FT                   GSYEFTYASGSATTTAPSGAPSPSSVTAAGESSATALSSSLPWPLIVAVIVLIGGAVVT
FT                   LRAATRTKR"
FT   CDS             complement(57825..58766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_520"
FT                   /old_locus_tag="pnf1520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_520"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60578"
FT                   /db_xref="GOA:Q5YML3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60578.1"
FT                   /translation="MIVALGAAWAAALLSLASPAILQRITPSMTPRTAVACWLISLGSA
FT                   VVLAGVAVTAALWPGHAPGVGVAEAAMLCLTRVVHSVPHWLADPLTVAALAGVVGLSYR
FT                   VALSARRHTRAGARVRAYHRDVVSVVARRGDEDMPVMWLDHPKPMAYSVDGRPGMVVAT
FT                   EGLARKLNDGQRQAVLAHELAHLRGGHHRLIRGCEVLAAAMPWIPLFADAPKAVAALAE
FT                   FAADDCAAAATSPATIRSALCAVAATTGTEPASTLSLAGQVLQQRLQRLESSNPPRRSS
FT                   RWVLMGLSPIVAAVAAPAGLLTCAVVACVVMS"
FT   CDS             complement(58763..59125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_530"
FT                   /old_locus_tag="pnf1530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_530"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60579"
FT                   /db_xref="GOA:Q5YML2"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60579.1"
FT                   /translation="MNGLGTLEARVMDVLWGTSEALTVREILERLPDPYAYTTILTVLT
FT                   HLHEKEWVVRVMHRRAYLYRPTRSRAEATAEVVRGIIDSSNDPESVLLHLASIVTEAES
FT                   EAFHRGRTRPRKRSRK"
FT   CDS             59605..61875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_540"
FT                   /old_locus_tag="pnf1540"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_540"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60580"
FT                   /db_xref="GOA:Q5YML1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60580.1"
FT                   /translation="MSQAEAPESADDLHTSPSSPSRDRLRGILRHDLPSSVVVFLVALP
FT                   LSLGIAIASDAPIMAGLIAAVIGGIVAGAVGGSPMLASGPAAGLTVVVAELVAKFGWQV
FT                   TCAITVAAGALQILFGLSRIARAALAISPVVVHAMLAGIGITIALQQVHVLLGGTSRSS
FT                   VWQNLSQLPAQLTRLHWGDLTIGLIVIVTLLSWKKVPGALGRIPGALVAVVAATAVSLV
FT                   VPLGVERIVMNGSLFDAIALPALPDGKWLAVATGVLTVALIASVESLLSAVAVDKMHSG
FT                   ARTDLNRELIGQGTANIASGMLGGLPITGVIVRSATNVAAGAKSKASTILHGVWILLFS
FT                   VLLAGVVQQIPKAALAGLLIVIGIQLVKLAHIRLAHRTGDLWVYLITVAGVMFLNLLEG
FT                   VLIGLIVAIALFVWRAARADIHAEPVGDLDSLRWRVVIEGSCSFLSLPKLSSTLDSVPE
FT                   GADVTIELTVDFIDHAATEVLHEWQRRHRDAGGTVLIDELGSHALSATTQGPPQRASSA
FT                   QARGVEPWKAWQDTNAQAVPHFDALRPMLDGISRYHRRHAPLMRAHLSELRDRQDPTTF
FT                   FLTCGDSRVVPNLITHSGPGDLFTIRNIGNLIPSDGLDTSVDAALAFAVEELGVSTIVV
FT                   CGHSGCGAMGALLGKPTKNSPAVRDWLAHAEPSLRAYHDNHPVAAAAEAAGFDAYDQLA
FT                   IVNVAVQIATATQHPSLVSAVAQGQVQIVGLFFDIATATVWHVSPTTVTAHHNQLATST
FT                   VHA"
FT   CDS             61951..63243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_550"
FT                   /old_locus_tag="pnf1550"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_550"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60581"
FT                   /db_xref="GOA:Q5YML0"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YML0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60581.1"
FT                   /translation="MIMQWSLVTGPLPWLLSGVGALCAAWLIGARRRLSAQAVAECAGL
FT                   GFGAAIVIWVVVERWWRPFPDALPRSVYTWVGIAVAALALLAVRISVTPRWIRRIAAVT
FT                   AAVCVITACAVQINLEFGAYPTLEDLLGTGSDNRISLTAVPAAQPNPVTGWPIESVWSP
FT                   PPPTQVDGRVVRAVIPGTRSGFRARPAEIYLPPAYFTDPRPLLPVLVLLPGQPGSPVDW
FT                   LNGGRVDQTMDAFAAAHGGLAPVTVIADATGGAWRNPLCLDSRLGKVASYLAIDVPAWV
FT                   NGRLQVDPDPRRWAIGGMSYGGTCALQIATNYPDRYPSFLDLSGDAEPSLGDRRQTVQA
FT                   AFGGDTAAFERVNPPTLLRTRRYPNSAGALVTGTEDDTTLSAQRSIAAAARAAGMTITT
FT                   RELPGGHNWSVWSAGLRIEMDWLAQRLGLTR"
FT   CDS             63581..64240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_560"
FT                   /old_locus_tag="pnf1560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_560"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60582"
FT                   /db_xref="GOA:Q5YMK9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60582.1"
FT                   /translation="MLRTLIQYGLDGIGTDGSVSRAINRSADATQWLHPVMLAVDRFGI
FT                   VLAPLALFAARWSTRRTAAAAPFPAISTAVAASGLAYLLARITAASAQHHPPCAIDQTR
FT                   IVLEYCTNTYSLPDATLSAAAAVAAVLAQIDRNLGIAVWASVSGFLVARVYVGHDYLID
FT                   VVLALTIGTSVAVVLTSITRAAAPLVNRTMTRTRRRRCARRTATGHPRAGSDTEAR"
FT   CDS             complement(64204..65247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_570"
FT                   /old_locus_tag="pnf1570"
FT                   /product="putative cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_570"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60583"
FT                   /db_xref="GOA:Q5YMK8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60583.1"
FT                   /translation="MSTMGAEHALAEHTATTGGHAHDNNANAHHGHGHSHGVSADADRR
FT                   WLVLALGLIVAFMAVEVIVGVMAQSLALLSDAAHMLTDAASIVLALIAIRLAKRPARGR
FT                   FTYGFKRAEILSAQANGITLLLLAAWFLYEGVQRLVNPPEVSGPLVLITALVGIVVNIV
FT                   AAWSISQANRTSLNVEGAFQHILNDLYAFIGTAIAGAVVWLSGFARADAIAALVVAVLM
FT                   AKAGWSLVRESGRIFLEAAPAHLDPDQIGSRLASVPQVSEIHDLHIWQITSGQPSLSAH
FT                   VLVADAADCHSVRSGIESVLHDEFGLEHTTLQVDHAADVHAGAGDGHCADPHGPVHRAS
FT                   VSDPARG"
FT   CDS             66064..67206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_580"
FT                   /old_locus_tag="pnf1580"
FT                   /product="putative pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_580"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60584"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60584.1"
FT                   /translation="MNAVLDDLGFTPATLLTTGTRCLRPATLVGNTPVLWIGAPLAPRG
FT                   HGFWAKLEAANPGGGMKDRPALCMVERALGRGDLTPGARIIESTSGTMGLGLALAATTY
FT                   GHPLTLVSDPGMEPLMCSMLAAYGATVDTVHAPHPVGGWQQARRDRVDALLATDPTAWC
FT                   PDQYNNPDNIDAYSPLALELIAQLGRVDVLVCSVGTGGHSAGIARVLRRYCPQLRLVGV
FT                   DTIASTIFGQPAGTRLMRGLGSSIYPGNVDYAAFDEVHWVAPGEAVWAARTLARTHHAT
FT                   GGWSVGAVALVAGWTAATTNPDTRIAAVFPDGPHRYYDTVFNDNYCRVNDLLDHAPPTE
FT                   PVTIADPAEAVVTSWTRCTNVIDPHQLQSANTHAVAEAIG"
FT   CDS             67203..68462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_590"
FT                   /old_locus_tag="pnf1590"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_590"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60585"
FT                   /db_xref="GOA:Q5YMK6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60585.1"
FT                   /translation="MIATVGSWRELNRPSQLLMINQFAINLGFYMLMPYLAGYLSGALG
FT                   LAAWTVGLVLGVRNFSQQGMFLIGGTLADRLGFKPLIVAGCLLRTAGFGLLAVVDTLPA
FT                   LVIASAATGFAGALFNPAVRGYLAADAGKQRVETFAMFNLFYQAGILAGPLVGLGLMTL
FT                   DFQVTAACAAAVFAILTVGQLAALPSHPVCAGGEKTSVGQDWRTVVTNRTFVGFSIAMI
FT                   GAYVLSFQVYLAMPLHAAILSGQHPGTGLVTAVFVVFGTVSVLGQMRITRWLSVRYGRR
FT                   GGLAIGVGTLGVAFTPMLLFPGPGGSAAVAALLISAALLAIGSAAVFPFEMDTIVAVSG
FT                   NRLVATHYGFYNTVVGTGVLVGNLGTATLLDLARRSGSGALAWSVLVAIGVVAAIGVYI
FT                   LGRIVPPETSQPAEVAVSRS"
FT   CDS             68643..69671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_600"
FT                   /old_locus_tag="pnf1600"
FT                   /product="putative copper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_600"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60586"
FT                   /db_xref="GOA:Q5YMK5"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60586.1"
FT                   /translation="MNDPSRRFLLGGALASTAGLALAGRSLLDASPAKAQAPVPAGHGG
FT                   GADGPTFRIGQTVDHTANGFNPTQVLRDFDYGTTTRLPDGRTLREWEVFASDEDIEVAP
FT                   GVTFPAWTLNARVPGPTLRCREGELLRVHFRNGSEHPHTLHFHGIHPAEMDGIAGLGAG
FT                   IIQPGQSTTYEFDATPFGLHLFHCHVGPLAEHIARGMYGTFIVDPPTPRPPADEMVMVM
FT                   HGYNTTFDGEGNQLYAVNGIPFHYMHEPVRVKRNELVRIYLVNVLEYDPINSFHVHGNF
FT                   FDYYPTGTRLQSSEFTDTIVQGQGQRGICEMRFPHPGKYMFHAHKTEFAELGWMGFFEV
FT                   SD"
FT   CDS             69671..70858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_610"
FT                   /old_locus_tag="pnf1610"
FT                   /product="putative metal cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_610"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60587"
FT                   /db_xref="GOA:Q5YMK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60587.1"
FT                   /translation="MSTTTPATRRPWLLGVAALILLVLALIGLALLGGASLPDRAGPPV
FT                   EEIGVEQVVLEPGTIELNLRNTGPDPVAIAQIFVNDTYVDFTGPAEPIGRLSSAHLVLD
FT                   YPWQNGQPYKVSMLTSTGLVIEHDIAAAVETPRAGASFFGLMALLGTYVGIIPVVLGML
FT                   FLPFLRSVGTTTVRVLLGFTIGLLVFLAWEGTREGFEIADTSGGPFGGASLVVLGAILA
FT                   FLTLTAVDQWLRSHRTAAAEQGAASGTRLALMIAIGIGLHNLGEGLAIGSAYAIGELAL
FT                   GTFLVIGFTIQNTTEGLAVVSPLTERRPSLAALAGLGLIAGAPAILGAVIGAGANNPEV
FT                   SALLLGIGVGAIIQVIVQITPSVREPGTTTIGIRTLAGIAAGLVTMWATGLLVAA"
FT   CDS             70855..71265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_620"
FT                   /old_locus_tag="pnf1620"
FT                   /product="putative iron sulphur protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_620"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60588"
FT                   /db_xref="GOA:Q5YMK3"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60588.1"
FT                   /translation="MNTDSVTTTPITRRTALAGACTLCAVAVTGCATGQASQSDGQPVR
FT                   VARAGIDIGGAAVFPEHRILVTQPSDGVYKAFSAVCTHQGCAVTDVDGDVVKCPCHGSK
FT                   FRLTDGSVAKGPAQRPLPERAVMVDGNTLIVS"
FT   CDS             complement(72017..72865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_630"
FT                   /old_locus_tag="pnf1630"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_630"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60589"
FT                   /db_xref="GOA:Q5YMK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60589.1"
FT                   /translation="MTVKLRLNHKLLAARAHEMGFSAAAVVRETGFSLTDLERDPDQRT
FT                   VTLTMLSRLHALLGLSVDEMLLSDRAAKGLAEHDRDAIDAIDAIDAIDAASHARTLLAV
FT                   LVSRDGIGVDVLLAATRWSIAEFEAALTYLRAQLDQTALQVVATDVVLHLALRPGALPG
FT                   PLRAALARPTAMRRGLDADTAIQLLRLVRKEILRPVPGGPIPLPSEVNADRDIDTRRLL
FT                   DAGIAVGRGTKRGDELVITFDDYDGITDSEQAVAGLRIHPDVMFGLGLAERPARRRPAS
FT                   K"
FT   CDS             complement(72862..74415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_640"
FT                   /old_locus_tag="pnf1640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_640"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60590"
FT                   /db_xref="GOA:Q5YMK1"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60590.1"
FT                   /translation="MTSEQGLACDPIVDLDAANAWESLPVRRRRRHRVTVLLDPLDDAA
FT                   VVAALLDVHDQTGPVVTVHPTPATHSSSALALDILAALGRPVRYLAAEKANAPSSLWHA
FT                   VRAWVAAEDIERLVVLRAQRLHKDSWNALLDLWRETGVGLVLVCHATSRPAVLAMLPAG
FT                   VNPRVVAPVSTLLRHFPPERSPDVDAEVEVLPDVPDADVVAFRAEAFRRLSRTDFAQVD
FT                   EVYRAGMAAACRWLHGHPGPVLPTTRAEEALRRMGPTGVRSLELRRGAEALAQRYDESE
FT                   LRHIAVGLLCLNGPRSSEMHKLPYRFDDDDGLDCFLTGLVADSPTRNHTITLLRGAQAG
FT                   ALLHGLLIQLPGHLTRAAGPGMTGRPITAAVAARIRAGTVSPVHAAALACALFTGFDRH
FT                   ELARIPIAGLSMDAGMLRWNNAERYLFDRSPIWVVTSVPRRARPMLAAARTFLGLRGVE
FT                   PKKSLFTGAISSAGQIVPTTAARAGIALPTTISAAGSWTGTATAWWVGSPLHNDMDYSR
FT                   "
FT   CDS             complement(74412..75200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_650"
FT                   /old_locus_tag="pnf1650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_650"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60591"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60591.1"
FT                   /translation="MTRGPITPTEAADDEGADHYLNLPGAHVVATDALLAVRDNLADVI
FT                   EAKAMMCVHGDAGLGKTLSVNTSLREQPAGSVCRVQFRARPTPRDIRHTLFEALAIGGD
FT                   PPRKPIEFDRVLKDVLAERFRVLVCDEAQWMSRECFEYWRHLWDDRFTDMAIVFVGGGD
FT                   CYEVLRREPMLSSRVYVWQEFRRMPRAQVLRVIPAYHRIWANTDPELIAFADKSAGHGN
FT                   FRSWAKITAHAARTLDKIGRDTVDGDVLGYVFSKLSGRSS"
FT   CDS             complement(75197..76756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_660"
FT                   /old_locus_tag="pnf1660"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_660"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60592"
FT                   /db_xref="GOA:Q5YMJ9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60592.1"
FT                   /translation="MADAAKRALQHAAVDRLAVLDQHGDLSSDHVRLTAQTLGVTERTV
FT                   WRWLADRRGAVRKDERRARFRIDAQLRVRFAYWRGNASALHRELRERERAGGPPAPSLA
FT                   TLHRAIREDMTRGDIAGIREGERSRRKFDVFLKRPSTYRNAAWEADHVEAAVEVDVDGR
FT                   LMKPWVTWFVDTEHCVIMGVAVTPKTPNREAILAALRAAILRTPPYGPAGGVPTLVRID
FT                   QGKDFLSRTVSDAMGAFAVRVVDLPGYTPHLKGSVETVNGAVERMLIAEMPRYTHAPVG
FT                   MNGTPTDPDAPALPFEVFVADLLGWVNWWNTTTEHNIDRLDGSSPLESWLADPTPLHEL
FT                   DANKLWMFTLEDDRAHRKITTKGVARGRGRHYVADWMVGMVGARVRLRYMPNHDHEVEV
FT                   FDLASSRHLGSAWLADQATGEQIGRVRRARDRKAAQLRRDLKTAEKARRTRYAAVTTVA
FT                   PAQRLGAMTVAEVEAELGDEDYTELASLARPNLIPHSPPAPGWVLPVDLDAPEPQKKGR
FT                   TR"
FT   CDS             77152..77934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_670"
FT                   /old_locus_tag="pnf1670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_670"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60593"
FT                   /db_xref="GOA:Q5YMJ8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60593.1"
FT                   /translation="MRGGSGMREAVLTTRLALRLFEPGHVAALHEIFADPATHPIGEGP
FT                   FSDIAATEAWIQHRITPRAGTGLCWYGVHHRGTGALLGNCGVFPRRTGAREPEIGYEIR
FT                   ARDQGHGFAREAATAVLAEDLRPHPSMSNSPHPHELVGRRASFGIVEEAVVLGVGDPGQ
FT                   IAHPGPARVRQLLDQLRDRHRRVRQFDGGDAVPADRAAGMPDEHQANGASAAQPQQPGH
FT                   RARAEQVRAARSGSRSGRPAATPSPSAPPAARFCLPGS"
FT   CDS             complement(77931..79334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_680"
FT                   /old_locus_tag="pnf1680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_680"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60594"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60594.1"
FT                   /translation="MPWSNAGAGRGVGGRSVVVDVPGRGLRKAAVQPLLTLDRRGALSS
FT                   AHVQLSAETLGVAERTVWRWSGWALRLRRDVRRQGSYTALVNSGISAEHPAGFEFDFSY
FT                   WFDCDCGRRVEVTAGEYEQQCGGDEESYPVCECGDSIDISTARPALRDLDDIDCHDDQV
FT                   DRHLWYHTSPYQDWPSPRYRSDITALIKRSLLSPSEHEKAIEGRTSLALHLGTYAAAVE
FT                   NMLRRMHDQDSPTHRYWLHQVQVQLGATDLAPGVRGELSTWFGDVPMTALTDLGARAVR
FT                   YVNTHESPGSISLAIDATVIVRVRTIPLPPAASALPATEAGEQAVTRAVAALTAAQQLR
FT                   PDTTGIPEEEIFESELDLVIAQMRGRIVDDEAVQRANEFASQFEESRNQEHEALSSLRA
FT                   ELAEIYLPNVNPQLRTRVDDAIAVGTAPGEYHLRLRQLAALIAQPHQVLRYFDNAPWRK
FT                   FDPPSRLTS"
FT   CDS             80062..81126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_690"
FT                   /old_locus_tag="pnf1690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_690"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60595"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60595.1"
FT                   /translation="MISLAVVRFDFSRLPTERERKALTIRRDRLTAAQKTRTVAVANLG
FT                   KLSAERELTAVRVRDGFVRLPFPLVDDTSDRSAPAPEHRPTSTRLMTPNGIGLRLMLIA
FT                   LFEAQSRTAPGTRADGTPIPLHARVGSGRIGWTTLLSSSAQPAGDGKYRMSVVDKQMRQ
FT                   LQTTFTKLEREGLIEPADPKRRGRGRYEGFFLRYENIRSGETGDRYRVPDSEDPYFDIP
FT                   VSLFTNGWIHVLEDSELALLLITIRMYHRHGAEPQKLAAGTRLLHYGLSRDATESHLML
FT                   TRLGLIESHGDPARTDHGKVTDYKNIGAQPHEFLFLPAGLDRDASTTTLEEIQFQLDRE
FT                   TKGSARSIADAKTT"
FT   CDS             complement(81608..83131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_700"
FT                   /old_locus_tag="pnf1700"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_700"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60596"
FT                   /db_xref="GOA:Q5YMJ5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60596.1"
FT                   /translation="MTGPVLRHSVVVVGAGFGGLTMGAELKAAGVHDFVILEEGNDVGG
FT                   VWRENTYPGCACDVPSHLYSFAFDPHRDAQVRYPDQASILAYMRAVADRNGLREHLRSS
FT                   TSVKSAVYNDADGSWTLTTERGQHLHTEAVVWAVGQLHRPAVPQIPDAHTFGGRAFHSA
FT                   RWDHTVDPTGHIAVVGTGSSAAQMVPELARTAASVTVYQRTPAWILPKPDSRFGPGTRW
FT                   ALEHIPGLHRLYRAGLYHGADLVLAPIMRGGWSARPAAWIARAHLRRQVPDPALRVKLT
FT                   PHYRIGEKRILMDSRFYPALALPHVELVTDPIDRITEEGIRTADTPHRRTHRRHDVIVW
FT                   ATGFRAPELLGGITVRGRGGRDLHAQWAHWGRPEAFFGLAIPGFPSMYLIAGPHSFTPA
FT                   NSNPALKRHQARYIMRCLELTARLGAPIEVAPASMANYRRWLNTELARTVWPDGVPSWF
FT                   KRRSDGQITNPWPASAREFGRLLDRHHPADTFTEVSVAAGAAGQDWQAG"
FT   CDS             83374..83670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_720"
FT                   /old_locus_tag="pnf1720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_720"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60597"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60597.1"
FT                   /translation="MYALGVGYHFRDDVAESVYLHDVTKAEVMEALAYPRRWPQRIESK
FT                   VDARVLQIFSRTAEGNGVAVVVIQIDRWDWLIYAARPLEVDENAEYTVWEAQQ"
FT   CDS             83667..84023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_730"
FT                   /old_locus_tag="pnf1730"
FT                   /product="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_730"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60598"
FT                   /db_xref="GOA:Q5YMJ3"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60598.1"
FT                   /translation="MNIERRIEELTAQAADADLMGDFLAGRLVRSSEPADVSELPVPDA
FT                   AEVESVALIPTTVRFSKAQRDKLTELAKARGTDVSSLLRAWVDHQLEVTEHPERQLITV
FT                   DEAIQALRNLPHSA"
FT   CDS             85135..86532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_740"
FT                   /old_locus_tag="pnf1740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_740"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60599"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60599.1"
FT                   /translation="MACQTFPPSPFQVCGAILDKYLQTGGPNGFLLFPKSDELTNPDGF
FT                   GRRSEFLGGNIYWSPNTNAHPVAHEFLTKWGEYGYEGGFIGYPLTDEIVLSDGIGRRQE
FT                   FQGSWIYWHALTGAHNIQGAIRDKWLESGGERGPLGYPSTDEVVTPDGNGRFNRFERGM
FT                   IYWSPSTGAHAVSGRILTLWSAAGYETSHYGYPTSDATAGAEPGSLIQQFEHGSIYVLN
FT                   DYLRALLVPAQGFASYDTGLHPGYCPDPLNSPPTCPVDLSDYDTVPDPFGTLVTANMQK
FT                   AALVSTYFAANGRPNAHELWEHYYRNTGDDYVLSSALLDSWTAEESTDYPGLRPPAELV
FT                   NANKVEAINAAIAETARTGQTAKVIISTPWQVTAGISNDQVQSIGRYSLCSTTAVIAQP
FT                   ANPGQNPIELRQQTHIYDVYDYAAGDDYGNPAQDAVAVAVEGEKLGIAKPFLVLGSSSV
FT                   HSWSGIR"
FT   CDS             86639..87004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_750"
FT                   /old_locus_tag="pnf1750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_750"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60600"
FT                   /db_xref="GOA:Q5YMJ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60600.1"
FT                   /translation="MSSAAPGNVSRPCSAGWGVGAGLFVSTVVFVPAVFVVRQWLDLPE
FT                   IPATPSHLRAHPVEVPDSYWITWLVAAVVLLAPGVALMLWPRMRRVAMGYTLTAGFVAG
FT                   LLAALTIGFELGGFAPT"
FT   CDS             complement(87248..88486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_760"
FT                   /old_locus_tag="pnf1760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_760"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60601"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60601.1"
FT                   /translation="MDCNTSGLQHLVISGRRLGADSTALLLRWIFDPDSRDFDLAELAV
FT                   VTAMVGDEWEDTARDVTEVVLPLLAQHRIRFIQIGRADRRVRADGTGVVVFDDSRSPHR
FT                   LHIEGAYTLGTEMLTAGIQPQVGGSRRCSMSAKGEVLDPVIAAITHGRPYRHVVGFEAG
FT                   ELSRARRDAGYDTALRRGEYPLVSWGWDRERVLAYIDEKTGRAWQKSACVFCPFALVTA
FT                   ANRAATLTRYAEFPDAGARMLLMEHTALALNAKQGLVGGKRAIDYVRAAGLTGVLTAFE
FT                   SALAEQPHALYEVRRLARRTQTGGAKMVARSVRAVDVGSRDEMVAWLDGAPLRVDIGGP
FT                   DGSPALVDTHRELGDDGIARAVVPGRDGTGPHELEHFFVVAPAVVADKERPGFADWWAQ
FT                   ATGTDLALFPMST"
FT   CDS             complement(88832..90388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_770"
FT                   /old_locus_tag="pnf1770"
FT                   /product="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_770"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60602"
FT                   /db_xref="GOA:Q5YMI9"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60602.1"
FT                   /translation="MSSSQFPHPTSMTRRGFLALGTGVTAAAVLAACSKDSTASRTLVE
FT                   PDSEAVRAAENTRRAADAAVRDVSLHAEPATVDLGGVQVQTWAYGGKLPGQEIRITKGD
FT                   VLRAELTNALPVPSTVHWHGIALRNDMDGAPEVTQPQIPPGGTFGYEFTAPDPGTYFFH
FT                   PHVGVQLDRGLYAPLIIEDPADGKDYDLEAVVVLDDWLDGVNSRDPDKQLDQLRAKGMS
FT                   GMNMGGMNHGGMAMGGSSTMAMPTDPNAPLGSDTGDVSDYPYHLINGRTGADPVTIAAR
FT                   PGQRIRLRIINAASDTAFRVAVGGHQLRVTHSDGFAVQPATTSSLLISMGERYDAVVEL
FT                   ADGVFPLVASAEGKTGQGFALLRTGAGAPPPAEVRPAELAAPPLTADRLVSAESVRLPL
FT                   RKPDKTLDLTLENNAAKYLWMINGKAFPEHAMLDVTEGQRVRLRFVNKTMMFHPMHLHG
FT                   HTFQVVTAAGTGPRKDTSIVLPMQTLEVDFEADNPGQWMVHCHNAYHGEAGMMSIVSYM
FT                   R"
FT   CDS             complement(90598..90999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_780"
FT                   /old_locus_tag="pnf1780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_780"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60603"
FT                   /db_xref="GOA:Q5YMI8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60603.1"
FT                   /translation="MQHQSSRASRSVRVLGLLVLLLGITVMHTGGFHLGSDAHHAGSSP
FT                   ASITAGTTLHDEVTIGGGGHGLGHDAVHACVFILSTLTLAIGLVLLYRAGHLSRGIGPM
FT                   PTTASLRLHRERPPPWVVPSLAELSILRI"
FT   CDS             91259..91693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_790"
FT                   /old_locus_tag="pnf1790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_790"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60604"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60604.1"
FT                   /translation="MRFPGRLRHAGSVVALLAAVLVVVPLIDCSVARGDVHVHASAHAG
FT                   AGHHLASSPGGDHVHAVIIDALDGHCLAHLDHCIAKSVVRGAAENLPPQKLLLFALASA
FT                   LLAAVAARGVAPGGVRGPPISRVPVAGGRATLTQFCIARR"
FT   CDS             91797..92924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_800"
FT                   /old_locus_tag="pnf1800"
FT                   /product="putative pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_800"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60605"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60605.1"
FT                   /translation="MDKLVLDARTDRSSALMVAPAPARFPQSLIGNTPVLWVGAPLAPK
FT                   GRGFWAKLEGFNPGGMKDRPALHMVLKAEQRGDLTPGARIIESTSGTLGLGLALAGIAT
FT                   HHPVMVVTDPGLEPIVARMLTAYGTQVDVVTEAHPAGGWQQARRDRVAELLAADPDAWC
FT                   PDQYSNPDNVDGYESLALELVEQLGGVDVLVCAVGTGGHSAGVARVLRQFNPEMKLIGV
FT                   DTVASTIFGQPAGPRLMRGLGSSIYPVNVDYDAFDEVHWVAPSEAVWACRTLAATHHAT
FT                   GGWSVGAVALVAGWAARTHDTDTRIAAVFPDGPHRYFDTIYNDAYCDEHGLLDADPPVE
FT                   PDTIAHPAERVVRSWTRTTTVVDPRQFIHDQELAS"
FT   CDS             92921..94285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_810"
FT                   /old_locus_tag="pnf1810"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_810"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60606"
FT                   /db_xref="GOA:Q5YMI5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60606.1"
FT                   /translation="MSVLAKFRSFDLPARLLMINQFGINLGFYMLMPYLAGYLAGPLGL
FT                   AAWAVGLVLGVRNFSQQGMFLIGGTLADRLGYKPLIVAGCLLRTGGFALLVFATSLPGL
FT                   LVASAATGFAGALFNPAVRAYLAADTGDRRVEAFAVFNIFYQAGILAGPLVGLALMALD
FT                   FRMTAAAAAVVFAILTVAQLFALSTRRAEIRAERTSVLDDWRTVVANRRFVWFAVAMIG
FT                   SYVLSFQIYLALPLQAEFVAGAQAQTLVSALFAISGLVAVAGQLRITAWFRDRWGTGAS
FT                   LVVGLGILAASFLPLALIPDPDRFGVPAAAAALLLCAMLLAVGTAAVFPFEMDTVVSLS
FT                   GGRLVATHYGFYNTVVGVGILTGNLATGAVVGAARAAGMDWALWVGLSVIGVVAALALH
FT                   RLDRPQHAEEDGQSTDVRGRHRIPEDHAIGTTLVEQEFDYTGRGHWPTKIPAGRR"
FT   CDS             complement(94384..95028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_820"
FT                   /old_locus_tag="pnf1820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_820"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60607"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60607.1"
FT                   /translation="MPLRSTTLRRYVPGVAVLLFVLAGCGDSDEAGKPTTTAGASAPAT
FT                   STTVGAATSAPAATYNDADVTFLQMMYLHHAQAVQMADMVPSHSQNPQMLDLASAVKAA
FT                   QEPEMAQIRSLLEEFGKPVPSPTAGPMGPMGHDMPGMMSPEQMSSLQGMSGAEFDRMWL
FT                   QMMIGHHTGAVQMAQTELDTGANDQAKQLAAEIVSAQQREIDQMKAMLGQR"
FT   CDS             95453..96118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_830"
FT                   /old_locus_tag="pnf1830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_830"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60608"
FT                   /db_xref="GOA:Q5YMI3"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60608.1"
FT                   /translation="MADAAYGLWPLVILNTALFVAFALSFFHPRTNRDWRVMSGYTAFL
FT                   VALFTEMYGTPLTIYLLGSWLGSRFPLLRDSHAGGHLWNDLTGWTGDPHLSPFHLASYA
FT                   AIGGGFWLIAAAWRPLHEAARANRLATTGPYARVRHPQYDGFLLVMIGFLLQWPTIPTL
FT                   VMFPILVVVYARLARSEEREVATRFGREWTDYAARTPAFIPHLGVGASLRAAGAGRSR"
FT   CDS             complement(96540..96968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_840"
FT                   /old_locus_tag="pnf1840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_840"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60609"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60609.1"
FT                   /translation="MKGGNIPMTTVKDMLATYPADLGDVDRDKLTRCIEDCIACAQACT
FT                   ACADACLSEGLVGELTKCIRTDMDCADICNATASVLSRHTGYDANITRAILQACATACK
FT                   ACGDECSAHADTHEHCRVCAEACRRCEQACDDLIRALG"
FT   CDS             complement(97150..99633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_850"
FT                   /old_locus_tag="pnf1850"
FT                   /product="putative cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_850"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60610"
FT                   /db_xref="GOA:Q5YMI1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60610.1"
FT                   /translation="MATHFDAHTHSPKERVTAVLDVRGLLFASQQNVVAARLARRPGVY
FT                   QVEVNPVAQTATVVYDQTQTTIAALRDWVIECGYHCAGRSVPAHICDPLTEPDPPTEDK
FT                   QTGDAGQLATTEPIEHAGHIAAAPAHTEHPAGAGDLRSPHDAMGHGGHAGMSMASMVAD
FT                   MRNRFLVAVLFSIPIVIWSPIGRDVLRLDVPVPFGLREDVWALLLSLPVIFYSSWIFFD
FT                   GAVRALRARTLDMMVLVAVAIGSGWLYSLVITLTGGGEVFYEAATVLAAFVLLGHWFEM
FT                   RARGGANDAIRTLLDLAPPKALVLRDGEPVEIPTAEVAVGDLLLVRPGAKIAVDGVVED
FT                   GDSEVDESMVTGESLPVHKAPGAAVVGATINSNGTLRVRATKVGADTALAQIVQLVQEA
FT                   QNSKAPGQRLADKAAFWLVFVALIGGGVTLAAWLLLSDRPFSAAILFAITVVVITCPDA
FT                   LGLATPTAIMVGTGLGAKRGVLFKNAMALETSARIQVVVMDKTGTLTKGEPEVTDVITD
FT                   GIGETEVLRLIAAVERESEHPLAQAVVRYAENAGVGQVRAEKFENVPGHGAIAEVEGRR
FT                   VVVGNRRLAEREDIDLGALAARRDELAATGRTAVIAAVDGKAAAVIGIADAPRETSPAA
FT                   VAALHDLGVEVVMLTGDNEATAKRIAERLGIDTVIAEVLPGDKATKIAELQRSGRQVAM
FT                   VGDGVNDAPALAQADLGIAIGAGTDVAIETADVVLMRSDPLDVPTALRIGRGTLGKMRQ
FT                   NLAWAIGYNTIALPIAAGVFEPAFGLMLRPEIAALSMSGSSLIVAVNALALKRLRLPTP
FT                   KPTHTGTSEATPVVA"
FT   CDS             101364..101591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_860"
FT                   /old_locus_tag="pnf1860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_860"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60611"
FT                   /db_xref="GOA:Q5YMI0"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60611.1"
FT                   /translation="MNTRYLPWYALALAVLVAGLAISGVSVSTLLLMLVVLACPLMMMF
FT                   MMGGHGHGGNDDKPYEMGKRHDHGPTSGRS"
FT   CDS             101631..102332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_870"
FT                   /old_locus_tag="pnf1870"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_870"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60612"
FT                   /db_xref="GOA:Q5YMH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60612.1"
FT                   /translation="MTTDPDAVEATADEPVTAVTRDTTPLLVAEGLEKAYRRGGRFLSP
FT                   RVPVLRGFDLRLLPGEVVGLVGENGSGKSTVMKILVGDLSADAGTVTRSGRLGYCPQQP
FT                   VLYERLTCDEHIELFARAYRMTREAEHQARRELYAALGFERYASTRADRLSGGTLAKLN
FT                   LALGLLADPEVLLLDEPYAGFDWDTYLKFWEFVALRRSTGRSVLIISHFVADEHRFDRI
FT                   VELRDGRAVER"
FT   CDS             102329..103864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_880"
FT                   /old_locus_tag="pnf1880"
FT                   /product="putative ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_880"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60613"
FT                   /db_xref="GOA:Q5YMH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60613.1"
FT                   /translation="MTAVAAVPAPPRPAVWPFVRCFVEDYFRNPVNLIVLLLVPTVFVL
FT                   VAAGSIAQAMELLGRSLGSRPAVETATAGWAAAFLSGIAMYFQVRSARATDRRLVLAGL
FT                   SPARLVAARAAAGLVLGVLVSAVSLLALTARTGIGDPIRVIPATVMFAVIYLAIGAVVG
FT                   ILATNPVNGAVVILFVWIIDVFIGQVGDTTEQISRWFPTHFVARWMVGLPTGHAGRLGD
FT                   LGASLVWVTAAALVAAAALVTSSRTTTRRAAGQLRTALRLGVVELSRNPALAVLLIVVP
FT                   VVFVLLAEITTPARSIVMPLRENGATVTSTFWFPEVHAGTMTPIAVGSLATLAGLFLAL
FT                   DAADGDRRLRLAGYRAGVLLTARLGVIAMAVLVVTAAALAITATVFDARQWTGYAAANL
FT                   LLAATYALIGVIIGPLFGRVAGVFVAFLIPFLDLGLVQSPMLRPEPQPWARTLPGYGGS
FT                   RVLIDTGLTDHFDEIGALLIALAWLTGLAAVAALLYIGGYPSHRSIRFGSSHQ"
FT   CDS             complement(104632..106776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_890"
FT                   /old_locus_tag="pnf1890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_890"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60614"
FT                   /db_xref="GOA:Q5YMH7"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60614.1"
FT                   /translation="MTTALTPTGDDLPSPDTVVLLNRSLRPGTDQHALSRFGQDRWNLS
FT                   PGLLQHHSSALAVDFAQVPDEFRLPVKQIVWLLLNAEPDQPVNYRFTTARLSVSSVSAV
FT                   SRFLRSFTQWLHARAITRFADVTAADLDTYAIDVRAAEISHSQREDLLAAVVRAWSVRD
FT                   RLCPADRLPQGPPWNGDRIRDVLGQSRELAENRTLRVHPDTMTALLAWSLRFIEVFADD
FT                   IIAAFTEYLELSGAAYRARRTRVPKDEIYSHRRRPGEARQLLAAHLDEYRRRGLALPGR
FT                   RTADGRLLVNTYFLSAQAGIPVAHKSITSLFAERGQMPIDDDTYLFAPITAVLDGRPWR
FT                   SRSIPYLQAPILARHLATACFVVIAYLSGQRPGETLNLERCCIDRDPATGLVLLRGKHF
FT                   KGVRGQDGAAVPDGEYRVDPWVVVEPVAVAVEVVGRLHDSALLFPNTIEVNGISSPDRL
FT                   KARVVHAARNDQLMTRDIEALLDWVNRYCAEHGRTDAIPPDPVKASISLGRLRRTLAWF
FT                   IVRRPRGLVAAAIQYGHVRTGMTLGYAGSYDSGFPDDLVFEEWLTRLDNRADAHQRLRD
FT                   GEHVSGPAAEVYRQRVESATRFAGRVLRSSRDAAALLANPDLQIYKGNAMTCVLDPAKA
FT                   ACRLASDEQGTRRTPDVNDCRPTCANIARTDRDIAELSRHADQLRLIVADPLAPPIRTL
FT                   RERRELTRIDKIIAEHRNSA"
FT   CDS             complement(106773..108653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_900"
FT                   /old_locus_tag="pnf1900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_900"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60615.1"
FT                   /translation="MSRGRAAVQPALGYRTPQRLFLGHNECRVRFFPENGGDHVDLDFM
FT                   CLPVPRELRNWFATAAAGATRPSGPRRTATSASDIVSTFLRFARYLAGLDNPPLSPNGL
FT                   RAVHLDGYILSGGVGTTLHRDLATLRSVLRFAPDVPAEFAARLSTARVAKNDERETSYT
FT                   EAEFNRILAHARSQLRAAARRIRAANRLLEHWRADRVDQVTDAQRWELGWLLDYVDREG
FT                   DVPRAGAVQPAAGKAHQAAVVSRHGGSSTVLAHLYPTYLEIGAAVALMIGLTGHNLGTI
FT                   RAATVHHHRTDADTGAAPTILVDWLKPRRGTRRAAMTVPLQDLTPDGARPAGRDDLTTP
FT                   FGLYTLLLELGHRVRAKTGSDGLFVAFTHKGNGKGRDIAGFRVQVPKSILLFWGEDAKL
FT                   PTDIADPDTSAPAVLRVRSRRLRLTFLERYQRPVAHTEITLVNEYLARNRGNLAEYQQV
FT                   VADVLSEQVAKARTAATIPVLSSEDIAQARTDPAGVAARFGVSAQTLTELVDGRLDTVV
FT                   AGCTDNLNSPHSPPGKPCQASFLLCLSCPCARATPAHLPVQVLVHDALLARRPGMTPLT
FT                   WAERFADPATRLLDLLEQHTTTAVADARANASRFDRLLVDRFLTHGLDLQ"
FT   CDS             complement(108650..110212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_910"
FT                   /old_locus_tag="pnf1910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_910"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60616"
FT                   /db_xref="GOA:Q5YMH5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60616.1"
FT                   /translation="MSVVVAVPELRLVRSDDYSATVPGVWRLQRCSYYIGRSAIVGGLA
FT                   LPEGLDVAALCARNATVEGQEFLINSDGRVVVEVNAFFASRRMRNRSASTREKYARGLC
FT                   VWLGYLDAVGGCWRGVGPEDVDAFKFWRMTDEANPLRVAGSSVSDNIQAINAFYEWAQE
FT                   RLDVRNPVDRRLASWPRQGPLGRAEPFVATPHVVRDRDVKWLDQGGYACWRDLGLRGLD
FT                   RSGRELRGWRGRNSQRDCAFTDGLYGTGLRLSEWATLLTVELPADDESRGYYTCRLASS
FT                   CGKGGRGRRYWMPRSVLVDVLSYVESGRAAAVGRARAKGLYDQVSDPLLLVGQDCGRRV
FT                   RLRAGDGAVSDVALDTLNARTRARIFRQTRTGLEPVSLWLNETGLPRLAAGWEHTFTQA
FT                   NERLARAGLGSVSATAHMLRHSFALRWFSVGRLIYEQRFAHLSSEELRDFRAQFGDTWY
FT                   LVKTLLGHADIAVTMDVYLEPFRDLDVSLLIEHAHGAGMSALMAEMFSRHPQVITRPAG
FT                   VGA"
FT   CDS             complement(110347..111126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_920"
FT                   /old_locus_tag="pnf1920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_920"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60617"
FT                   /db_xref="GOA:Q5YMH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60617.1"
FT                   /translation="MSRKDRDAGAWFSVLDTPFRDELELRLRTASALTLETVALLRHGV
FT                   RPAGLPDSIRVMPHTVFEDADGDRLEVTDLGDGRERLTIAPDADAVRFGGSFQSVDVPR
FT                   DQLLALLARLTDRFTADFRTRSLVTGGADAEPDTARSPAHHTPHSRTPRSFPVNSFQHD
FT                   RRHDEQHDQSWLAQAHAVVASGWLAGGSMYALGAVTSEFPAIISSLMFLAGAVAVESGL
FT                   RHYRTWRRITDELHMAGCTCPPGSGGVALRVRDRANR"
FT   CDS             complement(111422..111832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_930"
FT                   /old_locus_tag="pnf1930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_930"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60618.1"
FT                   /translation="MSPLAAVVADHDRFYVVFSDVPPASERRFLDEREFVTEADARAWA
FT                   AEEVSAATQHSGSAWDFRGDLWRIPAGVRVEDESSLENVQALANVTWDHITKAVVWAVG
FT                   VPDDWNPDGGDAEPADGRGDPSAPWGDDEAPF"
FT   CDS             complement(111992..112456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_940"
FT                   /old_locus_tag="pnf1940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_940"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60619"
FT                   /db_xref="GOA:Q5YMH2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60619.1"
FT                   /translation="MSASYAVPALLLGGPGVVFAALALSYRRDARRFPATGERPGATTL
FT                   SAAHGCLAALSFLWAVATMPLSAPLAVVAVGVGAASLTVLAVQLRAADRADRWEAALAV
FT                   LSATAPLGEPEGCPAARPSSPVRSQDTRRLAVLRRRQCAPAQHRDPYSTD"
FT   CDS             113499..114560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_950"
FT                   /old_locus_tag="pnf1950"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_950"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60620"
FT                   /db_xref="GOA:Q5YMH1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60620.1"
FT                   /translation="MRSLRETRSLVTDEELADFELDVLSEFVLARASSGVGDSTIRGDT
FT                   THLGQVRQWFGRPLWEMEPQDADRYFGTVLRRVSSSTRAARARTVVSYFEFLEIRYKVV
FT                   LHEMTGRVVECPIDEVNRPRMSVDTMVRIPPTEAELEQLFTGWREDLVTCRKFAPSARN
FT                   YMVARLAADVGLRVNEACMLDLDDIRWELGRFGKLNVRHGKGAFRSGPRQRLVPLINGA
FT                   DTALTWFVEDVWAQFDADETLPRAPLFPSERRRAGSSGTRVTRDVIRRALGGAVDRHLP
FT                   TWSGRLTPHVLRHYCASQLYRTGVDILAIQELLGHSWITTTMRYVHPYGTRVEDAVTAG
FT                   HKRAAARWEGLIR"
FT   CDS             114557..114892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_960"
FT                   /old_locus_tag="pnf1960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_960"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60621"
FT                   /db_xref="GOA:Q5YM19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60621.1"
FT                   /translation="MKWNLRLVAANRGIWKSSELRRMLAARGLEISTGKMSGMWSSTPA
FT                   VLRPEELDVLCAVLNCGIAELITAEPDTVAAPTDAGEHVRAVGDQGPESVRRIVPKPRT
FT                   GRSLPPR"
FT   CDS             114889..116511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_970"
FT                   /old_locus_tag="pnf1970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_970"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60622"
FT                   /db_xref="GOA:Q5YM18"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YM18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60622.1"
FT                   /translation="MTATSCRECGGRIEASTCPRGGRPRQYCLTCRPSKTAERRAEGAK
FT                   DYRDGSCVGCGTQLERAARTIGRPRIYCDACRGRRARTPSRSRRRNDAGPAQDNRSEAY
FT                   RDRRCTRCDAPIEVDGQRKGRPRIYCDGCFGRRVHEQRRHRTRPRSLDGLRFAEVFGTI
FT                   TGRVEHEVLERLFDTARVGRWSVATVQRRSEELRRVLATAGDEPISLSQVRAELGNVWQ
FT                   SRIAARVLDQCGLLIDDTESPTRQWIDRRTAELPPGFRDDVRAWLVVLHEGGQRARPRA
FT                   EATLHAYYSRVLPPLTEWGSTRSHLREVTQADVSVALNRLNGHKRVGTFVALRSLFRFA
FT                   KRHRLIFLDPTRRLRAGAAPSRVLLPMTTGQVDAVTATAVTPLQRVVVALVAVYAVRAH
FT                   ALRQLVLDDLDLARRRIRIGGSVHQLTEFTHDVLTDWLTYRQQRWPGTPNPHVLVSSDS
FT                   VLGNSPVEDYYLTWHLSLLGIQLEHIRGDRILEEALSTDTDPLHLTIMFGLSEKSAADY
FT                   ARLARGITERPIEAVSHYPADWD"
FT   CDS             116873..117292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_980"
FT                   /old_locus_tag="pnf1980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_980"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60623"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60623.1"
FT                   /translation="MPPKSRQGHRPHSVEKRTRRHEALFAPAEWALVAAAAATVGLKPG
FT                   AFIAKAAVGAARAFAAQRNGSAVRTSGQVEILIAEVRELRRLLGNVAGNVNDVAKHANS
FT                   TGELGQNADAVLAYTRKINSRIDTWLVEQLRHGAL"
FT   CDS             117289..118920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_990"
FT                   /old_locus_tag="pnf1990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_990"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60624.1"
FT                   /translation="MIGKAIRGWDGQRLVRYLFSKGKYNEHTNPTVIAAWQSDPDALQP
FT                   VWVGPDDCDFAPGEIGKLANQVTALSDAIGLPTEQPEPGQPGYTKHGYIWHLPVAIGAE
FT                   DGELGHDTWRRIAEDMLHETGIAKAGDAGACRWIAVHHGKSVDGNDHIHIAAVLVRADT
FT                   GKRFYPDNDWKAVRRVARRWEQALGLRMTAINDPSAVPTPTRGEQEKAKRRHAAGDDGM
FT                   LRATPGAAARVQLRQMITETAAIATSADEFVARLRDAGMLIDFKYDAIGQIKGWAVAAP
FT                   GDVSARTGEPIYFAPSRHLGADMSWPRITARWSASVPSRPGAAREAAATETAREPHAVL
FT                   ADSAERVRSVTTAVRGGRADVATLARELQDVISSWASIADGAARQGPLSRAAWVYDRAA
FT                   RTRRGLAAVPAGQLAAELREVSRGLAAVRMLSGRGLQRDPSLQLGLAIAELLLEIAAWH
FT                   QQNQRIAAARSAREAVGLVRAHGEATGAVPGQLPPRRAPAGTGHTPTVTAHPGPAARPG
FT                   EGRRELPAVRGVRELPSGPTRKEHRR"
FT   CDS             118917..120629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1000"
FT                   /old_locus_tag="pnf11000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1000"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60625.1"
FT                   /translation="MNQPVIETPVMGIPREDTMRMALAARTLSGVLRQLRERRGRSAWD
FT                   DAENAARKNAVIDRHTVNRFSRADAEEWNTAEREGRIRAERHPDTGMTIRVAPLSRGRF
FT                   GVQAGWEDNHAEAVVGSEDLAARVADWLRADGSADAVDDLRRNVEDMHATSRPRRQRTL
FT                   RDIELAEAREWAKENDADWYRWWELSYTNADTIDGRRLDEAEIINKWVDATGGVTRSAV
FT                   GVARRWLAEHDPEWTKNWVAEYDNCDTRDGRRSLEAEIVRRWRAQSRAGRGRGGAGQEW
FT                   GADTGAAEQGGDSQDRSTPTPLADRLRGRVPDRVLDDPRWHVAEDQFAVLTSQGADPDT
FT                   LIESVAAIDFNNGKIRAPSGFAAWAMREAAKKGKAANAHTRSEEDARRSVAEEWLMSAD
FT                   PDSPFDRARAAQLVGEIDDDFDALLARKYPGILDGDAEQARAKAAQHESNADTADDQAR
FT                   KDNTAAQQTDEAEAEDTVFVVDSDGTVITVPFVPAPEPPPEAEAEAASHAADADREHEA
FT                   ADSQHRAARTAEAAAQAPLTPPKQAKSNAKTRRRTPPPATPAATHTRNRGRAH"
FT   CDS             complement(121255..121656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1010"
FT                   /old_locus_tag="pnf11010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1010"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60626"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60626.1"
FT                   /translation="MTTTVGFLAGGKCPNTAEGRVHRGDNQGGLVGSVPVIFAFQHAYY
FT                   VARSGEQVRALVLPEAPVSSADTIQKGINTIPDKTNYCLTITELEPARYLVEVFERRPS
FT                   GETKTYRQNVTTVHRDGRTFIDTVTSADR"
FT   CDS             complement(121976..123847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1020"
FT                   /old_locus_tag="pnf11020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1020"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60627"
FT                   /db_xref="GOA:Q5YMG4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60627.1"
FT                   /translation="MRTDKTGSPPSFARITQALDEWAFENSRPAGPASRRGQWTMYHCP
FT                   AHQDDDPSLGLIYNADKHKTVVRCFTGCSDTQVLATIGLPESAIWDRQWVRVPGSPARP
FT                   RAPRPEVPKARGDAPVPPKPSKKERLGKVVGPRYQAAIYHYTDHRGRPLGEVVRMHVPH
FT                   ERGTDKMFFQRKMDAGGRWSKGGFEPVLYHLPEVVQAIADGEDIHLPEGEKDVDRIRAA
FT                   GRFATCNAMGAGSFRLEHARQLTGARRVIIIADRDSAGYQHALQVKRMLVGRVGEVLVV
FT                   EAATGKDASNHFDLGHDFDEFVPVTDEQLERGFPGADEAIAAAEKAMEGVFRRSFDPET
FT                   GWRWQWAPEAETELGIERAPAKSVQNQQNPETTMAQTAIAPGEGVQITVYTKPQCPQCD
FT                   ATKRTLDNLGFDYRIVDVTQDSAARQRLLDMGFQGAPVVEAGDVRFSGFRPDKLKTLPG
FT                   VMRADVLAEQEAAAAQPGFPSTADRLSVDAVQAWAGPYLRAAMRRGEIPEVGSPQWAAL
FT                   PNGDPRKTGAVVEAALRYVQQATAAEATAPVARSQTSTVTATARNSSGRPTFAQLQEAR
FT                   RGEQALRAANGPLTPSAGAAAAAGASMTPASRANTSAAPQRTPGRGR"
FT   CDS             complement(124251..124670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1030"
FT                   /old_locus_tag="pnf11030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1030"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60628"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60628.1"
FT                   /translation="MNARATTIAADLVYAVRYRVRNLCADLRYCRALRLALLVKADGAD
FT                   WRRVLHTLMATYDVSTVRVGEHWFLIGPQDPRTLDRLPEGNRWAWYVCGPSLSATVNPS
FT                   LSWEETVPGFSPGTALDYCREWAEVAATTEQRSAA"
FT   CDS             complement(124667..125653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1040"
FT                   /old_locus_tag="pnf11040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1040"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60629"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60629.1"
FT                   /translation="MADAKAGPEFDTLAAAVAETIAAWRAQNPTAEAVPRQVRREISRA
FT                   VRNDTRSRQLDVSITRTQLELDILHHQKAVVAAGFKPEKEEQHEAWARKQAELSDAATR
FT                   LERRIHELPHLSATDRGRAVEALAQAHAVPGAAVRVKWEVNSAMEALKARVAEKVSAIR
FT                   LGITTVTRQLRSAPFRLAQWQADAMHNQARQPEGPSAWLTPGQAAALADLTAAAQRFDK
FT                   ASTQAREAKEAETDLAAVVTEFHEALTRTQQLGITSDRINQELRAAHQASQTEPQRQGM
FT                   WSKIQAAARGPLTPPAAAATGGRKFTFGAAPAAQAAPVAAAARRAAR"
FT   CDS             complement(125838..126953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1050"
FT                   /old_locus_tag="pnf11050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1050"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60630"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60630.1"
FT                   /translation="MAKQYSPPPVVAPWSTDTAAYGGRADSGLWTDGVPAQGVSPLQRA
FT                   HAGEWRHTSSDRSAAVTPESRDWRRDPVRPAPGSGWRRALYLMSGKTLNLGESPAEVRA
FT                   RELDRRIRTAIESDFCIGVVQLKGGSGKTTTAMGIGNAFAACRTDGVIAFDVNPDRGNL
FT                   ARRTTARTESSALTLLAGPRPRRVQDVRTHTQLTPAGLDILASAADPATADSFSAHDYR
FT                   QLVDLASDYFPLMLADCGTGITHPATQAVLDEADALVIPLDAKKDSADEAVAAAEYLHT
FT                   AFAKDPVTGDPLLDERGERRWLYRGLLSRTVVVISHQQPGRRMFDASAATRWFNHLVHA
FT                   VHEIPYDRHLDEGGVIDPQLLHPRTVLAYSR"
FT   CDS             complement(126971..127423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1060"
FT                   /old_locus_tag="pnf11060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1060"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60631"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60631.1"
FT                   /translation="MADTQSDAAGGRRWSRENFSCSDEVWGAAKKKWGQQLRQYPTWTG
FT                   WLEAALAEKTARTRQKLGISTFEPAPDRLPPGRRTPPDQAGTRPRRSFSCSVEVWQDAR
FT                   NAWWAEAESYPAWSDWAEEAVAEKAESDERSTQSESTEDKISSKTS"
FT   CDS             127809..128336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1070"
FT                   /old_locus_tag="pnf11070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1070"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60632"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60632.1"
FT                   /translation="MSAMIIDQVRTYYSTYLPQTTASLDDPEEFFQELSDQISQRVEQI
FT                   TAQLETNAIVPGQDYLERVGTLNTLRAQALESALAELLYSTPPEVDEDPEPSQTERDLL
FT                   VMQQEERAVDQRLEMAPGSPEAIEWDRRYPHLVEEVTWMLTDHGELTVEQKREQLAQIM
FT                   HRQDEARARLRP"
FT   CDS             128519..134980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1080"
FT                   /old_locus_tag="pnf11080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1080"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60633"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60633.1"
FT                   /translation="MFTPVELATLRCKVEDEAYSYGGYNRPLEIFNPGTAPRYLTEGPL
FT                   KSLSVGERFGPTWLLVESYLRAHPDLYDETPSSVEARQAHRSAAAKSLTTEAAEHFRAG
FT                   RLARARELVDQAELANPYETGTYDGIRSRIDRLAGIVDELGLSRPQERFDGLPGGKQAQ
FT                   VSVGDHSFSLEPRGGGRWVVYPKTGGAEDQSTLAEPMPTSEVMPRIRAYLASLPDPQNP
FT                   TPAAHAPSAATTAAAQRDPGNPTTPGDAPAEPLPIVIEHTAEDTLVRNTDKNNLQLRQA
FT                   LHDAKFNWSRPQRFWYQRRATDFAVRTRRVGYLRASLTRLGLPFTETNPAREESTTLTA
FT                   AGVAEAAAPESAHEQQTTAETQHDSTAESAAAAEVSPTASGTPTPPLSSPDVTGNTTTA
FT                   TPTSQTESPADRPAGTAEVRVPERPTAPQVDVPRSTQRRIEANLAAARTLQLVEAESRP
FT                   PTAAEREVLAKWTSWGAAPQIFDAEREEFRSDAESLRALIGEEGWKQANRTVLNAHYTD
FT                   PMIVRAMWDHLRALGFTGGQVLEPGCGAGAFIGHAPEAASMTGIELDSTTARIAQVLYP
FT                   HASIRVESFADTRLPEGHFDAAIGNVPFSSARLHDPVHNAGEHTMHNHFILKSLALTKP
FT                   GGVVAVVTSSFTMDNKNPAARREIAAQADFLGAIRLPNGTHRRVAGTDVLTDILILRRR
FT                   DGEARRLGGPFELAVTAELPLTRGQGETESVLVNEYFLNNPEMVLGELRAGTSVYGGLS
FT                   VEVLDRGDLEQHLRAALARIAERALSEGIAHQPRELASGERRAAAAAPGDPNEFPGHLR
FT                   TTASGFEVLHTDGTYSELKVPSTQADELRALLDLRDTAVALLENEAASAEDSDEIEALR
FT                   TRLNQRYDRYVERYGAINRCSWHPTGRVDDAGEPVMSVRRPPVMRVFRDDPHAPVVLAL
FT                   EDYDATTDSAVKMAIMRQRVVAPRSPRLGADTAEDAVAICLDTHGKIDLPVIAGLLGVD
FT                   DDEARVQCRGLIYPDPADNGRYVPAAEYLSGNVRVKLDQAREAAAANPETYSDNVTALT
FT                   AVIPPDLGPAEIDARLGAVWIEAPDVQAFLNEILNDDTITVEHTKAGEWKVTGGRRGIL
FT                   STQEFGTSRVPAPKLAQALLRQAPIRVYDPDESGEARIPNPTETEAANEKAEQLNERFS
FT                   EWVWENPVRAARLSEEYNRRFNNLVLRNYEADGKMLTLPGLSKVYTPRPHQRAAVARMI
FT                   AEPNVGLFHAVGAGKTLEMAMGVMELKRLGLVNKPAIMVPNSMLDQFAREFLQAYPQAR
FT                   ILAAGTEDLAGEKRRQFVARAATGDWDAIILTRGSFQRLEVSRETAHWYFDREIEPRRQ
FT                   YLAELMSGSAKRSVVKRIEDAILKSEEKLKKKLGGPTDPGITFEQTGIDYIVVDELHDF
FT                   KNLATDTQIESAAIAGSQRAQKLHMVVEYLRDKHNGRAITGATATPLANSITEAYVVQR
FT                   YLRPDLLEGAGIRNFDEWAATFGKTKTELEMSVDGNSWNLKTRLVGFRNVPELQRMFHV
FT                   AADVKLPEDLNLPVPKLARRADGQRAPEVISVPATETQLEYVRELGHRAQMVKSRAVDP
FT                   TRDNMLKISSDGRAAALDLRLVKSLGLTPGTAEEQGSPTLTTAEGAAIAGYLHSKSPSP
FT                   STARYVALFAQRGRHESQRQESQEIGEEEFGLKLEAAADWMFEKWQAAKDQVYLGRDGQ
FT                   PHPRRGGLVVAFCDLGTPGEDWNAYDELKAKLIARGAPPELFAYIHDAKNDKGKAALFT
FT                   KARNGSIQFLFGSTSKMGVGVNIQDRMVAMLHVDCPWRPADIEQRDGRGIRQGNQNEEI
FT                   AVGRVVTEGTFDARMWAAQARKAAMVNQFMKGSLTVREIDDIGDAALNANEALAIASGN
FT                   PLVLEKAEIDIEVTKLERLRRAHQRSQSMLQIRIRDANDAIPKLEAEIDAYTRAIEHRR
FT                   PTKGDAFAAKVSGRFYDHRGDAGDALAARLLKLIEDPRAVWKEFEDHGVAEIAGFTLDA
FT                   RNVPTGRAALVSVVFSDIGDDVYVTLDKATLQKGGTAVMLRLENAVNGLDKRLEVATGR
FT                   LETERTERERSELRLGKPFEHSERLDALRERQKEINKELLGSKETETENASTDPAAAPG
FT                   EAESIRSAAMHDAAAMVHQMGGAAVVSGANGITIISDRGGRAR"
FT   CDS             complement(135068..135988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1090"
FT                   /old_locus_tag="pnf11090"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1090"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60634"
FT                   /db_xref="GOA:Q5YMF7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60634.1"
FT                   /translation="MNEPSNPAASHRESKEREPDMTKTPSTPPSWPMRPGYREDLFRGA
FT                   AEYYSRYRPAYPQPLLDDLINRVGEGGVLVDLACGTGEIAIPLHTRFGHVYAVDLEPDM
FT                   IEVGRAKAEQAGAINISWSTGKAEDLVIDEPAAQLVTIGNAFHRLDRPLIAERVRQWLA
FT                   PGGCLAILGSSTPWSGTEPWQAVAVDVVARWSGEPGRPASAAPAPAESNTPARRTHEDV
FT                   LREAGYVDVAEHQFPTPHTWTMDEFLGFLWSTSYTARIRQDPTLAERFETDLRAQLLEC
FT                   EPSGQLRESIAHYYILGRNPEPALK"
FT   CDS             complement(135991..137124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1100"
FT                   /old_locus_tag="pnf11100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1100"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60635"
FT                   /db_xref="GOA:Q5YMF6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60635.1"
FT                   /translation="MRTMYTVPDLRQLHLEVSTRCNAECPMCARNLFGATAPGLTETSM
FT                   TLDQFRACLPEHVLAQLEIVDICGAYGDPAIAPELLDICHHIHTINPSTTIRIYSNGGL
FT                   RTPTWWARLAEIPGITTIFAIDGLATNSVYRRKVDIDKVLANAAAFIDAGGRAQWDYIA
FT                   FAHNEHEIDSARARAAELGFAEFSVKKTARFLRPLYEPAPELRPGDGIDAAPIYDRTGA
FT                   VVGELRPPADERLVNEVVLWARSIEARAEYFDAFFDTCTIQCQALDSSAIFVSATGHVY
FT                   PCCWLYVQATLPQLYRGQAATDAQVHDLLTASGGANTLDAAEHPLDEILASEFFTAVER
FT                   SWSTDTIAGGKLKVCSRVCGEGFSAYRRQFDRPDLVP"
FT   CDS             complement(137132..138091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1110"
FT                   /old_locus_tag="pnf11110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1110"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60636"
FT                   /db_xref="GOA:Q5YMF5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60636.1"
FT                   /translation="MTRIPLRITPADTADTGRVVVEWIMSSVCNYACHYCPIYLHDNRV
FT                   RWPDYNSVHRFTRTVAEHYRGRDITFLLSGGEITLWPQLPRMAADLRALGIDVAVLSNG
FT                   TRPQPWWATHAPAFDHVLLSYHHERAEPGHFRAVVDTIAATTSVDVNVVIDPAAFDTTM
FT                   NLAAAVQADGKAPVHRKIMFLDGWARRADYSPDQHAALTAALATEVDQPGSRESALLKG
FT                   DLDVEYLDGTHQVLTPSQIIDTGANTWPGWTCNVGAESLFIRFDEIWPASCREGGRIGT
FT                   IFDNNLALPTAGITCTARSCNCIAGIKATKSDPTAVHP"
FT   CDS             complement(138088..138906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1120"
FT                   /old_locus_tag="pnf11120"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1120"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60637"
FT                   /db_xref="GOA:Q5YMF4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60637.1"
FT                   /translation="MTYDPHGLFTGAAPFYARHRPGYPAALFTTVSERFDLDGTQQVLD
FT                   LGCGTGQIALRLAPLVAHVHAVDPDTQMLHEGAKLATAAGIDNISWREGDSYHLDALDL
FT                   PALDLVTMGASFHWTDRASLLADLDHRLTAAGAVVLASGGPPATATAPPWNDIVTEVRT
FT                   AHLGAARRAGTSTYTHPRLTHTEVLATSAFSDIDVTTWHWDLDRDIDSVIGLQFSFSYS
FT                   APGQFSDESARAAFADDLRAALVEKFGADAVLTEHLTTELIIATRPNGGS"
FT   CDS             complement(138907..141036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1130"
FT                   /old_locus_tag="pnf11130"
FT                   /product="putative phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1130"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60638"
FT                   /db_xref="GOA:Q5YMF3"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60638.1"
FT                   /translation="MTTDWTTQVAAAAASVTAAEVDTARRALDYLCLAQLYLRDNVTLS
FT                   TPLQPGHVKPAPAGHWGVCPPVNAVLAALGPYRRMPGTDVRVVHGGGHAGPSALAHAWI
FT                   TGALDTGEDAFGHTEVDLARLCAQFPRTRFGGEITPLIPGHDHLGGQLGPALAIAHGMG
FT                   LDAPDRLVVAVIGDGECETGATAAAWLGARALIGTGTHGRVLPVILANGLRMGSASLLA
FT                   ALDPCDLARHLGGLGYEVITAGPSTDEITAAVARALTGLRPLQYGPSTVVVVTVDKGHG
FT                   VPKTVAGQQIAQTPRVHKVPLRNPRDDNAEFVALERWLSGYRPQELFTGGAPTATVRRA
FT                   LAPAATGRVELHAPRGCIAAASAVADRVAGADFGAAITATLRELNTVYGLRVFSPDELA
FT                   SNRIELGAPDSGWTIEVLNEELCHAWAQGYQATGRRGVVVGYEAFAPITASLLAQQLLA
FT                   HRLAAAAGRPPGPSLVYLLTSLGWHNTITHANPGLIDIAIGTADPSVHIYLPADATRTA
FT                   AALTFAVRKLGRASLVVASKHPMPAHPHTTIDAELRDGYAVWPHIADDLDPEMVLVSIG
FT                   DIAARELTRAATTITATRTATRLRYLHIHDLTSLGAPGRRDAAISAADFERLFPPGAAV
FT                   LIATTCHPAAVHALLGERGAPRTVVVRGWANPPLPMSHDELLDHTGIAATALHEAALAL
FT                   LDSTTCDPLIRQGAR"
FT   CDS             complement(141033..141500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1140"
FT                   /old_locus_tag="pnf11140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1140"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60639"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60639.1"
FT                   /translation="MLPELPAIPVSTEGTLRRLHGRTVLVLDFAAPRGPHRGRRYRVEH
FT                   HHGTGGCSRVVFNIDGRAALRPPPWAAQQTSGAVALRLRPLPDRRHHRIPADLQQALTA
FT                   ADLGLDHITEPELIQILEMIVEAGNDQLRADRITVAVAAIAQAGADRKARR"
FT   CDS             complement(141490..142116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1150"
FT                   /old_locus_tag="pnf11150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1150"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60640"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60640.1"
FT                   /translation="MTNILDELPCRAEWLTGARCDPITGLVAFPDLYPHAITDALARVV
FT                   AERTLLGLAIGDVDDLKSHVEHSNATDPDSFGHLAGNALMTQLGSVCRTWFADTAFPAG
FT                   CVSTFGGDEVIVAATGVTDAGFTASVTDLRDRCRAALPCSVSFATTVVGPGLVWPSTDP
FT                   AVRAKFLLAAVDRALFAAKAARRNTGGPAGALVTVDLARVMADAA"
FT   CDS             complement(142097..142774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1160"
FT                   /old_locus_tag="pnf11160"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1160"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60641"
FT                   /db_xref="GOA:Q5YMF0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60641.1"
FT                   /translation="MPQREIRAICFDIGGVLVQMPRGVLAAELAEVLDADVEHVRDMLI
FT                   EHAKTRRTPPGELAAILATACGRPHTADAVADRLRLRVADMADPPLYPDAIPTLEQLAG
FT                   LGFRICLLSNAIGPDPDTQPARPPYFAHAEVVLHSWQIGACKPQPAAFRAIEAAMDLAP
FT                   QQLLNVGDSARFDIDGALAAGWSAIHLVRNSATPAHPDVARIGALTDLAPLLKGPVRDQ
FT                   YSR"
FT   CDS             complement(142761..143897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1170"
FT                   /old_locus_tag="pnf11170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1170"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60642"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60642.1"
FT                   /translation="MTARTITDVITRPLPPLPLTAAASAEVLPDWAQPARRHPAAQPWP
FT                   ENLTRMAVGVVDSTGATGWFGPVSATVARMVFDQVAPAVIGRELAAWRAMASLAPHGRH
FT                   RQGAHLRLAVSAVELAAWDLRSHATGVPVGALLAGERRERIPVYATALGIDIDHPLAPD
FT                   IAAWLVDEGFWAQKWGLPGAARGETPRADAARLRRLREAAGERARIGVDVGGRWPADYA
FT                   RQMLPVLAEAGVCWVEEPGPISDADLARHGLARAAGEHDYEPTDQLRTLGGDIQIWQPD
FT                   PTWCGGLAHTLSMVELAARLNIRSLPHGSGLAAALALAASAPAAAVPAIEYHLTLEPLR
FT                   QDHQLDPLVPAAGHLDARTAAGLTSGYRFGEGDAGAAA"
FT   CDS             complement(143900..144964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1180"
FT                   /old_locus_tag="pnf11180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1180"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60643"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60643.1"
FT                   /translation="MLETRADAERLAIRWGIDADDIMLIALNACGLDADIGVSRLRFRL
FT                   RLNSRPDDQLYMILSLGRRRSPFKLVDTKVLLGGEQVAVIDVAEADDAVLGYWRNEGRV
FT                   LTLNSNARSACTGCVFCPNTLEEANDPRLALDDLNAYFSTLVDDRLGTGLSSVEKVTVC
FT                   TGCFRFEQLALTHLRQVREAMTTHQCGGEIHFLSSVLTTPAGLAEAAAIGPFHLTLTAE
FT                   AFTKRDLILKESKAALTPTEMVRVLGDAVAAGIRTDFTYIIGLDPLDVAARHLADFVEV
FT                   TTTFPRFQVYQSHTPMMDVFLADGARDIEFYLAARREIEELFGPTGLRPQPWENYRPLW
FT                   YFSFADEPLTGTRI"
FT   CDS             complement(144971..145543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1190"
FT                   /old_locus_tag="pnf11190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1190"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60644.1"
FT                   /translation="MDNPQADRYRVRTSQPVHRFPSGPQGSRWVGGEPVRTPPITQEHR
FT                   YRLPARDRLLIALCRGLDDTDPICSWARELVQLHGARRESSARAAECDCRRTELTARIN
FT                   DLTNTVEPLLAITYPQTIGVLIDRMAVAAEQAMHQLAASGARSERMHQAWTQLAELELE
FT                   YSDLVSDLFYVDNLCPPHPSTDTGHKR"
FT   CDS             145604..146359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1200"
FT                   /old_locus_tag="pnf11200"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1200"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60645"
FT                   /db_xref="GOA:Q5YME6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60645.1"
FT                   /translation="MPKQPEYLSIAATLRAEVLAGSYDAEPLPGNADLAERFDVNMKTA
FT                   GRAVQQLVAEGLVIARPGMRAIATPPELRGTRWPMNGRYARARAARGLIFAGDVNGNVR
FT                   KDTVSREWVSAPLPIAHLLGVKEGARVFRRHSRTFIDDVATENTMMFFPEEIVAAAPDL
FT                   ETAERIQVVALIEDAGHTVTRTANEIRARHTNPAEQELFGIDANSIVIEHIHGTYGATD
FT                   EPLEAVINVRPAHGGAITFDTYEAPLDNE"
FT   CDS             146372..147070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1210"
FT                   /old_locus_tag="pnf11210"
FT                   /product="putative orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1210"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60646"
FT                   /db_xref="GOA:Q5YME5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60646.1"
FT                   /translation="MPTTTTVRGRLAIALDTSDLDTAVSIAKAVQPDIGVAKVGLQLFS
FT                   AAGRDAVRAMQDLGMDVFLDVKLHDIPNTVYGASTVLGALGVQYLTVHAGGGTAMLEAA
FT                   VRGLGEGASSAGFAAPTVLAVTVLTSAPDASPELLNERLAAAVAADCGGVVCAASDLPV
FT                   IRAAAPDILTVVPGIRPAGGEVHDQQRVATPADAIRSGASILVLGRAITAAPDPAEAAR
FT                   AITEEVAQAL"
FT   CDS             complement(147185..147535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1220"
FT                   /old_locus_tag="pnf11220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1220"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60647"
FT                   /db_xref="GOA:Q5YME4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60647.1"
FT                   /translation="MNEPPERVSSERHLAAANGPLVPSALSIEQRRERLDERIAWLRDR
FT                   TNCTVHLRGDLRAVVVLWGPRPAHGLHAALSVATAGLWAPMWLAITWQRRPLRLQLEVD
FT                   DAGVVRATPIKR"
FT   CDS             complement(147813..148013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1230"
FT                   /old_locus_tag="pnf11230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1230"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60648.1"
FT                   /translation="MRCNEPCPTISSSSMPVVGCWSMARTRLSRPPQNSVSCTRLVSRR
FT                   GDPTESRRTGCVWPGVLTSWW"
FT   CDS             complement(148014..148250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1240"
FT                   /old_locus_tag="pnf11240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1240"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60649"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60649.1"
FT                   /translation="MEWAEAPPSLRPGYLDPRSLKHTVSNIADCLTDPGPIPRGVAVRA
FT                   RRMHESCSSQCRVKGRVAEVLAAPADSVEDDFE"
FT   CDS             complement(148299..148634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1250"
FT                   /old_locus_tag="pnf11250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1250"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60650"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60650.1"
FT                   /translation="MRAIAIVRQDVAARDGQGGVESVRALARRMRLDLPARDTHVTTDL
FT                   TVLLAHVNSTQADVVVVPSEQHLRGWMDTVRRIAAVWTVDPPLCWPKDGGRPHSLTRPD
FT                   RHLEVSR"
FT   CDS             complement(148631..149461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1260"
FT                   /old_locus_tag="pnf11260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1260"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60651"
FT                   /db_xref="GOA:Q5YME0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YME0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60651.1"
FT                   /translation="MDRKPSLMYGYLRQELVGERVQEVEDAMREFAAREGFDLAVVHRE
FT                   CGAATGALWMLLRDVSQAWSRHIITPTPTHLKGGENDDRLTLLGQLQRLRPLRVWYLDP
FT                   DDAAALVRTVRRNRDIPSPRASAPTPPRTPIGQFELRLNLATRGLAQIQTHELLTRAGL
FT                   RHLSEPVEQIVLAVLAEAMTAAEPGIYARLAAGFPDLAPSNQITVWLLRRESTLEVQVH
FT                   ETASRADELMSDPITAFAEHGRVQPETGGTLTWARIPLAATPSVSYSSLRSAVS"
FT   CDS             complement(149466..150545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1270"
FT                   /old_locus_tag="pnf11270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1270"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60652"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60652.1"
FT                   /translation="MAAAASHDPVALRDSPLIVSTDIGGDPDDAIALALAAMTEPRLAL
FT                   VVTADEFPDGRRSMLARHLLDLLGREDVVVAAGATAGERKYWAADGLVPAGAHPWPLDL
FT                   HTAVASLTDPDSSAPLRWLGIGPLTDLARLLETDSGRRTPLGLARRLRIWQMGGALEYR
FT                   QPDRAEHNFRLDPKAVHTVVGRAENLTLVLSDHTFTPVMAVDPDSPVYRLLATSSIPWA
FT                   QVIAHHLDQWFARFHPASMLHDPLTLAALQGAFVSFDHREFRLEPDARMHLGPGRIARL
FT                   SSGVDYLGFLEWVLATLRAGVPARPGRARATTTDPAVRAAAAGSESLGNTVHFAAHRTT
FT                   SGSTSQFGQHDGLPKFRQG"
FT   CDS             complement(150548..151006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1280"
FT                   /old_locus_tag="pnf11280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1280"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60653"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60653.1"
FT                   /translation="MATTLTETAAARCARYITENRFIGAEVDEHQQIILRAGPVDTIQM
FT                   PRPLGERVRAELLRRGLATPTIENRATGFLTFVTQPARMGDPRPVRILSQLFKYQAIRT
FT                   VQGSLVTLPGPDDERRHWVEEPIGEERPDFDTVVSIVLDAAKNLSQAS"
FT   CDS             complement(150991..151236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1290"
FT                   /old_locus_tag="pnf11290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1290"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60654"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60654.1"
FT                   /translation="MARAVDSRLSNKGSPRPAEPDVHLRFVWADRVFDYRGCRSAVKNF
FT                   LRKWSQGHNPAITAVELFDGFLPDHRMPCEELWLLP"
FT   CDS             complement(151251..151607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1300"
FT                   /old_locus_tag="pnf11300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1300"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60655"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60655.1"
FT                   /translation="MAVQLVAGRRMSSDITTISAISVGNDQWVVEQLRGRTLTLGQALA
FT                   AIRLAEVLPQPRPASDDDPLWADVTDWLDELGLGHAPLTVAGVLGVPCHLAPLPERRGQ
FT                   QLTHRRRFPRWLVR"
FT   CDS             151988..152857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1310"
FT                   /old_locus_tag="pnf11310"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1310"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60656"
FT                   /db_xref="GOA:Q5YMD5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60656.1"
FT                   /translation="MSPYSRRLHLGDRLRNLRQEQERSIQQVAKEADIDRTLLTRIETG
FT                   QRRVAADVSMKVAEHLGVEQHSPLWQEFYALARDAAQSGWWEGRAFRGLSDRQALPADL
FT                   EAGASRIRWYDFALVPGLLQSPAYVRARHDATVTNDHSSDNPVEIRARERRQQEALTEG
FT                   GPRIEVIVEETVVRRRVVPAPAMLEQLEHLLKLIDANEQIDFRILPVGGELLGLRAPRS
FT                   PVSIYEFAAGDPPLVFVESLTDDVLLRDHAEVANHERLWKRLHEIALPPDESRVLIARS
FT                   AEILAKEQ"
FT   CDS             152854..153264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1320"
FT                   /old_locus_tag="pnf11320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1320"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60657"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60657.1"
FT                   /translation="MKQVRNTIMTGHRPLDGYVKASASDGGGNCVLVRRKSGEELIFIR
FT                   DSKYGRDPRNRPEDEPVVEMPASAWEGLRAAALGDATSPAVPGQPVLEETVDGGMALQG
FT                   ADGTRLTFTAAEWSAFKAGLVAGEFEPRQVAA"
FT   CDS             complement(153375..153737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1330"
FT                   /old_locus_tag="pnf11330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1330"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60658"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60658.1"
FT                   /translation="MFDEARYQPCRWVDPPIDVTVRVADIWPPARLRWGGATPLWQKAM
FT                   GLRVEDDVPGRLEELVVTSVGDLLGRVRFAPLLGDQRTAENMLLPPSTWQPIAADDVRR
FT                   LQTLVVEFGFEPGHLL"
FT   CDS             complement(153772..154794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1340"
FT                   /old_locus_tag="pnf11340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1340"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60659.1"
FT                   /translation="MSVFDQYTDKAEASPVLGWLVLYSIFRGEVTPDELAKWFDEFDLD
FT                   TVHLPPPLRADDAFERVTGPQGVKAVYSLDDPTADRKTRPRRKSGDDAGDRVATLMVRH
FT                   VRRDSGQLVRHLVREVRDEERTELSYDTRLGVIAFIRSDDPDAAGAGKLRVEPDAAAIA
FT                   DLPQGEQDRVEQLLAEVTDLHTWHSTYMGPDRLRAVVRRYVEALGGLKVRPTGGVYFVT
FT                   AEHESTLAGLREVVARFGSGSHFVRVPLPDEDEMREMIVNAFTNQAREDLEKLAEDIAA
FT                   AKANGAGDAALTNLHNRFQQLSRRAEEYSERLSDSLDDTHASLRLVNMQLAELMIRAAG
FT                   "
FT   CDS             complement(154881..156524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1350"
FT                   /old_locus_tag="pnf11350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1350"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60660"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60660.1"
FT                   /translation="MDSMSGKTLRKFADLARKAGRWVGLGSTAPERHATVVEGDRFDAM
FT                   TWTEVREQATALAEVEEELSRRFDYVPDLLRDVFLTVYKAEPTLREQAEMEPTRLPNHA
FT                   IVTALIGTPEYADLHRETVGDEYAAAMAVIAQRSTLAQMLEQSQDAQQTAEQSAAAEQE
FT                   AAEHATAVESALDAAAEQVDEDGAVPGQAAAAVDNAVAAAQAADDAAQQARAQAEAAAG
FT                   ALGATLRADARQAMASAAEQAREEAALMAAWGLGPGQLQRMSFDERARLAERLRGGRLG
FT                   KFTDLVGRFRRLATAERTRKLEHVAGELVGITLGDDLTRLIPSETANLAHPALRAVFAA
FT                   RFAEKQLMLYETMGEDHSGRGAIIACLDCSYSMCAPHTGPDGRIASAEAWAKACGLALL
FT                   DQARAEGRDFVGILFSSAEQVSVHRFPAGEAPLDRVLDFAESFFSGGTDFQTPLGIAVD
FT                   ILAEHHGDQAVQGGDIVLITDGDAEVTEEWMRTWKSAKSELDFRLFGVAITDPRRPAGR
FT                   SAVLEALCDNLRTLDDLADPHPAADLFRVI"
FT   CDS             complement(156535..157752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1360"
FT                   /old_locus_tag="pnf11360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1360"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60661"
FT                   /db_xref="GOA:Q5YMD0"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60661.1"
FT                   /translation="MSGKQQVEHDSSDTARKLRAVTDELSDLFYERSEVVRAVVAAILA
FT                   GKHSLILGPPGTAKSELARELTGRIVDAQLWEILLSKFTDPKKMFGPVDVAALTQGRYT
FT                   QLFEGRATTCHIAFMDEIFKCSVGALNETLAFLNERLYHPESGGAPISCPLISAITASN
FT                   ELPSGEESAAIYDRLLVRLEVGYLADPSNFAALIRSAVQSPAAATAPTTVTLAALQQAV
FT                   TIDVPAVAVPDGVVDTVCQLRTSLRRQSLVASDRRWKQAIRLLQASAFLDGRAEVDDND
FT                   LPMLAHVLWDSVAERPTVEREVLALVNPDAREAMDLSDAIAEMAAQLDAKAGQSRETLS
FT                   QWAIKEANHKLGKAGKRLEELRHNARSAGRSTATVDAALARHKAVYARVMTEALGVDVS
FT                   TLTGSN"
FT   CDS             complement(157797..158240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1370"
FT                   /old_locus_tag="pnf11370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1370"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60662"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60662.1"
FT                   /translation="MGGTTPLGLPPRRRRPPHGGKARGIRTPPQTGCHPRLPSVSFYDA
FT                   ALPRVQRGASCEDSSVRGRPRVRGSGQCSPSIASAVSGSARSQRTQARRYSVNPRPRAW
FT                   RSFFASSYSSFSGRQVRWGALCGSLGVIAPSSLSGYPFVQPLC"
FT   CDS             complement(158280..158927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1380"
FT                   /old_locus_tag="pnf11380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1380"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60663"
FT                   /db_xref="InterPro:IPR032584"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60663.1"
FT                   /translation="MSTESPDERLEELRNQVASLSEALVEMRNQHRLLSTKVERVDATA
FT                   ARSSQGLDEFETALGVLADRLASAAPGEAPAAAAPSGAGDGGAAPAAISAGADLDQIDM
FT                   DVLLEWVIANIGEWAQRKLPRSTTSSANGAICWCSEWYEHPEAVTVLWSLRRSWLEAVV
FT                   QPGTAMAVYFRDFFYPLLRNLTDPAGPFYACTPDRHDPEAKFVPVVPASFRP"
FT   CDS             complement(158924..160651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1390"
FT                   /old_locus_tag="pnf11390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1390"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60664"
FT                   /db_xref="GOA:Q5YMC7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60664.1"
FT                   /translation="MMGDSALAWVWISVLVVGGICYGVYRIHEQGTSWLVIGLVGALLC
FT                   LLLAALAWVVWKAWPTETPETLLRDRKQIPDMLGKKAAERGVGLRASIESAKGVSMREL
FT                   APLIGRLKGKSVYASYEDFTIVMMGPRSNKTSAVAVPRILSAPGAVIATSNKPDLWILT
FT                   GALRKDVGPVYVFDPSQIAYAAQTWWWNILSGITTLRDAKKVAEHFIEENRGGGSGQNE
FT                   DPFFAPTGKNLLSWALLAASLSGRTMRDVLDWIDTYSDKPIDILHQHGNRRAANAFAAV
FT                   LDLPAETRGGVFGEAQTALASIQDEETLRWITPPNTWEQPTTEKITELDLWSLFAYEDG
FT                   KAPTLYLMTQEGSGSAGAVIAAMVAKIFELGDLAASAHGGRVDPPLTLVLDECANICKI
FT                   KRLPNLASHLGSKSMCVTAIFQSEAQVISTWGADDAAALWGASTVRILGAGLQDEPFLR
FT                   KISGLVGQYKPRERRRSHGPGGVTTSNDRGSLEPIMPVEEIAAMKKRNALLIRQESRPV
FT                   LIDLIPWYTEPDKGDVERVRDEATKEVQNAAIEHLGPANPVAKALRRRLDEQAKASAA"
FT   CDS             complement(160648..161388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1400"
FT                   /old_locus_tag="pnf11400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1400"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60665"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60665.1"
FT                   /translation="MMRDVISAQDWDHDPVGATSAMVITVTDHVAALPRRWWGKALVWN
FT                   PELPGPATTFSWDLLARITDAADADRIAENLFSVVRDEAALYFVPEATLLTANLLLAAV
FT                   RGRRSLTDVLDWIHSGDLSEPYQLLHANEESGPTADLDTFGETPAGEQAAIWAVVRQAM
FT                   LPLDHSMILAALSAQTGALPGVGPLPVLEAAALTARREVFVVEVPGTRSAGAAAALRAE
FT                   LLLAAQEAGLVVRVVSVGPLRRGA"
FT   CDS             complement(161411..163036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1410"
FT                   /old_locus_tag="pnf11410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1410"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60666"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60666.1"
FT                   /translation="MTTELITEAESAARQRAGAQAGLAERWLAKLGVTPAYRKQEQTDE
FT                   NEPGQAPFNPFLPFESLPPIPNARGENRPFGGYAHNVDAGRLYAGTTTQVQGLYPFPAA
FT                   SGARVRGVPFGRHLHTAEPIGLDPSQWLVDGLVTNTGLWVQGQPGIGKSTCCKRLMVGL
FT                   VAYGFAAVIPGDIKDEYSPIVEALEGKVFRIGRGLHSLNPLDLGPLRGAIRAAVGSHRE
FT                   QLVSQARGRRLDLLESLITIVGGQDLTATERLLLAMAVDQADDASARHHLPDPTIPELV
FT                   HILDEAGPPLQRVVAARDEYEYRREIRELRNTLVLLCEGPIKGMFDRSSSFSIDADLPA
FT                   VSLSLKAVEDDGDDVVAAAMMCAWAWSAGLIEGKQAAGERRNVFQPQDELWRALRAAPG
FT                   LVEKSDRMTRLNRARGVVSAQSTHSITDLEALPTEADRAKAKGMVARNAIKVIGGLDNA
FT                   EMERLHAISPFTSGEKELVTRWSAPPTWVPGQRHPGRGKYLIKSGSRMGLPVHVDLTPE
FT                   ELELYNTDGAFAGLNPDGRRSHAA"
FT   CDS             complement(163033..164532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1420"
FT                   /old_locus_tag="pnf11420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1420"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60667"
FT                   /db_xref="GOA:Q5YMC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60667.1"
FT                   /translation="MSETRGYGGYREVTGFGLGRLGTSGTAIILATVVGLAFTTFVSLV
FT                   LAFMGLLIAIPVLALTIVPVGDSRRTVVQHVAWNVRNAWANRRASDAHAADVLEEVSRG
FT                   ENLPGVLAPLKPLTVEDGRGGSQCLLWNRRTGILSAVLKVSPVGTTLADTADTEAWVRN
FT                   YGSWLADLGFTPIISSVVFTCESSPTGGVDQRAYTLARMERDGRNAPKLAKTIMKKVVN
FT                   QSRTTTADVQMRVTVNFDLSKASPQPKTLSEGAAEVVRWLPRIESALAAAGATVTERAS
FT                   TASVIRNIRAAFDPAIRVFLSDAPDEEADELLSWSDAGPLRTESTKDVYYHDSGYSVTW
FT                   VFKAPPSGVVRHHILLKLVSPGKYYRRFSLVYRPYTAAQAAEIVEREIQAGTLRRIWNA
FT                   KTKKDETQREYDDRVRARKAAQEESMGAGLGQFTMYITTTVRNEETLAAACADIEDRVS
FT                   ASKLQFRRARGAQAAAFATSLGYGIEPTAGLSRSAAQRWLA"
FT   CDS             complement(164609..166336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1430"
FT                   /old_locus_tag="pnf11430"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1430"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60668"
FT                   /db_xref="GOA:Q5YMC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60668.1"
FT                   /translation="MTVPGARAGARAVLRPMVFLGVLLAALVAGPGIVAAQPSANMPQK
FT                   LSELTAEQKSWRDADGVIWCSEHPEFPGCEGNPDTGYLYPNDDTLYRAQINNGARERTF
FT                   DLSPGTVAENIVGKAVDSAFGKAAESIGRFAGDLLVESMTWWIGTDSISLSYAGVMADK
FT                   QPVQKVVFFIMMAGILTSAMVMMISRRTEPGAQVLLGGVKYVVISSMALIVLSGAIHAG
FT                   DDFARQMIDTDANQFGQRVQAMLGTATIGNPGGVLILGLVGAILGFIQWVMGFIRQAGI
FT                   IVLYNMILFAAAGQLTTWGRQWFPRIAATCVALVLYKPMAAFIYSLGFQLIGEEQSLTT
FT                   LVTGLMVVALAVIALPAMLKFFDFMGMHVSGGSGALGVAVGGLAGGMLGAAALSGGGGG
FT                   GGGTSAGTSAGGDGFANFMSATGPGGSGEPDPSPGNGGSQALTSGSAQSQLESGASQKA
FT                   IGSGSSGVELEAGSGGPQPEHPDAAGTPATPSDAGGSGVDIAGAAGGGAAGPAAGGGAA
FT                   AAGAAGGGSAAAGAAGAAATGGATLAIQAGMSAANSAVEAADDVGSEMTGDDLGPEMR"
FT   CDS             complement(166351..167022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1440"
FT                   /old_locus_tag="pnf11440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1440"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60669"
FT                   /db_xref="GOA:Q5YMC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60669.1"
FT                   /translation="MFTTREFAERPASQGPRPSRRWLLVAAAAVLVVAVGIVLVAVVRD
FT                   RSDNSATPAEPGAVATATPPRDLEWKLINGVRLPFGPDGPAEVDGPRAHGYSHTPQGAL
FT                   IAAWQISTRVLTDTRYEQLLGTQVRADLGQQQQVRNAVTQTRNLSPEEFDAAFRQPVAF
FT                   QFATYTPTFARIYFAVPSNKGGYDFQRRAVLWDGNDWVYQVDSGLPELPNSTGLKGFTT
FT                   F"
FT   CDS             complement(167039..167797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1450"
FT                   /old_locus_tag="pnf11450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1450"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60670"
FT                   /db_xref="GOA:Q5YMC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60670.1"
FT                   /translation="MPLTTREFREKTPLAGVRRPYLIGAAAAAALVLVTGIALIGPDSG
FT                   SGGQDLATGPGTSSSAAAAPTTPAKGSLVPQVPVSRSPADPDWLTAAPQGVSWQRVEGV
FT                   PLPFSASDGPSRIDGAVAAGYSHTPQGAAIAALQISMRILYSPDYARILDAQAAISDGD
FT                   RQQILTARSTQPRLDPVAVQASTVQPAGFKIGAYTGDAATVYYAYPRPSGSYRIARQAV
FT                   VWRDGDWRYSSDLIAPALPETADLTGFTPL"
FT   CDS             complement(167814..168260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1460"
FT                   /old_locus_tag="pnf11460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1460"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60671"
FT                   /db_xref="GOA:Q5YMC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60671.1"
FT                   /translation="MKQAAWAFVLATVLTVAGAGAVHAQPPTTTPAPTPSQQLSPQSPG
FT                   GGGSGEQIPIQDPKTGGVQWDKFGGDPANAPENLDSFIADALGWLRTLALACAVGGVLI
FT                   TAGVLMIGIRGRSEQAKKALHSLPVVLGATVLSGSAYTVIHVFL"
FT   CDS             complement(168257..168544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1470"
FT                   /old_locus_tag="pnf11470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1470"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60672"
FT                   /db_xref="GOA:Q5YMB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60672.1"
FT                   /translation="MSTLLLAADWLAQVPNPPAKELPGELGNRVNDVLGYAKTICYALA
FT                   FGGLLAVAGMLFVGLRGRSDTAKNALGHLPMVILGVVITGGAGGIIQAFQ"
FT   CDS             complement(168570..169100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1480"
FT                   /old_locus_tag="pnf11480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1480"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60673.1"
FT                   /translation="MSAAPRRPVVGGIAGGVGTTTVAHLLDGIDMGVIEANGSQCVDVL
FT                   VTRATAAAVSWAIATAQRMPVRPVLVVVAGSEARWPSVVERRLKMAAANLSTPVLRLPW
FT                   FSPLAASDNPWDLLATGVFDADRKTYRWAEPARKFREELVPAVLALIEREPPTADSSSE
FT                   LRPNDERPVMRVS"
FT   CDS             complement(169097..169753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1490"
FT                   /old_locus_tag="pnf11490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1490"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60674.1"
FT                   /translation="MSRNPETMTPKFSWTASAAVLAGAALVVAGCSSGGSDHEQTTTPP
FT                   ASTTSFVTPTETTSRVPATPPSTPLTAPAALPAEIGPVDQASVDAVAAAVARIWYGWDT
FT                   TRDLTQHDAKLRAVPLLEPRLAQLLRDYPPIAGPGADWLDLTARSAVLTVPADGVRPGV
FT                   EAGAPADTATSAVRLLEVTQKVNTPTGPMPDRHLVVGIALVKVGAEWRVSQVGSR"
FT   CDS             complement(169750..170820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1500"
FT                   /old_locus_tag="pnf11500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1500"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60675"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60675.1"
FT                   /translation="MTAMKSPLKWAALALALLLIPVLIVAVFVDGDKDNPSFAQGKLAT
FT                   GTVPPEYEAWVIRAGTMCEEISAPLIAAQIEQESNWNPNAVSPAGAQGLSQFMPYTWPS
FT                   YGVDANGNGVISPFDPPDAIMAQAKFDCTTVEQAKKDLASGRIKGDLIDIVLNAYNCGY
FT                   GCVLANGGPQIVNGETEGYAPGVKAKMAKYTQIGTGGGRVANCSQFRPGGGFGANVAAA
FT                   ALCWQGTPYAWGGGNIDGPSLGIRDGGVADSHGDYGKVGFDCSGLVVYAVGQASGKTIQ
FT                   LPHYTTSILNDPRGREVALGDIQPGDIVFPGGGDPQHVGIAIGDGKMVEAPQSGDVVKI
FT                   SPLSNLGSGIEIRRFG"
FT   CDS             complement(170976..172295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1510"
FT                   /old_locus_tag="pnf11510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1510"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60676"
FT                   /db_xref="GOA:Q5YMB5"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60676.1"
FT                   /translation="MMSAAMIGGRVAGSLVIAASLTCIAPSVASADPGASPAVTDCADV
FT                   ITLAVPGTWETSAGADRNVVPGMLGQVTGPLLAALNSAPPTLSGSTPATTSAATSAAKS
FT                   ATPRPSATAQKPATASVRAEQVPYVAQVGGPIAGMFTGNPLTLSQSRENGASALNTRAK
FT                   ELAAACPLSKFVILGYSQGALIAGDFLSAVGNRKGAVDPSRILAGALLSDPKRSATAES
FT                   DFAGSTGTSSGSSSTKLSSVSETLIGSNPGGEGVLGEREGGMGVLAERVTTMCAPNDTV
FT                   CSLSGKSKVVAAVVPLLNLTPEDLPDYLIGRGLELVKNVAEADPQVIAQAAKSVITEFT
FT                   KLGVAAATSPQTLPIALAEMVFSSTMLDDVSKVINMPEFDALVSLTKPDELIQQASQAV
FT                   SYLLLDAHRSYAGNYKVNASGDTATQWIVKWLTSKIQAGL"
FT   CDS             complement(172292..173803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1520"
FT                   /old_locus_tag="pnf11520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1520"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60677"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60677.1"
FT                   /translation="MQKLKEGSAMTTLGPAAASACSDKAETPIPYSGSRRVGTPRSAAH
FT                   RRSTGIRTDLIRVAVAPAVATAVLMTACGVAQAAPSGQPGITGPAEPQEQPGVSTAPVL
FT                   PPKPQSQSPLGVILPDPPSHAPSEYETAPPSGGVQVGPYYDTPAPSTPAPQTYYYVEPT
FT                   PQYRAPAPEPSLGEELLTLHAPAPVPEKPKYWVPVGPERIGSKRASIPTPDWVPIDVAW
FT                   KANAYISEAQQATNTALQSVGIAPSRADALAGGTVIGAAAGTCIGATVIGVPAAVFGGI
FT                   AGGLIGGTIGGIAGAAMGTLIPVPVIGTVTSGVAGTAIGAAAGAAAGAAIVGIPAAIAG
FT                   GVAGGAIGGLVGFVLLADDGSEYTGPAPDGEIPMEEREVPPPGPTLADQFSEQAAVAVD
FT                   AGEQAVDWVQEQPGGEQVLEQAAAVVDQVDQWAQSEPTVTQAVGVVEQVAQDVVAAAQA
FT                   APETAAVADAVVEAVTEQPAFTPDQLGPLTDAANGALAAVQGLVR"
FT   CDS             174078..174536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1530"
FT                   /old_locus_tag="pnf11530"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1530"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60678"
FT                   /db_xref="GOA:Q5YMB3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60678.1"
FT                   /translation="MTRRITRGFDPAALKRAREEHPNEDLRRRAEVARLAGVGVATIQQ
FT                   WEAGKKSPQVNLLFRVAAVLGVPMEQLVPIPREQRYLRDWRVLRGMLESDLAARTGISG
FT                   SSIGRLEEGSAALTDENANRLAEALGITATEVRAAYDRARNRAVGAPA"
FT   CDS             174799..175479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1540"
FT                   /old_locus_tag="pnf11540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1540"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60679.1"
FT                   /translation="MPSGHPEFFGEVVKARREYLSLTMAEVRAAGGPAQTTMVRTERGE
FT                   LGKPQKKIFAKFDTALRWVPGSAAAAYWNRETPVPLELEQPAAPPLNLAGSDVEVPLDQ
FT                   VIALMELQRDLNAAAEARRELSADSVQDLATRLNREVSLIVGRWATTMLERNRGTEAVH
FT                   PGLEVIFADALSTPVDPGTPDAEERLYRRWLLGGRSAAGLGEELRQKFERRYRQGGGDL
FT                   DADQ"
FT   CDS             175508..175936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1550"
FT                   /old_locus_tag="pnf11550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1550"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60680.1"
FT                   /translation="MTRLFATFHARSAPEQSVDDVARSVSAMLGRIVPGAEITALRAGE
FT                   YDRDSADPQILAALAKHFGVPPAYLAGADANVVRQVEKELLMLAATRDAGVRSLRLRGK
FT                   KVDIGELANHLKRLAKRRSDSPDEAATRDVPDTSDLGE"
FT   CDS             175956..176492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1560"
FT                   /old_locus_tag="pnf11560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1560"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60681"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60681.1"
FT                   /translation="MTVVRGEGVVNKMTTRFAELSKLVPIPYPWDTREYIARVAEYRGR
FT                   PIELVPIAPGALSGTGCGTGSALWLELDDSDVIMYGADTEWHADHMIAHEIGHILLGHG
FT                   STGGEPAPADDLPLHELMPSLSPDAIRNVLRRQDYDSDRERDAETFADMVMVEATLPQR
FT                   KPSRFRSTFFRARHR"
FT   CDS             176489..177670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1570"
FT                   /old_locus_tag="pnf11570"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1570"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60682"
FT                   /db_xref="GOA:Q5YMA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60682.1"
FT                   /translation="MTSPIPGVIAWPVLLLLTAVILGRYWLLRDGTVDKLINRALVIAL
FT                   FGLLLREAWFEHLLIAILPFDDADVVHFARQISFGCILFTVSYIYGIAQLWAGADPEYT
FT                   WQRQRRYDLVALVSTITILIAGTPARRADQLIDQHMGAGAVIAWVAFYLPIAATALLVA
FT                   RISIRELRGADENTSWRERSVYLGVLAIAIAIGADSVFVPVVTALEVSADRPSADPDME
FT                   AKAWTFFGATVAAGAVVAVPLIGTVLSLSGWDRTSRYCRRLKPLWRDLTAAVPEIVLAL
FT                   PQDRFGRVEPATRLHRMTVEIRDSLLQLKRYGAVDEPGQGADVYARRVAAAIAAKNAGV
FT                   APQISKAPAGRPAFVGARDLTAELQQLLDLAAAWPTAKRQAGRTESPDTALTQ"
FT   CDS             177679..179100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1580"
FT                   /old_locus_tag="pnf11580"
FT                   /product="cytochrome P450 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1580"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60683"
FT                   /db_xref="GOA:Q5YMA8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA8"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAD60683.1"
FT                   /translation="MAVTTSTTSGGHSNPPLPHPKWRLPIINDLLTINPIKPTLTSLRD
FT                   AEQLGGIFERRLVDWPMIVVSDSELITEICDERNWAKHLGVPLRKMRHIARDGLFTARN
FT                   DEPNWAKAHAVLAPAFTKEAMRSYHQTMLTTIGELLDYWAKRDGQWVDVGEDMNKLTLE
FT                   IIARTGFDYTFDSFTRSEVHPFVAAMLRGLTYISRNSNMPPFLQKTIGARAAARHSRDI
FT                   TYVRTVVDDVIKARQASGTVGDHHDLLDRMLTVPDPASDELLDTTNVRSQILTMLVAGH
FT                   ETSAGVLAFALYELSRRPELVAAARAEIETRFADGDLSTIAYDDVAKLRTLRRIVDETL
FT                   RLYPVAPGFFREARHETTIGGGRYRFGPGDWVLVLTLHAHRDPATWGPDAGEFQPDRWL
FT                   PERMRSLDGRQVFKPFGTGLRACIGRQFAYHEIVLALAHILHTFEFTPDPGYELDIAEQ
FT                   ITLKPHRFRLRLNHR"
FT   CDS             complement(179559..180257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1590"
FT                   /old_locus_tag="pnf11590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1590"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60684"
FT                   /db_xref="GOA:Q5YMA7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016584"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60684.1"
FT                   /translation="MNPFLELGGPMASKDAARIAAEPYTPAFLAVYDLWVIKLSDRFAW
FT                   QCPAEVMLDQYNRFIGRKHLEVGPGSGWYLANAELPPESAVTLMDLNPEPLAHTRRRLE
FT                   GRTCEVRTVAASVLDPVPESAGVGFDSIGINFVLHCLPGDFGEKGVAFAHLAQVLADDG
FT                   VLFGSTILNRKPSTLFGRVLTAIYTQVGAFNNAADDRGGLEKALRSAFTEVSLSEVGDV
FT                   TLFTARKPRR"
FT   CDS             181131..182879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PNF1_1600"
FT                   /old_locus_tag="pnf11600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PNF1_1600"
FT                   /db_xref="EnsemblGenomes-Tr:BAD60685"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5YMA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD60685.1"
FT                   /translation="MRELDRVLYSGPYVLIDVDNHSPRRTRSLDRAYAAIDTGEVATAG
FT                   GTLRPGNVGADIDPLPEHAVLGDAVAEVLVGWLHDQGISYIARESGRPGGRHVVGVGAS
FT                   PDQMEEWNRLCADTAQAFGVPVDDRSGGVLRLLAAPHRKGYAAPVLGGTLTLNALAVRT
FT                   RPSRVRSARPARRRPSPSSRPAPTSPDTSRSAREYGQVCAMIRRGCTPAEAWRVQNRPG
FT                   SKASERGEHRWRRFVWLDAHTTVCAEEGLTPEQAWQRVSAASPAVCRKIGRRAWQRLWE
FT                   RAVDQAGVQRPRRRRLPPASDPLNKSTGEDNARIAAVAAGLKAALDATDLGVRRQRRRN
FT                   CEILLLNLAPVLVRREGSISVRDIALRAGIDVKTFRACRDLLIAHGLLVTAHHYAGGAS
FT                   DSHAYAMGPAARPHVEDAVSKISPTCPKDTPLPLPPSGRADRTLLRTRFRRERHQWRTR
FT                   CAALDDLPPGESLASSSSPAMKAYRSLRYQQRWWRNLSCDEQEARRTARRATLETLAPS
FT                   ARSAWFAWLDRRNSLMAVVDRAAAGPFTSTDRSVLAAAPRTVHMGLQDPSWQPGSRGSG
FT                   QLVLAA"
XX
SQ   Sequence 184026 BP; 29964 A; 61276 C; 62304 G; 30482 T; 0 other;
     atggcatacg tcgaggttgt tctgaatcag aagggtggcg ttggcaagtc cacggtcgcc        60
     gtcaacctgg cggccaccac cgcggatgca ctgacaagct ccgagccggg caccatctct       120
     cccgttgcgg cggtcagcat cgacccccag ggctcagcag tctggtgggc agaccgcgtt       180
     gaggacctgc cgtttcatat cgtccaagca cacaacgaca ttgacggact gcgcgctctc       240
     aggaacagca gcagcatcga ccacttctac gtcgataccc ccggctggat cggccaagac       300
     gaagacgatc aagcagctgc cgaccctctc ggcaaggggc ccgcggccga ggcactgcgc       360
     gctgtcctcg aatccgctga ccacgtcatt gtcccgatcg aaccggagcc actcgccttt       420
     gatccgacgg ctcggacaat cgagaaagtc atcaagccgc gggggctgga tttccttgtc       480
     gtagtcaata attgggaccc acgagacggt gtggcggact tggaacagac caaggactac       540
     gtcaaggcca acggttggcc tctcgcgaac accgtgatcc ggcactataa ggtccacgcg       600
     cgtgccgcag ccgagggcat cgtggtgacg gagtacccgc gcaaccgagt cagcatggaa       660
     gcgcgagccg atttcagcaa gctcgctctc gagctcaagg cgggggcacg ctgatggccg       720
     gccggggcgg tcgcgcgaat ctcgccgacc tggtcggttc cactgggaag aactccacgg       780
     tcgatggtgt gaacgcgcgg accagttcgc ccgcgaaggg accgaccccc gaggtgatgg       840
     tcaatggggc gcccttggag atcaagctgg aagatctcgt tgcgaatccg ttgaatccgc       900
     gcgagaccat ggacgtggac gatctcgctt ctatcgtcga gattcagctg caaccggcat       960
     tgatcatcgg cagagaggcg tacttgaagc tctggcccga gctgaagtcg gagctgggtg      1020
     acgccaagta cgtcgtcatc aacggttgcc gacggctgga ggcagccagg aagttcggcc      1080
     ggactaccct tgagtgcgtc cgcaaggatg aagtcgcaga ctcgcgagcg agtctgcggg      1140
     cggcatccat ccgggagaac gtcgagcggg agaacctcga cgtgatcgag gaagcgaagg      1200
     ccgtcgaggc gctggtctcg gattgcgacg gcaacggagc gcgggccgga cagattctcg      1260
     gcaagacgaa gatgtgggtg tctcaacggc gggcgctcct gaagctcacc ccggagcttc      1320
     aggcgaagct ccgggcaggc gaactcgcta tccgcgaagc ccgagaactc ggccgagttc      1380
     ccgccgagga acaggtcgcc cgctggaagg ctcagctgga gaagaaggaa agggagcaag      1440
     cgggcgagac gtcggggtcc aactcctcga ggcgcgatgt cgacaccgtg aagatcgtca      1500
     agacgctcaa gaaatgggac gcggacaccg cggttctcgc ctctgcgctc ttcgtccatc      1560
     tggatcggag tggtgtgcac gagttgatcg agcagctgaa tcagatggct acctcgaacg      1620
     aggctgagta gtcgacctca cttctgtggg ggaagttccg gggccggtag accattggtc      1680
     taccggcccc gtctcaattc acggcgatca gttcgtctgg ccgagcccgg tgtgctccac      1740
     gcggtaaacc acggtttacc cctcgggggc acctgcggtc gctgtcggcg ccgcatgtct      1800
     ctggtcttcc gttgtccgtc gcgcggctcg tggagttgct ggaggaactt cccacacaac      1860
     cacaacgcgg gtaaaccgcg gtttacccgc gttgtcccga ccaccttccg tcggggcgag      1920
     gtgcccggca ttcgcagcaa ggaacatggg taaaccgcgg tttacccatg tgagccttcg      1980
     atccaggcga gaacttcccc cacaacctcc aaaggggtaa accgcggttt acccccacct      2040
     cgccagcact cggtcgactt ccgcttctgc cgcatcgagc aaggcgtcga tgtcggccat      2100
     ggattccagc gcgcgccgtc gggcagcgag accgcggtcg aagtggtcgt tactgagtga      2160
     cgggcaccta ctcccgacgg tgagatcagg gacgaagtcg actccgttgc ctcggcggcg      2220
     ttgtcgtggg cgatgggttg gcgctctacc gaggatgtgt gcggcggtga ttaccccgat      2280
     cgagccgggg gtgagcggcg agggattgag ggcaggattg ccgtcccggt cgagtgcaaa      2340
     gagtagcgga cctgtgctgc ggggggatgt gcgctcaggg agcgtctcgt tctcaaggtg      2400
     ttgctccagg aggtaggttg cggtcggtcg gtggacgaca gcgaggactg ccgaccaacg      2460
     ccggaaagcg gcgacgggac agctcgggca gtcgtcggca gcacgaagaa cgagaagggg      2520
     cccggcgccg atctcgatgc ggtcctcgcg gatcacgacc tcggatcgat ccagtcctgc      2580
     gatgagcggg aaggagaggc cggagcgggc caggtggagt atgaccgcgt cgcggcggcc      2640
     gaagagcccc gtcggccatc cccatgtggg aaggttcggc aggaccgcct cgatcagttc      2700
     gtgaagccgt tcggtccgtg aagcgcggac aggattcagc agatcgcgga cgtgtggtga      2760
     tcggccaggt gcgggaaacc ccgcattgcg atgcgcccag ttgatagcac tgaggcggcc      2820
     tcgttgggtt gacggtgccg ccggcgcgga ggccaggtac tcgccgatca cgctcgggtc      2880
     ggcgggaatc ggtctatagc cgtgtacggc gcaccagtca gcgaagcggg cgtagtcata      2940
     gcggtagcgc gcggtgaggg cagcgctcac catggcagcc gggtggcggc gttgccgacc      3000
     agaggagcgt gttcgcgggc atacacacgg agcatggcga cggacttgtg ccgggtttgg      3060
     cgctggatct cgtagtcgct ggcgccgagt cggtagctct gcgtgacgaa gccgctgcgt      3120
     agtgagtggc ccgcgaatga ggccgctgtc tctttgtcgt acccgactgc catcaagcgg      3180
     cggcgcagca tgtcaccgac ggcttcggct gtcagcgcgg tagaagcgat gttcccgtgg      3240
     cggtcgaccg cacggaaggc ggggtttcgc gggttggtga gttcgggcca gcggccgcgg      3300
     cacacgtgct gctcgcagcc gtcgccggtc ttgctcagaa cctgttgaac agcaacgcga      3360
     ccgccagcgt cgtgggctgc cacgaggtcg agccagcgac gccacgcgca cggtgggcat      3420
     gttgcgggct cgctgccccg tgggagtgcg accaccactt cctcttcctg cgatcccttc      3480
     gagatgcgca gccggacgtg gaggccgtcg agtctgtgtg gcgtgatgtc ctcgagccag      3540
     cgctcggtca tctccgaggc tcggaacgcg ccagtaaacc ccatcagcag cagtgcggcg      3600
     tcgcgatggg cggcgatgcg ctgagcgtcg ctctcggcct ggcggcgggc ttgggtgaca      3660
     agctcgcgta cgtcgtcgac gaggacaggt tcggcgcgct cggggcggcg ctcgcccttc      3720
     gcccggcaag ccctacggat gccggtcaac accccggcga cgatccgcgc cgagcccgga      3780
     tgcgggtacc cggccgcccg gtggtgatcc ccgatcgcgg caacccagcg ggtgagggtc      3840
     ggcggggcat agcggcgtcg tcctttgcta tcgcgcagcg cggccgcttc gctgatgtag      3900
     agggccaccg tgagtggatg ggcgggcagc gcctggtgcc cccgtgcggc gtttgccgcg      3960
     caccagcgct cgaaccgccg ccagtccgtc gcataggagc gaatcgtatt gcgtgcacgg      4020
     gcggtggcgg tggactcccc gatgagccgg acatcttcgc ttgacagcga cggcagcggc      4080
     gccaccgtca attccgcgcc ggagtctaca tcggccattc cgagaggctt tagcacctcc      4140
     cgaatgtggt cgatctccgc atcggtcagc gccggtgccg ccgccgggcg gtagacctcg      4200
     atctccttgc tggtcatgtg caggagctta gccgtgtata ccgacatcca tactcgcaca      4260
     aaaggttctg tgtcggtgaa tggaaaacgt cacggaggac tacggtttca gatgttttcg      4320
     atacactagc ctcattggaa ctatcgacat ggaggtcaga accgatggaa ctggcgacgc      4380
     acaccccggt gccggggcag ctggctctgt gggaacccga agtcgagcag ccgcacgcgc      4440
     agccgtcaca gccgcaccgg ccggccggcc aacacacctg ccccaacccg gagtgcggct      4500
     accccgcgac gggggcgagc gcacggggac gcctccgaga ggacgtgaag gtcgtctggc      4560
     tcgtgcccga ccccgaccag ccggacaccc cggccgagcg ccgctactgc aaccgctgtc      4620
     gcccgcggcc gccgcagcaa atcgccgatg tcgaatgcgc ggcctgcgac cacggcgggc      4680
     cgttgcttgt cggggagctc gcgaaggcgc tgcgcaccag ggggacagtc cccgtagccg      4740
     tccgcgcatg gctgctggac cacggatggc gcgagcagga gggcggagag ctcctctgtc      4800
     ccgaccaccc cgccgccgtg agatgaagat caaaatatcc agctattgca atctgagcat      4860
     caaatctgcc cacggcacat gtcgtgccga atgtggcgcc cggctcgcag gtcggcggtg      4920
     taatgctatg accgatgtca ggcaactggc ggcgtagtgg acgctgcgag gacaggggga      4980
     agtgatggca gcggattcac ccgcactcag ctcggtcgga gagagcgtaa acggctctgc      5040
     tacaacggat caccccatag ccggttcgcg tccaccgtgg tcgcgcgtgt tcttccgggg      5100
     gttggcggcg gtgacgctgg tgtatccgct ggtgtattgc agcagctacg cggtggttgt      5160
     aggagacacg ccgctggcgg ttgccgtcgc gttctgcttc ggcgttctcg cctccggcgt      5220
     gatcggcatc ggcgcgttca tggtgcggcc gcggtcgtcg atggtgaccg agacgcgggt      5280
     cgtctgcggg ctgctcgggt ttcgtcgccc cgagcccgcg cggtggcggc gccggccgct      5340
     gttggtgtgg tgcgttgtcg tccctgtact cctggcggcg gtgcactttg ggctcgacac      5400
     agtgatcggc gcggtatggc acccggtttc agatgctgaa cagttacgag cgaacgccga      5460
     gcgggcggag atactcaccc gcaacggcgc gctcagcgct gcggtgctgt acccgttctt      5520
     ggtcgcggcg gtgccagagg agatccgcta ccgcgcactg gtcttgctga ctcagcgggc      5580
     cgtcggcgcg tgcaccatcc ctcgttgggt cgggttcctt gtggtggcgg ccgtcgccgg      5640
     gctgagcatc gcgctgttcg ctgcggcgca ggcggagtat ggaccgatga acctcgtgac      5700
     ttctgcgatc ggtggagtga tctatacggg gttggtgctc tacacccgct cgttgtggcc      5760
     cgcgatctct tgccacggct tctacgacct catggcgatc tcgctgacga tcctgtgacc      5820
     cccagacagg ccgtgccccg ggcggcgtgc tcggcagagg cggacccggg gcgtacgaga      5880
     acacgttagg ttgcccgaga actggcggtc aaccaaagtt tctggctgcg acacagtcaa      5940
     aacggccgtt ttagaacacg ggtcgtccgc tggcctgcgg ccaggcgggg ctgcctattc      6000
     ggaggactga cgcaggtgag ggcgggtcag gcccttcccg cgccgctcgt tgagcacctc      6060
     gacgactccg cgggtgcggt agacggtgcg ggccccgcga ttctcatgct cgaccttctc      6120
     gtcgaaggtc tcgcggtatt gggtcacggt cttgccgtcg acgccgagca ggcgggcaat      6180
     ggcgccgagg gtgcggaact cgtcgggctc gtcgggcatg gggaagggag ccggccggtt      6240
     ggcggcttcc cagcgctcgg cgaaggcgtc gagctcgtcg gagtcgtact ccggggcggg      6300
     ggtgccttta ccggtgcgtg ggcggggttg tttcggggca gggaagtcgt cacggccggt      6360
     ccagttgttg cggatcgagc cgtagctgcg gccgcgctgt tcggcccatt ccttcaatgt      6420
     gatcagggtt cccacaccct cattgtggtt ggcggcaggt ccggcgtggt ggtcggccgt      6480
     cggcacggtg gggatcatcg ctgcttcttc tctctctcgc ggtggcaggg tgtcgaagtg      6540
     tcgaatcagg gcgattcgct tgctaagctt ggcgatgccc ttcttttgcg agtggggcac      6600
     tgtcgggcgg cctggcgtgt ccgagctgcg gtctttgacc gaggcttcgc cggccgcccg      6660
     agccatgtcc tagtagccct ccaggaacgc cgtgagcgcc gcagcggcgg caacgctggg      6720
     ttcgggctcc ccggcgtgcg gccagtcctc cacgtgcaag ctcaggtcgt cccagagctt      6780
     gcgggcctcg gcgatcagca ccgcccggtc gatgccggtg cggcggccgt tcacccattc      6840
     ggccaggttc gggcaatagt gctccccggc ccagccctcg gcgatgatcc tggcctcgta      6900
     ctcagtgatc acggtgtcga agctgtcgtg gttgtagatg cgctgggcga ccgcctcgta      6960
     gacactgggc actgtctcgg tggtctgcca gacacgcact tcggtggtga acgtcagcac      7020
     gtcatcgggc atctcctcat cgcgacggtc gagccagaac ggtgccacct cggcaccgga      7080
     gacaccggtc aggctctcgc ggtcgatgcg cttgttgccg tacatgccgg aggtcccggt      7140
     gtagtcgatg ctcccgtcgg gatcgaggat gaagccgtag tcggggtcgt ccccgcaggc      7200
     gaacaattcg ccgctgtagg cggtgaccca caggcggctg cggtagccgc cggggtggac      7260
     gaggatatcg ccggtccagg ggccggtggg cccggccgcg cgggccgcga cgccgcggcg      7320
     agcgcggtcc tcgtcggcgg gggtccaacg ggagcggtcg aacatcgtga atgtcatcgg      7380
     agtagtccca ttcgtgaaag gtttggggga gagaggtttc aggcgcgttc gacgcgcacg      7440
     atgaggtagc ggtcggtgtc gaggtggccg gggccggcca tccgccagcc gtggcgggcc      7500
     agaacgtcgg tgggctcgtc ggggatgggg tcgagcgggt tggaggtcag cgagtacgtc      7560
     gcgaccggat cggtgtcccc gtcggcggtg atcacgatgt cggcgcgctg ggcgggcccg      7620
     tgctcgggtt cgacggaatc gtcggtgacg atccgggcgg tgaacacgac gccgctgctc      7680
     ggcagcggat gaggcagggc ggccacccgt tgtgcgtagg tcggcaaccg tgtcgcctgg      7740
     tcggcggtga tggcgccgac gatcaacgcg acggcggctt ccttggccgc ctcggcggtg      7800
     ctgaaggcga tgtactcgca cagcggctcg gcaccgtcgc gaaacacggt cagccgcacg      7860
     aggttcggtg actcctcggg ccgttcggcg aacgcacgga acccggccgt ctcgaaggtc      7920
     caccgctcga ggaccgccag cgccagcagc tcgtccgggt cggattcggt ggtccagcct      7980
     tccgccggcc gcccgccgaa cagcgcgtgc tcgcagttcc aatgcccgat ctcggcgcgc      8040
     aaccgttcgg gcagcgcgtg gtcggggtcg tcgctcacct cgtcggagaa caccgtccag      8100
     gtcgagcagc ccgccgtgaa ctgctgaccg tcgcagccgg tcacggtgtc gagggcgatg      8160
     acgtcgccga cccagctgcg gccgtcgagc gcggtggtga tcgcgtcggc ttcggcgtcg      8220
     tagcagccca gggcatcggt gggaatcgtg acgaatcgcc atgcttcggt gtgctcgcag      8280
     gcgacgccga cgattccgga ggtgacggcg cggaccgcga cccgggtcgt cggcgcggga      8340
     ggggcgagcg gggccggtgt gccccattcg gtgtggttgg tggtcaggtc gtccacggag      8400
     gagtcctttc cggaagtggt tgcgggagtg gacgagagag gaaggccagg gagggggccc      8460
     tgtgcgcggg ccccctccct ggccttcacg ccgtcggggc gtagcggtcg agctcttcgc      8520
     cggtgatggc ctccaccagc gcggagatca ggatctcggc ggcgggcggg gtgacggcgt      8580
     tgccgagctg gcgcacctgc tggcgcttgt tgccgagcac gatgtagtcc ttgcggaacg      8640
     ccatcgcgtc ctggatctcg tgcggctcca acatccggaa tcgggtgttc tcgatgtcgc      8700
     gctcggtgat catgtcgacc agggcgaagc ggtcgcgggt ggacagcgtc cccatcgggt      8760
     cggagaccgg gcgggcggtg ctgttgccgt agtagggcag cagcagcgag ttccacagct      8820
     ccggcgacat cccggtgggc ggggtgggcg gggtgaccag gccgtggtgg ttgccgctgg      8880
     cggtgacggt ggccagagcc tcggtcaccg gccgcgcatc cgaggagccg ccgcgcagct      8940
     cggcgacgaa gggcaagaac gccaccgccg tctcgttgcg ggtggtctgg gtgcgcagcg      9000
     gcatcgaggc cagctgagcc tccttgccgt cgcggccctc catcgggatc atcagcggcg      9060
     gcggcacgac caggccgtgg ttggagccgt cggcaacgac cgtggcgaga ggttcgtgca      9120
     ggccgatcgt gcgggggcgg tccgagcgga gcagcgccag aaacggctgc gggatcgcca      9180
     ggccgtcgtt ctcgcgggtg gtacgggcgg ccatgggccc ggtgacctgg gtggcgtcgt      9240
     cgcgccaggt gcccccggcg ggaaccatca tcggcaccat ggaggcgtag cggcgcatgc      9300
     cgacgcgaat gcgttccatg gtcttggggg ccaggggctt gtcccggtcg ccgatgcggg      9360
     tgcccggcag ggtccagtcg atcgcggcgg ccgccgggag cacgggcggc tcaatcacgg      9420
     cgttgcggca ggtgtagcga gggcagcggt agaagtactg ggtgcggtag cggcccatgt      9480
     cggcaccagg gcgtttgaat gcctggagcg cctgtaccca cccgcattcg gcgcagtagg      9540
     ccatcggacg caaccacttg ttccagtcgg gcgtgcggcc gagcttgaga tcccagtacg      9600
     cgacgtagag ccggtcccgg ctctgcggtg ccgccggggt gcggaccggc tgcgcatgag      9660
     cggagttcag ggcgatgacc ctgaccccgt agcccagggc gcggatctca ccgatccagc      9720
     ggtgccactg atcccactgg cggacctcga cgacgttctc cacgaccccg gcgcgaacgc      9780
     ggccgccgcg ctcgatcacg ccgcgcaggt acatcgggac ctcttccatc agtgcccggc      9840
     tgcggtcggc ttcctcgtcg cgctggaggt cgagcagatc gccctggagg gtgttgtgga      9900
     agtcgcgctt cttgccgcgc gccgaggacc actgcgggca ctccggcgaa gcccagaaga      9960
     tgtcggccac aggccatttc acgatctgcg ccttggcctc ttcggtgctc aaatcgccga     10020
     ggaaatgatc ggcctcgggg tagttggtgg catgggtctc gatggccttg tcccagtggt     10080
     tcgccgcgcg ggtgacgcac acaccgggca ccttcgatgc gccctgggtg gagccgccag     10140
     cgccgcagaa ccaatccatc agttcgagca tgggaatcgt cccttcgtga tttgcgagtg     10200
     gggtagaagg ggcggggtgt ccggtcccgc ttccttctat gtcatatatt acccgttaaa     10260
     gttgatcgag gtcaagaact ttcttgacgt gtcattattc gaaatagact ggactgcaac     10320
     aactttgagg ggacacctac gacctgccgt aatccctcgg ggatcactac cgatgcaatg     10380
     gatgctttag atacactagg tgtgtggaag ggtgtcgccc cgcgttcgcc cccccgtcaa     10440
     cgaagccggt agggccgcca acgacgtcgg cccggcggca agctcggggc cccgtcctct     10500
     caccgccggc cgtcccgccc cggtcatccg cctgcatccg tcggtgcccg gtgggagact     10560
     cgtcgggacg gcgtggacga accgcgcagc ggcccaacta cacaggaacg ggagcacccc     10620
     gcccatgacc gaagtcgatc gcgtacaggt cgtgcaggag atgtggccga ccatcggccc     10680
     ccacgacgcc gactcgctcg ccgcggccgc cgtcgcctcc cgcgagatct tccgcatgct     10740
     cgcgcacgcc accatcaccc gcaccgacgc gctcaaggcc ctgccgtaca tggtcgatgg     10800
     ctacaccgtg ctgggagggc tcgccgaggc cgccagctcc gagcgccagg gcctcgaaca     10860
     gctcgccgtc tgggccgagc acttcgccaa cgatcccacc ctgcgccacg ccgaacaccg     10920
     cgatcagcag ggcggcggca tcgcccaagc ccagcaggcc gccctggaga ccgccgagga     10980
     cctgcgcgag gccgccgggc acgccgaggc cctcatgcgg gcactccagc gcgcccaggc     11040
     gcacaccagc ccgctctacc acgacgacga ggaatcatga ccagcgccca cgccgcaggc     11100
     gaacccaccg actacttcgc accggtgtac gcgatcctcg accgatgggc cgcagacggc     11160
     gcggccgccc ccgacccggt gccggtgatc ctgggcgacg gcagccacgc caccatgacg     11220
     cgcgactggc tcaccttccc ccgcacagag ggcacgatct ccggcaaatc catgtcgctg     11280
     agactgctcg agaaggcgcg cggcacgctg accccatcga accgccccac ggacgagaag     11340
     gaccgatgac cgcctcctac accgccgacg aactgcgcac gttgctcgaa accggcgctg     11400
     ccgcagccga ttcccgttac cagcgggccg cgatccacct gctgaacttc accgagctgc     11460
     ccggccgcac cgccctgaac gcctacatcg agaccgatac cgtcaccatc gacggccgcg     11520
     acgtgcgcgc cgcctggatc cgcgactggg acggcatggg ccgcctggaa aacctcggct     11580
     acctcagcgg cggcgaggaa cgcctcgtcc ggcgcgccgc cagcatggcc cacggctctc     11640
     cagtcgacct gtgcgccacg ctgagctccc ttggccacgc ccacgcccgt cgcgtcctgg     11700
     aagccgtcgc gatctgcctc ggcgccgatg agtactacga catcaccccg acccccgcac     11760
     tcctcgaaaa ccagcgcttc gaggaacaac tgctcgctgg cgagctgagc cgccgcgggc     11820
     tcggccccga tggacagccg gtgccgaacc cccagtcagg agagaccgag tgaccagcct     11880
     gccgacccag gaacagatct ggaccaacgc cgccgacgcc gccgaccgcg cggcgctggc     11940
     cctgtccgat gtgcgcgact ggctgagatc cgattggtcc gacaccaagc ccctgaccga     12000
     cgaagcggtc caggcgcgca gcgcggccta cgcccggctc gagacgctca aggacgagat     12060
     ccgcgacctc gaacatcaat tgcgcggcgg cgcgagaagc ctccgcgacc ggcgataacg     12120
     agacgaccgc tcaacgaggg gactggaaat gttcgacgag actccgatca gctgggaaga     12180
     cttcaaggcg cggcggccca gcgacgccga gaacgccgcc cggctcgccg acctggtccg     12240
     ccgggcccgc accgtccggg cgcacggctg ggacgactac cggtacgtgt ggtcgtccgg     12300
     cgaggtcgcg ggcgtcgcgt acttgctcga cgacgaggac gtgctccgcg acgccgacga     12360
     aaccgccgac agcgtgctga gccgctacgc ctgcgacctg ttcggcgtca ccggcggcca     12420
     cgacgacatc gccgccggcc accccggcac ccgcgcctgg ttcgaccacg cccggcagga     12480
     ggctgaacgg tgagtacgct tctggccgac gcggaggctc gggtcgcgac gctcgcccag     12540
     gcccacccag agatgtatcc gcagccggtc gagctccgcc gccgcgcgca tccccgtgac     12600
     ccggcgaccg agacagcaat cgcgttgtac cagtggagaa ctccggtctt caaggcgcgc     12660
     cgcgaacggc gtgtggtgga gcacatcgtg gtcgaccccg acgtgtacgc ccgcctcgac     12720
     gggcgcggcc gggacgcgct gttggcggtc gagctcaccc gggccgatca tgtacgtcga     12780
     accctgtcgg cggccccgct cggcctggcc gcgacgtggc agctcgaccg gctgctgcgg     12840
     cggagcggca ccggccgcgc cgacacggcc gtgatcaccg gcgtgctggc ggccgcggcg     12900
     ggcgcgttcc tgccgctgcc cgtcgccccg cccgtgcgcc tggtcctgct cgccgtcgtg     12960
     atcgcgaccg tggtgtgggc attcgacgcc gccatcacgc gcggtctcca tctccacgcg     13020
     gaccgggtcg ccgcgcgctg gatcggggcc gacgcggtgc gctacatgct catgaccctg     13080
     tccgccgacg aacaccatcc cgagggcgcg gccgcctggc gggtccggtg gctgggttac     13140
     cagccgaccc tccggcatcg gctgaagtcg ctgaaccgcg tccacgcggt cactgagaac     13200
     ctccgcccgg tcgagtgagg acgacaccga gcgatcatcc gcaagacggc catcaacatg     13260
     gggcctcatc atgcgccggg cgcagctgca ccacgaacga ctcgtccgtc actaccggcc     13320
     agcatttcac acaccaggcg tcacagtgac gaaatccgcc ggtgcccccg gagtggaggt     13380
     ttgggctgcg gagagccgga tatgcggtgg tttccccgcc gatgctcccg gccccggaca     13440
     ggtccgggca tttccccggc tccgatgtga ttgttcgaag tcgtgttcag tgctgacctg     13500
     tgggttcggt tctggttgaa gaggacttcg atcatcggcg tgtctcgaac tccggttcag     13560
     tagcgtgctt ttcgctcgta ctcgtcttca gtgagggacc agggatggcc ggggattcgt     13620
     cggtggctga tcggggtgtg ttgaccgcgg aggaggcccg ctggcaggtg gcggtgcagc     13680
     gggcggaggt gatcggccgt ctcgcgcagg gggatcgggt gagcgtggct gctgccgatg     13740
     aggccgccgc ggagttgggg gtgacgcagc ggcaggtgta tgcgctggtg aagcggtggc     13800
     gggctggtga gggggtggcg tcggatctgc tgccgcgccg ttcgtcgggt ggccggggtg     13860
     gtgagcggct gtctgatgag gtggaggaga ttgtgcgggc ggtgctgcgg gcgcggtatc     13920
     tgactcgtca gcggcggtcg gtggcggtga tctgccggga gatcgatcga gagtgcaagg     13980
     tgcgcgggtt acggccgccg tcgcggtcgg cggtgcagcg ccggatcagc aggctggatc     14040
     cggtgaagac cgtgaccgcg cgggagggcc agggggtggc caggtcccgc agacccgccg     14100
     gcggggtggc acctgcggtg acgggggtgt tggagcgggt gcagatcgat cacactccgg     14160
     cggatgtgat cgtggtcgac gagcatcacc ggctgccgat cgggcgtccg tatgtgacgg     14220
     cggcgatcga cgaggccacc aagtgcgtgc ccgggctcgt gctcacgttg gaggcgccgt     14280
     cggcgacctc ggtgggactg tgtttggcgc acatggcgat cgacaaacgc gcgtggctgg     14340
     aacgcatcgg ggtgcaggcg gtgtggccga tgagcggcaa acccgtccag ctgtataccg     14400
     acaatgcgac ggagttcaag agcgaggccc tgcggcgggg ttgtggtcag cacggtatcg     14460
     cgatcgacta ccggccgcct ggtgccccgc attacggcgg gatcgtggaa cgcctcgtcg     14520
     ggacgatgat gcggatggtc cacgaattgc cgggtacgac gttttccgac actcgcgagc     14580
     gcggcgacta cgacagcgac gcgaaagccg ttctcaccct ggccgagttg cagcggtgga     14640
     tggcgttggc ggtggcctgc tatcacggtg aaccccatga cggtttgggt gggcggaccc     14700
     cgggtggggt gtgggcggag aaggtggccg cccatggtgc gccgccgacg gtgacgaacg     14760
     agacggcgtt tctggtcgat ttcctgccgg tggagcgcag atcgttgcgg cgcaccggat     14820
     ttgtgctcga tcacgtgcag tactacagcg acgccttgaa gccgttgatc gcgcggcggg     14880
     agcagttgga gaaggtggtg ttgcgccgcg acccacgcga tatttcccgg atctgggcgc     14940
     tgcatccgga gaccggcgag tatctggagg tgccgtaccg gatgtggtcg cggccggcga     15000
     tcagcctgtg ggagcagcgc gcggcggtgg cgcggttgcg ggagcagggc cgcgccgaga     15060
     tcgatgagaa cgcgctgttc gcgatggtcg agcagatgcg ccacatcacc gccgacgcga     15120
     ccgcgacaag ccggcgagcg cgccgcaaca ccgaacgccg caaggcgacc ccggcacgca     15180
     gccgtgccca agccatacca ccggcaccac cggtgccgac gccgggtgcg gcgccggtgg     15240
     cggtggcgcc gttcgaggtg atcgagcagt ggtgagtatc ggtgagccgg tggatctgtc     15300
     gcatctgcat ccgtcggcgc agcggccggc gatgttgccg gatgctgagc ggatccagta     15360
     cgtgcgggcg gatcggtgga tcggctacac ccgcgcgagg gaggctttgg cccggctgga     15420
     gggcttgctg agtatgcccg gtaagcagcg gatgccgaat ctgctgctca tcggcgcgac     15480
     gaacaacggt aagtcgatga tcatcgagaa gttccgtcgc gaccacccgc cggtctcgca     15540
     tgaggatcgg gaggagatcc cggtgctgac catgcagatg ccttcggagc cgtcggtgtc     15600
     gcggttctat gtcgcggtgc tggccgcgct aggggcgccg atccggccgc gggcaccgcg     15660
     gctggccgag ttggaacagt tggtgctgcg cctgttgcgg gcctgcggtg tgcgggtgct     15720
     ggtgatcgac gaactgcaca atgtgctcgc cggccggggt gacacgcgcc gcgagttttt     15780
     gaacgtgctg cggtttctgg gcaacgagct gcggattccg ctggtcgggg tcggcacccg     15840
     ggacgcctat ttggcggtcc gttccgatcc ccagctggag aatcggttcg cgccgttcac     15900
     tctgccgctg tgggagccag gcgaccaggc gtgcgcgttg ctggcgagtt tcgcggcgtc     15960
     gttcccgctg cggcggtcct cgtcgatcgc gaccgaggag atggcgtcgt acctgttcac     16020
     ccggtgtgag ggcacgatcg gggagctgac cgcgctgctg tcggatgcgg cgatcgcggc     16080
     gatcgaatcc ggggaggagg ccatcaacca gcgcaccctg ctgctggcgt cgtatgcggg     16140
     gccgaccgag cggcggcgga tgttcgaacg cgagctggcg tgagcccatc cccgccgcgg     16200
     cgctggccgc tgcacccgcc accgggtgcg ttggagtcgc tgtcgtcgtg gctggaccgg     16260
     ctcgcccgca tctacgaggt gccggtacgg gagctgctgg gaccgaatct cggtgtgctg     16320
     gtgggcatcc gggatgttct cgacgaggat ccgcccccgg cggtgttcac cgcgctggct     16380
     gagcgcacgg gtgtgccggc ggggcaggtg cgggcgatga cgctgcccgg atgggtgccg     16440
     tggctgttcg acgcctaccc gctgcccgaa cgcgacgcca ccgacgggtt ctacacctat     16500
     gtccgccaat attcggtgct gctggcaccg cgggaggcac cgcggttcga ggtgacccac     16560
     cgtcgccgct ggcggggccc atggattccg gaacgcccgg tgcggcgatc gtgcccgcag     16620
     tgcgcggccg gaccggatcc ggcccgcgcg ctgatctggc agttgccgct cacggtgagc     16680
     tgcctcgagc accgctgccg gctggcgctg gataccgaca ccctcgcggc cgagatagca     16740
     ggccagccct accagcccgt tccggtcggt gaaccagtgg cggccctgga cggttacacc     16800
     cgtcaagccc tgatcaacgc cgcggtgagg ttgccgggcc gcacggtgca cgccggggtg     16860
     tggtttcggc tgctgcgctg cctgctcgac gaactcagcc tcgccggttc caccggcacc     16920
     cgcagctcgg agcggcttct cgaacagatc tgggacgcga ccggtgaacc gatccgcgcc     16980
     gggctggcgg tgtggcagcc ctacgagaac ctggaatgga ccacccagga gaaactgctg     17040
     accgccgccg cgacagcgct ggtgctggcc accgaccggc gcatccagcc ccggggaact     17100
     ctcgcctggt tgctgaccga accgcaacca ctgcccgtct acgacggcga cccaccacgg     17160
     ccaccgacac ccgacccgcc cgcacagacc aggcgcgacc tcatgcagac gatgaacgcc     17220
     tggtacgcgc gggcccgcat cgatgccgac gccgcccgcg cgatgctgcg gctgctgacc     17280
     gcactcgata cgacaccggc gcacgccacc cggcaccgcg acgtgctgat cagcgagggc     17340
     atccccgcgc gattcctgcg cgacgatcta ctgcggtgcc caggccggcg cacccgcgac     17400
     gaaaccgaaa ccctgctggt ggccgaaggg ttcgatcccg gtgaggtggc ctatgagctg     17460
     gactgttgcg tcgccgagac gatagcgctg tgggaggttc ccgacgaggg tgtgctgatc     17520
     ggcgaggacg aactcggcca gatccgcgcc cgcttggagt tgtgaggggt gccccgatgg     17580
     ccgctacacc cgcaaccggg cccgatcgaa tcgttgtcgt cgtgggtcca gcggctcgcc     17640
     acggtctatc agctgccggt gaaagtgctg gtggcggacc tgtgcgccga tttctcgccg     17700
     aacatgcgcg cgttcgcgaa ccggctgcac catccgccgc cagcgctgct ggacgcgctc     17760
     gccgtccgca ccggcgtccc ggtgccccgg ctggcgacga tgaccctgtc cgggtgggtg     17820
     ccgtggctgt tcgagaaact gtggccgcgc gagttcgagc agcaacagct gttcgacaac     17880
     tatgtggggc gtcaatcggt gttgctgctg cccgggacca tcgagcgcga catcgtccgc     17940
     cgcatcaaat cccgatggga cgcgccctgg ctgccgtacc cgcgcagacc gcgggcctgc     18000
     ccggtctgcg ccaccgaccc ggactccggc cgcgccctgg tgtgggatct gccgctgatg     18060
     ctcagctgtg tcgagcaccg ctgccgcctc gaacgcgccg gcgcggtcgc aggcggtgac     18120
     gccccggtgg tcgctgtgga cgagacggtc accacgatgg acggctacac ctaccaagca     18180
     ctcaccaccg ggctggtgcg gttaccgggc cgtaccgtgc acgccggggt gtggtttcgg     18240
     ctgctgcgat gcctgctcga agaactctgc gtgtcccgcc tggcgtgcag tgcccgcacg     18300
     gacgcggtcc tggaaaccat ctgggacacg atcgagctcc cgatgcgcgg ccggatcgcg     18360
     atgctggagc cgtatgagtg cctggactac gatgtcgccg agacgctgat gcgggccgcc     18420
     gcattggcgc tggcgctggc cgccgaacgg tccattccgg cggtcgggga actcgggtcc     18480
     gcgctcgccc cggtgccgta ccggccggtg ccgcccggag atcccccagt gcgacgctgc     18540
     gcgccgtcgc ggctcgatct gctgaatccg ccccgctggt ggcccgccgc gccggtgcag     18600
     gccggtacgg cacgggactg gtcacaggtc gctcgacgtt atgcgctcaa gcgagggttc     18660
     ccggcatggg tcttcggtgg gctcaccgac gaacccggac tcgactagct gtcggggtga     18720
     tccgggcata ccggcccggc gtcggtgaca cgccagcggc gcaccgacag ccagcgccgg     18780
     accagtgccg ggatttcgcc ggtgtcgcgg agttcggtgg cgtagacgcc ggtgagcaag     18840
     gggccgccgc agtcgcaggc cgcgcactcg atgtcggcga tcggcacttc tcgggggcgg     18900
     caccggtggc agtggcgggc ctcgatgagg ccgccgtcgt cggccggttc gagccagacg     18960
     accttgatgt cttcgaggag tcgcccgcgt tcggaggtct cgtgggcggt gtagccgcag     19020
     gcgtcgttcg ggcagaccgc gggcggctcg ggaaggttca tgcgagcggt ctgcttgagc     19080
     cgccacgcca gattcggccg ctcgcgagcg aactcgcgtg tgctggagtt ggtttcagca     19140
     tgttcgtcgg cgtcggccgc cggtagcggc cggatcggat ccggctcggg tacgaggcca     19200
     ccgaggtcga ccaggccggt cggcgccgcc tccgtcacca ccgcgctgga accgcccgga     19260
     gaaccaggtc gcccatcggt gggatcaccg gcggggacac cgagggtttg cggtgtggcg     19320
     gtcgcggttt cggtgatggc cggcgcgata cccggtgcgg ggtctgcctg gtcgaccacg     19380
     acggcggccg gtgcactggt tgtcgggagt ggggttgcgg ggccggagtg gggccgggtg     19440
     ccgatgctgt tcttgtcgag gtgtccatag agggtgccgc gtttgacgcc gaggatgtcg     19500
     gcgatctgct ggacggtgtg gcggccctcg tcgtagaggc gctgggcctg ttcgatctgg     19560
     tggacggtga gcttggggcg gcgcccgccg gtgcggccgc gggcgcgggc ggcttcgagt     19620
     ccgtcgcggg tgttggcgac gatcagctct cgctggaact cggcgagcac cgagagcatg     19680
     ccgaacatgg cgcggccttc ggcggtgtcg gtgtcgatgc cctgttcgag gactttcaac     19740
     ccgatgccgc gtgcgcggag gtcggcgccg aggttgacca ggtgcagcat cgagcgaccg     19800
     aggcggtcca ggcgggtgat gacgatggtg tcgccgcggc gggcgagggt gaggacgaga     19860
     tcgagtttcg gtcgcgatgc cttcgcgccg ctggcagtat cgatgtggat gtcgcccggt     19920
     tcgactccgg cgcggcggag cgcgtcgatc tggtgggcgg ggttctggtc ggcggtcgac     19980
     acccgcccgt agccgatcaa catgatgtcg aaaatagctg aaatcgggtt tgccgacgtt     20040
     gattcccggc acgagttttc gacactctta tcttggggtt tctcccgctc acgcaaggtt     20100
     gtcggcaaat gatcgttttc cgacaatcac tatctgagcc gaacatgctc ccaaccaggt     20160
     tcgcgccgac tccactacat cagtacgcat ctggtttgag ctgtttcgat tcatcgtttg     20220
     caacctggat ttaattgatg ccatagtgtg gagactgaac taggtctaca cgaggagtgt     20280
     gctgcatggc tgtccggttc aagctcggtt actactcacc attaaccgac gacccgctga     20340
     atcgcgatta tgtcggttac ttcccgcgca tgaccgaaga ggaggcatgg acagcgggcc     20400
     ggggagtatg gaaggcgaac aaggaacggc tatcaaggga gaagttcgcc ctgatcatcg     20460
     gtgacagccg ggtgtgcgcc gttgccgaga tccgcggcgt gtcggtgtat gaggatcggg     20520
     tggctgtcga tggggaggcg ctgggcgaag gtcacccggt gcgcgacgcc tggatcggca     20580
     aaccggatcc ggtggtgaac gcttcgcaga acccggtcgg ctactgcgac ctccccgaag     20640
     aggccgaatt ccgggaacgg ccctgcggct gcgggtgcgg ggagatcagc acccgcgact     20700
     tcctgcccgg ccacgacgtg cgcgccttcc aggaccgggt acggcgcatg ttcgccggat     20760
     cggcactgga gttcttccgc tgggtcgacc gcatcggcgc cgagcacggc cttccgctac     20820
     tggccaaccc caccggtggc acggcactgc ccgacgagca ccgcgagccg ccgaatccgg     20880
     accccggtga gcagtcgccg cacgacccgg gaatctccta cgccgccctg tccgactctg     20940
     gagatttgtt gtccggcaac gaatctcgtg cggagagcgg agagcctgtc tgagactgtc     21000
     cgggccgcta cgcaggaacc accggcagct cagtcggcgg tccccgccgg cccgggtccg     21060
     gcgggttgcc tcgccgaact gctcgatggc ttcgatgatc cggttgtacc ccttgctcca     21120
     gcagttcgag gtcagggcgt ccgggcgggg gtactgtcgc ccggcacgcc actgcggcgc     21180
     gcttcctaga tgcactgatt ctcgccgtgc gtctgaagcg cggagaccgg aaccggggtc     21240
     ggctcgtcat cgggatgctg gttgtcgact gtcagcgcac gtaggacaca acgctcatca     21300
     ttccggcctc gccgtgatag gcgttgtggc agtggaccat ccattgtcca gggttgtcgg     21360
     cgtcgaagtc gacctcgacg gtctgcatcg gcagcacgat ggaggtgtcc ttgcgcgggc     21420
     cggtgcccgc agcggagacc acctggaagg tatgaccgtg cagatgcatg gggtggaaca     21480
     tcatcgtctt gttgaccaac cgcagccgaa cccgttgtcc ctcggtcaca tcgagcatgc     21540
     tgtggtcggg aaatgccttg ccgttgatca tccagaggta cttggccgtg tcgttttcga     21600
     gggtgaggtc gagtgtgttg tccggcgtgc ggttgggcag gcgtacggat tcggcgccga     21660
     ccagtcggtc cgcggtgagc gggggagccg acagttccgc gggacggacg tcggcgggcg     21720
     gcggtgtgcc accgccggtg cggatgagag cgaagccttg gcccgcttta ccttcggcgg     21780
     aagcgaccag cggaaacacc ccgtcggcca gttcgacgac ggcgtcgtag cgttcgccca     21840
     tgctgatgag caggctggag gtggtgaccg gctgcaccgg gaaggcgtcg ctgtgggtga     21900
     cgcgcagctg gtggccgccc acggcgacgc ggaaggcggt atcggaggcg gcgttgatga     21960
     tccgcagccg gatgcgctgg ccagggcggg cggtgatcgt caccggatcg gcgccgatcc     22020
     ggccgttgat cagatagtac ggatagtctc tcacgtcccc ggtgtcggag ccgagcgggg     22080
     cgctggggtc ggtgggcatc gccatcgtgg acgatccacc catggtcatg ccgccgtggt     22140
     ccatgccgcc catatccatg ccagacatgc ccttggcgcg cagctgatcc agttccttgt     22200
     ccgggtcgcg gccgttgacg ccgtcgagcc agtcgtcgag caccacgacg gcttccaggt     22260
     cgtagtcctt gccgtcggcg gggtcctcga tgatcagcgg agcgtacagg ccacggtcga     22320
     gctggacccc gacgtgtggg tggaagaagt aggtgccggg gtcgggtgcg gtgaactcgt     22380
     agccgaaagt gccgcccggc gcgatcggcg gttgtgtcac ctcgggtgcg ccgtccatgt     22440
     cgttgcgcaa cgcgatccca tgccagtgga ccgtcgacgg tgcggacagt gcgttggtga     22500
     attcggcccg cagcacgttt cctttggtga tacggatttc ctggccgggc agtgtgccac     22560
     cgtaggccca ggtctggacc cgtacgccgc cgaggtcgac ggtggcgggc tcggcgcgca     22620
     gccgcacctg ccgcacagcg gcaccggccg cccgccgcct gttctcggcc gcgcggaccg     22680
     cttcggagtc cggttcgacg agtgtgcgtg aagcggtgga gttcttggag catgcggtga     22740
     gggcggcggc cgcggtgacg ccggcgccga gggcgaggaa gccgcggcga gtcatcgggg     22800
     tcgagtgggg gaactggctc gaggacatgg gtttctccct gggggtgaag gattcggggc     22860
     accgcgccct ggcgtcgggg cggcttcctg tgatctggta cagccagtgg gccgccgaat     22920
     gccttgcagt ggcttcatgc cgcaccggct gtcgctgccc gcccagaagg cggggcgtgt     22980
     acaccgcgcg actggattcc ggcagcggcg ggtcctgtca gatccgcaga atcgatagtt     23040
     cagccagaga ggggaccgcc cagggtggtg gccgttcgcc gtgcgcacgc cagtaccctg     23100
     tcgacggcat cgccccgacg ccgtgcatga ggtgtgcccg gtacaggaat accaggccga     23160
     tcgccagagt cagcatcgac acgatgaaca cacaggcgtg caccgcttga tgtccgagac     23220
     cgtgatcacc gcccaccatg gttacctcgt cgtggtggtg ggtcctcacg gctgtgacgg     23280
     cgggagcaga ggagtcggcg tggtgcgccc cggaccggag cgtgtcggac ccgctgtgga     23340
     acccgctggc gtgcatgacg gtgatgccga caatcagcac cagcaggccg agcacccgga     23400
     ccgaccggga cgcacacgac ggctggtgct gctgcatcac accgtcatcg tagtgcctgg     23460
     catcgccttg ctcgagccgc tacccccgtg gggtaatcct cgggcgcccg ctgcctcgct     23520
     cggcgacgca ggtctcgtgg gccgcggttc aggaggggtc gcagccgtcc gtggacggga     23580
     gccggtcggc cgcggccagg gcgtgcaggc agcactcggc caactcctcg ggtgagacat     23640
     cggttcggac cgagccctcc acggcagcgg ccgcgatcag gtcaacgatc atcgcctcga     23700
     ggtattgcgt tcggtcagta tctccaccga cgacgaacat gtggcttgtg gcctacaggt     23760
     acgtggtaca gagcgagaag atatacccca gcggggtata ttggtggtgg tgcagatcca     23820
     ctgaagtcgg gagaatggtg gtgcaatgag gtggccgagc gacgaagtcg cctggtccgt     23880
     gcgcggctgg gtcgcattcg cgactcgcgg cgtcaggtgt ggtttctttg gtcctgctac     23940
     agtcggctca ctgtgaggct catcggtcga ttgcgacatg gtggctccgt ggcggcgctg     24000
     ctcgccgcgg tgctgctcat cgtgccgatg gtcgactgct cgacagccgc agcccatgca     24060
     catgctgcat cggttcccgc gggggtcgag gaattcgcgc actcgatgag tgatcacgcg     24120
     cacgccgtgg tcgttgacgt gcgcgacggt cactgtgtgg cgcacgtcga tcactgtgtc     24180
     gcgaagtcgg tgctgcgtgc acccgagaat tttgcgccgc agcatgtgct gctgttcgcg     24240
     ctggtatcgg cgcttgttgt cgctgtgggc gttcgcggga ccactgcggg gggtgtgcgt     24300
     ggtccgccga tcgcgtgggg gcccgttgcc ggtggccggg ccattttgac gcagttctgt     24360
     atcgctcgac gctgacaggt cagcgccagg ccgacatttg tctgtcggcc ggtgtccgct     24420
     gccctgctca cagtgttcgc cgcctatagg gcggttcggt acagaaagcg acagtcatgg     24480
     acaaggtcgt gctcgatgca ctcgccgatc ggtccgcggc cctggtgggc gcgccggtag     24540
     ctgcccggta tccgcactcg ctgatcggca acacaccggt gttgtgggtc ggtgcgccgc     24600
     tggcgcccca ggggcgggga ttctgggcga aactcgaagg attcaatccc ggcgggatga     24660
     aggaccggcc cgcgctgcac atggtgcgca aggccgagca acgcggtgat ctggcaccgg     24720
     gggcgcggat catcgaatcc accagcggca ccctcggctt ggggttggcg ctggcgggga     24780
     tcgccaccca tcacccggtg acggtggtga ccgatcccgg tctggaaccg atcgtcgcgc     24840
     ggatgctcac cgcctacggc actcaggtcg acgtggtcac cgaggcgcat cccaccggcg     24900
     gctggcagca ggcccgccgt gaccgagtcg cggagctgct ggccggtgag cccgacgcgt     24960
     ggtgcccgga ccagtacagc aaccccgaca acgtcgacag ctacgaatcg ctcgcgctcg     25020
     agctggtcga gcagctcggc gaggtggatg tgctggtgtg cgcggtcggc accggcggac     25080
     actccgcggg tgtcgcgcgg gtgctgcgcc ggttcaaccc ggggatgaag ctgatcggag     25140
     tcgacacagt cgcctccacc atcttcggac agcccgcagg cctgcggttg atgcgggggc     25200
     tcggatcgag catctacccg atcaacgtcg actacgacgc cttcgacgag gtgcattggg     25260
     tcgcgccgtc ggaagcggtc tgggcgtgcc gcaccctggc cgcgacccat cacgcgaccg     25320
     gcggctggag cgtcggcgct gtcggactcg tcgcgggctg ggcagctcgg acccacgatg     25380
     ccgataccag gatcgcggcg gtgttccccg atgggccgca ccgctacttc gacaccgtct     25440
     acaacgacac ctattgcgag gagcacggcc tgctcgatgc ggacccgccg gtggaaccgg     25500
     acacgatcgc ccatcccgcc gaacgtgtgg tgcggtcctg gacccggtgc accaccgtcg     25560
     tcgatccgag gcagttcatc cacgaccggg agccggcatc gtgaccgtag tcgcgaaatt     25620
     ccgcagcttc gatatggctg cccgtctgtt gatgatcaac cagttcggca tcaacctcgg     25680
     cttctacatg ctgatgccgt atctcgccgg ctacctggcc ggtccgctcg ggctggcggc     25740
     ttgggcggtg gggctggtgc tgggtgtgcg gaacttctcc cagcagggca tgttcctcat     25800
     cggcggcacg ctggccgacc ggctcggcta caaaccgctg atcgtcgcgg gctgtctatt     25860
     gcgcaccggc ggcttcgcgc tgctggtgtt cgccacctcg ctgccgggac tgctgatcgc     25920
     ctcggccgcg accggcttcg ccggagcgct gttcaacccg gccgtacgcg cctacttggc     25980
     cgccgacacc ggtgaccggc gcgtcgaggc gttcgcggtg ttcaacatct tctaccaagc     26040
     ggggatcctc gccggtcccc tggtcgggct ggcgttgatg gccctcgact tccgggtgac     26100
     cgccgctgcc gcggcggtgg tgttcgcgat cctgaccgcg gcgcagttgt tcgcgctgcc     26160
     gacgcggcgg gccgagaccc ccgccgagca cacctccgtg ctcgacgact ggcgcaccgt     26220
     ggtcgcgaac cgccggttcg tagggttcgc ggtggcgatg accggctcct acgtgctgtc     26280
     gttccaggtc tacctcgccc tgccgctgca ggcggaattc gtggcgggcg cacaggcgca     26340
     ggcgctggtc tcggcgctgt tcgtcatctc cggcgttgtg gcggtcgccg gtcagctgcg     26400
     catcaccgcc tggttccgca acaggtgggg caccggacgc agcctcgtcg tcgggctggg     26460
     catcctcgcg gcttccttcg tcccgctggt agtcgtcccg gatccggatc gattcggtgt     26520
     cccgcccgca gccgccgcgt tactcgtgtc ggcggtgttg ctggccgtgg ggaccgcggc     26580
     ggtgttccca ttcgaaatgg acaccgtcgt gtccttgtcc ggtgggaagc tcgtcgccac     26640
     ccactacggg ttctacaaca ccgttgtcgg tgtcggcatc ctcaccggca accttgccac     26700
     cggtgccgtg gtcggcgccg cccgcgccgc cgggatggac tgggcggtct gggccggcct     26760
     gagcatgatc ggtgtcctcg ccgcgttcgc tctccaccga ctggaccgcc cgcagcccgt     26820
     cgcggaaaaa ggccggtcga cgcgcactcg cgggcgccac cgcatccccg atcaacacac     26880
     cgtcggcact gcgccggccg agcagcaatt cgagtacacc ggacgcggcc actggccgac     26940
     gaagatcccc gccgcgcgac gctgaccagg tgcgcacaat ctgtgtgcac ttcgggtccg     27000
     gggtgctgct ctgtccggaa cgctccagat gtcgttatcg ccgggcagcg gcttctcgca     27060
     ggctcatctc tgctcgagca ttgccttcat ctggtcgatc tcgcgctgct gggccggcac     27120
     gatcgcggcg gccagctgct tggctcggtc gttggctccg gtgtcgagtt cggtctgggc     27180
     catctgcacg gcgccggtgt gatggttgat catcatctcc agccacatcc ggtcgaattc     27240
     cgccccggac atgctctgca gcgacgacat ctgctgcggc gacatcatgc ccggcatgtc     27300
     atgacccatg gggcccatcg ggccggtggc cggggacggt acgggcttgc cgaactcctc     27360
     gagcagcgaa cggatctgtg ccatctcggg ctcctgcgcg gttttgatgg ccgaggcaag     27420
     atcgagcaac tgctggttct gcgagtgcga cggcaccaga tccgccatct gaatggcctg     27480
     cgcgtggtgc ggatacatgc tctgcagaaa cgtcacatcg gcatcgttgt aggtgcccgc     27540
     cggcgcggac gtcgcggcgc cgacggtcgt cgatatagcg ggcgcgctcg gtcccgcggt     27600
     cgtggtgggc ttgtcggcct cgtcgctgtc gccgcatccg gccagaacga acagcaggac     27660
     ggcaacgccg ggaagatatc gtcgaagcgc ggtggaacgt agaggcatgg cgaactcctg     27720
     tagtactaga gccgggacaa catgacttca cgcgttgagg aaggcgcgaa acgaacgatt     27780
     taagcccatg aagccgcccg cctttggctg cgatgctctg accccaagga cgaggggcga     27840
     ccggccggag cgtgccgcgt tcgggcactt gaaatgagcg agtagaagag cccagtacac     27900
     actctggtat cggacgatcc gtgtcggcta gatcggcggt agtaccagcg gcggggctgt     27960
     tcagccgagc gcctgaatga ggtcggtgca ggcttgctcg cagcggcggc atgcttcggc     28020
     gcacacgcgg cagtgctcgt gagtgtcggc gtgggcggag cattcgtcgc cgcaggcttt     28080
     gcaggcggtg gcgcatgcct cgaggatcgc gcgtgtgatg ttggcgtcgt agccggtgtg     28140
     ccgggacagg acggatgcgg tggcgttgca gatgtctgcg cagtccatgt cggtgcggat     28200
     gcacttggtg agttcgccga ccatgccctc cgaaaggcag gcgtccgcgc acgcggtaca     28260
     cgcctgggcg caggcgatgc attcctcgat gcacttggtg agcttgtcgc ggtcgacgtc     28320
     gccgaggtcg gcgggggtag gtggcaagca tgtccttgac cgtggtcatc aggtattgcc     28380
     tcctttcgct ggcggatgcc gggctggccg ggacggccgc gcctccttcg acctcctgcc     28440
     cttgtgggta gccaccgcga aacgacgcaa acgcgccccg tggaccgtcc cgcaagcagt     28500
     cgaggccacc tgtcggcgta ctcgacgtgg tgatcgggtg gcgggcgagc gaaccaactg     28560
     tcggtgggcc agatcctgct gatggacaac ccgctgctgc gggaagcgtt gcggccgcaa     28620
     cacatcaagc cgcggttgct cggtcactgg ggtacgacac caggtcttca ctcgaacgag     28680
     tccggcggca acggaattca cgcgcagcag gcggatgtcc ggctcatcga cgggcacagc     28740
     ctttctcggt tgccctcgga cccggccgcc gcgctctacg cgatcacccg cgtcgcctcg     28800
     gaggttccgg tgtgcgcggg tttcggtatg gggagccgga gtcgtttgag ggcgagggcg     28860
     ttgacggcga cgatgaggct ggatccggac atggacagtg cggcgatctc cgggcgcagc     28920
     atcaggccga aggcgggttc gaagacgccg gcggcgatgg gcagggcgat ggtgttgtag     28980
     ccgatggccc aggccaggtt ctggcgcatt ttgcccagtg tgccgcggcc gatgcgcagg     29040
     gcggtgggca cgtcgagcgg gtcggatcgc atgagcacga catcggcggt ttcgatggcg     29100
     acgtcggtgc cggcgccgat ggcgatgccc aggtcggctt gggcgagggc gggggcgtcg     29160
     ttgacgccgt cgccgaccat ggcgacctgg cggccgctgc gttgtagttc ggcgatcttg     29220
     gtggctttgt cgccgggcag tacttcggcg atgacggtgt cgatgccgag ccgctcggcg     29280
     atgcgtttcg cggtggcttc gttgtcgccg gtgagcatga ccacctcgac gccgaggtcg     29340
     tgcagcgcgg cgacggccgc cggtgaggtt tcgcggggcg cgtcggcgat gccgatgacc     29400
     gccgcggcct tgccgtccac ggcggcgatc accgcggtgc gtccggtggc ggccagttcg     29460
     tcgcgacgtg cggccagcgc gccgaggtcg atgccctctc gttcggccag ccgccggtta     29520
     ccgacgacga cacggcggcc ctcgacctcg gcgatcgcac cgtggccggg gacgttctcg     29580
     aacttttcgg cccgaacctg acctacccct gcgttttccg cgtagcggac gacggcctgg     29640
     gcgagggggt gttcggattc gcgttccacc gcggcgatca ggcgcagcac ttcggtttcg     29700
     ccgatgccgt cggtgatgac gtcggtgacc tcgggttcgc ccttggtgag ggttccggtc     29760
     ttgtccatta ccaccacctg gatgcgggct gaagtctcca gtgccatcgc gtttttgaac     29820
     aacacaccgc gtttggcgcc gagcccggtg ccgaccatga tcgcggtagg ggtggccagc     29880
     ccgagggcgt ccgggcaggt gatgaccacc acggtgatcg cgaacagaat cgccgccgag     29940
     aacgggcgat cggacaacag cagccaggcc gccagcgtga cgccaccacc gatcagcgcg     30000
     acgaacacca gccagaacgc cgccttatcg gccagacgct ggcccggagc cttcgaattc     30060
     tgcgcttcct gcaccagttg cacgatctgc gccagagcgg tgtccgcacc gaccttggtc     30120
     gcgcgcaccc gcaaggtgcc gttggagttg atggtcgcgc cgacgaccgc cgcgccgggg     30180
     gccttgtgca ccggcaggct ctcgccggtg accatcgact cgtcgacctc gctgtcaccg     30240
     tcctccacga ccccatcgac ggcgatcttc gcgcctgggc gcaccagcag cagatcaccg     30300
     accgcgacct cggcggtggg aatctcgacg ggttcgccgt cgcgcagcac cagcgctttc     30360
     ggcggcgcga ggtcgagcaa ggtgcggatg gcgtcgttgg cgccgccgcg ggcgcgcatc     30420
     tcgaaccagt gccccagcag cacgaacgcg gccagcacgg tggcagcctc atagaacact     30480
     tcgccgccgc cggtcaacgt gatcaccagc gagtacagcc aacccgagcc gatcgccacc     30540
     gcgaccagca ccatcatgtc cagcgtgcgg gcccgcagcg cccgcccggc gccgtcgaag     30600
     aagatccacg acgaatagaa gatcaccggc aagctcagca acaacgccca gatgtcttca     30660
     cgcagcccga acggcaccgg cacgtccagc cccagaacct ccctgccgat gggcgaccag     30720
     atcacgatcg gaatcgagaa cagcaacgcg accaggaacc ggttgcgcat atcggccacc     30780
     atggctgcca tcgacatccc ggcatgcccg ccgtggccca tcgcctcgtg cggggaacgg     30840
     aggtcaccgg taccacccgg gtgtccctcg tgagcagggg ccgccacggc gtgtccggca     30900
     tcgtcgatgg gttccgcggg cgccagctga ccggcgtgtc cggtgtgctc gtgatacccg     30960
     tcgccggagg gtgggtccgg ttcggtcagg ggatcgcaca ggtgggcggg caccgagcgt     31020
     ccggcgcagt ggtagccaca ttcgacgacc cagtcccgca gcgccgcaat cgtggtctgg     31080
     gtctggtcgt agaccacggt cgcggtctgc gcgaccgggt tgacctcgac tcgatgcacg     31140
     ccggggcggc gagcgagccg ggcgacgaca acgttctgct gcgaggcgaa cagcaggcca     31200
     cgcacatcga gcacggcggt ggctcgttcc ttcggcgggg gcagatgggt atcggaatgg     31260
     gttgtcacgg ggtcactcct ccagaggccg gtagtcgacc gtatcggttg cggacagtgt     31320
     ttcggcgcgg gatggacggg cagcgcgggc cacgaccgcc agaccggcca ccacgatgac     31380
     gtcgccgatc acgccggcga gggtgatcgg ctcatcgagc accaccaccc cgaggatcac     31440
     cccgacgacg ggaaccagca gcgtccacgt cgtgaccgcg gtgagcgagg cccggcgcag     31500
     ctcaccgaac cacaacagat acggcagggc agttgccacc agcgcgagta ctgccagagt     31560
     gagcgtgaat cgactgctcc acgcgatcgt ggtgggcggt ccctcgacca cgcacgcgat     31620
     tcccgccagc acggtgcctc cgagcaagaa ctgccaggca cccaacacca gcaaatcgat     31680
     gctggacaac cgccgcgcca gcagggcacc caccgcgatg ccgaacgccg ccaacaacgc     31740
     cagaccagca ccacgaccac cacccgacgg tgccgcgata atcaccagac caccgaaacc     31800
     gacagcgaca ccggtgatcc cgagcaaccg cggccgctca ccgaacaacc accacgcggg     31860
     cagcaccacc agcagcgacg ccgagttgct cagcaccgac gccaccccgg tggtgacgcc     31920
     ggtgatgctg gcgaacatcg caccgaacgc caccgtcaca ttcagcaacg ccagcacccc     31980
     gatcagcgac cacacggcag caccgcgcga aaccagcagc gccaccctgc caccgcggcg     32040
     accagtaagg ccgtcgctgc gaccagggcc cgcagtgccg cgaaccacag cactggcgca     32100
     tcgccgaccc cccacatgat caacgtgaag cacgatcccc atgccaccac cacgatcagc     32160
     atccgcgccg gtcgcgcacc ggcccgaccg gccgagaccg gcaagcctgc cgtaacggta     32220
     cgatgatctg cgcgcatcga cgcgtccttc ccgatatgga acaccgatca gtcgaccacg     32280
     atcaatgggt aggccccgtc acggtgtgac gcaggtgccg cgtccgatgg cgaggcaacg     32340
     ggatcgaatc gagcgcagcg ctggctcgcc ggaagccact ccgcgcaggg gccggggcct     32400
     catcgaatac gtgagcgcct ccggctacat gcaggcaagc ggtagtgggt agccgccgtt     32460
     cccgggcaca aactctgcgc attgtcaaag gggtcggagc ggggcggtcg gcgggactgt     32520
     catggcaccc tccaaagcgc tacccggccc ttactacccg gcgccaccgc tcttcgtccc     32580
     tcggccggag ccgatatcgc cgcgcagcgt agccagccgc tgatggtatt catccgcatc     32640
     gatctcaccg cgggcgaatc gctcggccag cacctgctcc gcactcgggc gcacgatcgg     32700
     cgcgccgccg accggcgcgg agggctgggc caggtaccgg actgtcagaa tcaccccaac     32760
     gatcaccaac gcccagaaca acaccatccc gacagtcatg agcccgtaac cccacccgct     32820
     catcccgtcg ccgtaccaga acatcatcgt gcactcctcg atcgataaga actcacctcc     32880
     gcgtcgggac agccctataa cctgtcgtgt cggcgggggc gagcgctccg tattctctac     32940
     ggtccgcgtc gctgagcgcg gccggtagag accaggtgcc cttccggcgc acccgaaggt     33000
     ccctaccccc agtaggtctc attcacggga ggggagggtg acgttgcgtt cgcgctcacg     33060
     tgtgacgtcg gcgcggatgg tggccaagcg cgaacgcggc catcgatacc cccaatagcc     33120
     tcgcgggcat gcagccgccg cgcggtggcg atgatgcgtt cgcgcggttg cttcggcatc     33180
     gatacgcaac tcggttcgtg tggctcggca ggggtgagcg atcctgcgtc gtggtgacac     33240
     cctcgtcatg acgcggctgg accgactcgg ccgctcggtg ctgcacctgg tcactctcgg     33300
     cgcggaattc cgtaacggct gtgccgacaa cattcccacc gtatccggaa gccgggtcga     33360
     catacttgcc ggcctgcacc tgcctgacca agggcgttct tgcccgcgat caggtcggcg     33420
     acccctccgg gcagcccgac cgcgaccggc ccgcggaacc ggtcggccgc cgcccgcggt     33480
     gcgccgggcc gcaggccgct gcgtgcccgc ctccagacgg catcgcccaa gaggtccacg     33540
     cattactggt ccctgaaccc ctgttcaggg gcatcagaac gcgaattcgg tgccgtaacc     33600
     tgtcgtttgc acagtgccgc tggtgggatc agcgcggacg atgacgaacg gcatggccga     33660
     gaccggtgat aggcatcccc cgacgttcag cgcggtattg gagtgcgcga aggtatacgg     33720
     gaacgttgag ttctcgtcca gggtgactcc gccgactact gccgcggtca cagtgcccgg     33780
     ggccagattc accgcaagcc ctccggtgcg gccccctccg acaccggtac cgacgctgat     33840
     accgggcgga gcgtctatca ccagatcgat gccggagtcg aggccgaaag aaggtgagac     33900
     tctggcgatg acgccggcct tgggggggac gcctatcgag atgccgttgg aaatgttcac     33960
     ggcgcagccg accagatatc cggcgacgat ctgcccgcct ggcagcgacg aggctccgtc     34020
     gagatcgatc gaatactcgc cggacgtcgt gaccgcgtgc acgaaaggta tgccggatac     34080
     gacatcaccg tcagcgggta cgacattggt ggaacctacc gacgcgatca ggcgcagccc     34140
     gccggaactg aactcccccg gtgccgcgcc gaccgcagta tcgacaacgg caactgcacc     34200
     ggtggcggcc accatcaccg ccgtgatcgc cgccagaatc agcgaatgct tgtgtttcat     34260
     cacgctccag tcgagtagtc atcgagacga aacttcacaa aaggacccgc acagcaacta     34320
     tcgttgcgca tggtgttcgg cgtgtgcgga ccgaaacctt acccggtggg tgcagctcag     34380
     tcgccgccat cgtgccgcaa cagcggtgat ggggcagtgc tgcatggcgg tggcggtgat     34440
     ctacccgacc aaggcggtga cgacgaagtg gcagtccgtc ggcggcatgc ctgcttcagg     34500
     caaccgtaag ggccgccggc ccggcgcccg cagacagccg cgctcgtagt ttgaagccga     34560
     tgccgtcata tcgtgtgacc ggggccgatt tggatgatca acgaaaaaag attgaacgtt     34620
     gtattccagg tcggaccaaa atgaaacaag tactccacca cagtgctctc ctatgctcgg     34680
     cgaatcacac ggctgatgag tctgcagctt gtgtcgtgag tatgactcca atatggccca     34740
     gtgcacccac tgacacgaga acatcatcgt tgcacttctc gatcgctgcg aactcaccgc     34800
     tgtcgtgtcg tgtcgcgaga tccccatacc gctgccgcgc cggccgtggc gagcgcccca     34860
     tactccctac ggtccccatc gccgagcgcg gccggtagag accaggtgcc cttccggcgc     34920
     acccgaaggt cccggtaccc cagagcagac ctgctacata cgctgctgcc cgctgccacc     34980
     gcaggcaggc gggagcccgg cgcatacgga acggatgcga gtgctgcatc gacctcagca     35040
     cctcgtcagc aacctatgcc aggaggtcga atgccggagg gaccgtcgga gatttacgac     35100
     agtccctgcc ggacgcgtcg gtcgcgacgc cacgatcacg ctcacccgtg gagccgcgcc     35160
     ggggcgtgtc acatcggctg catcatcatc gggcaaccgc ccatcaggct gcacatccac     35220
     tggcacaaca tttgcatggg gttcattacg tcgatttcct ctcgggggtc gtcgaccgat     35280
     ccgaccgcag ggtggcgggt ccgccgggtt ggtcgtgcgg tgtcgttgag gttgccgcat     35340
     cgataccccg cacgggtagg gacctttgac ggtcggacgg aggtccttcg atgccgctcg     35400
     aggctacctc gtcccatccc ggcaaccggt gtgccagcgc agaccggagg tgatcgcgaa     35460
     agaagggaat gcgatgaaca ctcggtatct tccgtggtac gcgctcgcgt tggccgtgct     35520
     ggtcgctggt ctcgccattt cgggcgtgcc ggtctcgacg ctgctgctgc tgctcgtcgt     35580
     actggcctgc ccgctgatga tgatgttcat gatgggcggc cacggacacg gcggcaacga     35640
     cgagccatat gagatgggca aacgccatga ccatgacccc acttccggcc ggtcttgaac     35700
     gcccacagag gtgtatgagt tacttcggag aactccgtga ccactgagcc caccacagcc     35760
     gaggccacgg cggccgagcc tggcaccgca gtcacacgag acacgacgct gtcgccactg     35820
     ctggcggccg aggggctgga gaaggcttat cgccgtacat ccgcggatac ccaaccaacc     35880
     gccgcgtccg gttcagatcg tcatgaaccg aaccaccatc acctccccgc cgccacgacg     35940
     cccggtagcg gggagccgcg cacgattgcc ggtatcacca cggccacccg gcagatcgct     36000
     gctgagaaac gacgagtcca cactgaagag gacttcgaaa atcactgaag gtgacttcga     36060
     aacgtgacat ccgaggtgct gacctgcgaa ttcgtggtgc tgactccgga taactgccat     36120
     tatccggagt cacaccaaaa aacactacgg tgagataccc tcacgcagtg agattcgtca     36180
     tctcgatgtc agttggcgat ctggggattc gtcactcgtg tcagtagcat tcgtcacctg     36240
     atgtcagtaa agacctgttc aagccctgta ttgcagatga ggcgacgagt cgaaatcgtt     36300
     cgtagaacct cttcagagat gtcagtaatg acgagtcacg actgacattt cacggtcgcg     36360
     gcggagccgc tcatgtagcg gtcgacggag gcgacagcgt caggctttga cgaagctggg     36420
     gcgcgcgttt gccgatcttg gtcagggcgg cgtcggcgcg gggtggattg cagcggcgcc     36480
     aggatcggga cggcgatctt ccatgcgtcg actgcgccgc cgtggtcgcc gttctcccat     36540
     cgggccatgc ctacgtcggc tcaggtacgc ccgtagacgc ggtggtgtgc cttgggatcc     36600
     cagaaggtgg gtggccagca gatgatgcga ttccgcagcg ccccactcgt tgagcgctcg     36660
     cagggttttc gctcaccaac atggtcggcg tcgatccatg gttcggtcac ccggagtgct     36720
     tcgtgggctt ggttgcggtc acctcccggc ctaccggacc gaacgggccg caaccatgtc     36780
     gacgacgagg ttcgcgcgcg atcggcctcg cgcgatcgta ggacgaattc gtttcgatcg     36840
     tgcggaacag aggtgaccca ccatcaggcc cgctcgtctg cgctacgacg tgggcaccca     36900
     ccctagtggg agacctgaaa ccctacttca cctgcataaa cccggtcatc cacggccagt     36960
     cgatcgccga catcgacaca acatcgacaa cttacggaga cgcccatgtc gtcaccacca     37020
     acccgggcac cctcagatcc cggtgtttgt gtcggggcgg atgctgggcc gggtcggtaa     37080
     ccaccagttc cagtcgccga gcaggcgcat gagggcggga acgaggacaa ggcggatgag     37140
     gacggcgtcg aggaagactg cgacggcgag ggcgagtccg agttgtttga gttcgagaat     37200
     gtcggcggtg aggaagcttg cgaagatggc gatcatgatc gcggcggcgg cggtgatggg     37260
     gcgggcggtg tgagtgagcc cggcggcgac ggcgtgctcg ttgtcgccgg tggtgtccca     37320
     gtattcgcgg atgcggcgga tgaggaagac ctcgtagtcc atcgagagtc cgaacaacag     37380
     cgcgaacacg acggtgggta ggtagacctg cacgaagccg gggctggtga agtcgaggat     37440
     gttctccccg aggccccatt ggaatacagc gacggtgata ccgagggcgg cgccggtggc     37500
     gagcaggttc atcgcgatgg ccttgatcgg cagggcgatg ctgcggaacg cggcgatgag     37560
     gaagatcagc gaggcggtca gcaccagggc cacgaccagc ggcagtttgg aggtcatctc     37620
     gtcggagagg tccacgaact cggcggtgct gccgccgata cggatctcgg ctcctgccgc     37680
     gtcagtcgct gtgttgcgca ggtcgcggat gaggtcggtg gcctccatcg agtcgaacgc     37740
     gaccgacggg agcgcaagcg ccagcactcg tccgtcgttg agctgggcgg gcagaacggt     37800
     gtcgatgcgg tcgtcgtcgg cgatctcggc caggaaccgg ttgacctgtg ctgcggggtc     37860
     cccggtgagc ggggtgtcgc cggggccggt ggcgatgatt tcgaccggtg agagtgctcc     37920
     ggcggggaag tttgtggtca acgcggtggt ggcgcgtccg gtcggtgtgt cgtcgagggc     37980
     ggtggtgccc atgtcgaggc cgtagcggat cccgaatacc gggagtgcgg cgatgaccag     38040
     caccgccacg gcagccgtgc cgaacaggac gggtcggcgc atgacgagat aggcccagcg     38100
     cgcccagcgg ccactgagag ctcccggagc gttcgcggtg ctgtcggcgg gtcgccagcg     38160
     ggcggggagc gcgccgcggt tgatggcagg gcccagggcg gcgagcaggg cggggagcag     38220
     agtgacggcg acgatgagca tgctggtgac cgcggtggcg acgccgatgg cgatgccacg     38280
     gaagatcggt gcctggataa tgatcaacgc gcacagcgag atcatcacga ccaagcctga     38340
     gaccagaatc gttttgcctg ctgtggccag tgagcggccc acggcggccg cgatcgcggc     38400
     gtggtcggcg acggtgtggt gggcgagttc ttcgcggaag cggctgacga tgaacatcgc     38460
     gtagtcgata ccgacgccca ggcccaccat ggtggccatg gcaacggtca gcgaatcgaa     38520
     cgcggtcacc gtggtgaggg tgaacaacac cccgaccgcg gtcaacaagc ccgcgatggc     38580
     tactccgatc gggaccgccg cggcggccag ggcgccgagc gcgaggacga gcagtatcag     38640
     cgcgaccggg atgccgatcg cctcggcgcg ggccaggtcg gcgttctgta gttcggtggc     38700
     cgcgttctgc accgccgagt acccggtcag ccccacatcg atggagtcgt cgccggtgct     38760
     ggcgatggcg tcttgcaggt cgcgagcgac cctcgcgcgt tcggccatgt cgccgtccat     38820
     gccggccagt gcgatcgcga cgtgaccgtc ggccgagatc tgggatccgg gcagcccgtc     38880
     gtagggaccg acgacatcga ccacaccctg cacctcctcg gccgcggtga ccgtgcgagc     38940
     gacgactgca cggaagtcgg agtcggtggc ggtgagggcg ccggattgga gcacgatgac     39000
     cgcctgctcg gccccgaact gtgggaagtg ctgggcaaca aggcgatcca cctcggtgga     39060
     ctccgagcct tcgacgccga agtccatggc gccgagccgg ttctcgagta gtgggtaggc     39120
     caccgcgcat accgccagca gcactcccca gatcgccagg gccgtgcgtc tgcgtcgcgc     39180
     catgagaaca ccccaccgat acagcagccc gggtgagtca ggtggcagtg gttgctgggg     39240
     tgacctctcg gtcacggcgg actgctgctg ctggttcatg tgttctccct ccgtagccga     39300
     ccacaattga tcgctagtgg acgatgtgat cgttgaaatg agattaatca tgatagctgt     39360
     cgatatcaat acccagttcc gctatcatcg ccgtatgacg attaatgctg acgggggttg     39420
     cctcgtcgag acgcaggggt tggatccagc ggtggcgttg ttccacagcc tctcggatgc     39480
     gacgcggttg gcgatcgtgc gccggttggc gtgcggggaa gcccgcgtcg cggatttgat     39540
     ggcaggtctc gagttggcgc agtcgacggt gtcggcacat gtggcgtgcc tgcgcgactg     39600
     cggcctggtc gtgggccgcc cccagggccg acaggtgttc tacagtctcg ctcgtccgga     39660
     gctgatggac ctgctggcat cggccgagac gctgctcgcg gcgaccggca acgcggtggc     39720
     gttgtgcccg aactacggca ccgacgccac caccacggag acgacggcgg aggtgcgggc     39780
     atgagcgacg catgcggctg cggccacgac gaacccgctg gtgagggcga ggccgaggag     39840
     cgggaacccg aaaagctctg ggaagtcagc gaactgcgtg ccgccgcggt cgccggtgtg     39900
     ctgctggtcg cggcgctgat cgtcggctgg accggtggcc ccagcgcggt cgagctcggc     39960
     ttggagatcg cagcgctgct ggtcggggct tacaccttcg tcccgtcgac gttcaaacgg     40020
     ctggccaagg gcaagatcgg ggtcggcacg ctgatgacga tcgccgcgat cggcgcggtg     40080
     atcctcggcg aggtcggcga agccgcgatg ctggcgtttc tgttctccat cagcgaaggc     40140
     ctcgaggaat acgcggtcgc ccgcacccgc cgtggtctgc gggccctgct gaacctggtt     40200
     cccgaccgag ccacggtgtt gcgcgacggc accgaaacca tcgtcagccc agcggagctg     40260
     cgggtcgggg accggatgct ggttcgtccc ggcgagcggg tggctaccga cggtgtgatc     40320
     gccgaaggcc gtagctctct ggatgtttcg gcgatcaccg gtgaatcggt accggtcgag     40380
     gcagggccgg gcgcggaagt gtttgccggg tcgatcaacg gcaacggcgt tcttaccgtc     40440
     gaggtcacca ccaccgccga agacaactcc ctggcgcgga tcgtgcggat cgtggaggcc     40500
     gagcaggccc gcaagggcga tgcccaacgc ctggccgaca agatcgccaa acccttggtg     40560
     cccggcatca tgatcgccgc tgccgcgatc gcggtgatcg gtgcgatcct cggtgatccg     40620
     gtgacctgga tcgaacgcgc gctggtggtg ttggttgcgg cgtcgccgtg tgcgctggcg     40680
     atctcggtgc cggtcaccgt cgtcgctgcc atcggtgcgg cgagcaagtt gggtgtgctg     40740
     gtcaagggcg gtgccgcgct cgaggcgatg ggtcgggtgc gggaggtcgc gttggacaag     40800
     accgggacgc tgaccgcgaa caagcctgcc gtggtcgaga tctcggctgt cgcgggcacc     40860
     gagcaggcga cagtgctcgc ggtcgccgcg gcgctggaat cgcgtagcga acatcccctc     40920
     gcccgcgcca tcctcgccgc cgtcgacacc ttcactcctg ccaccgacgt cgaggccgtt     40980
     accggcgctg gattgaccgg gctggtcgac gggcgtccgg cgcggctggg ccgacctggc     41040
     tggatcgagc cgggtgactt ggccgccgac gtggagcgga tgcagcacgc gggtgcgacc     41100
     gcggtgctga tcgagctcga tggccaggtg atcggcgcga tcgccgtgcg cgatgagctg     41160
     cggccagaag cacatgaggt catcgatcgg ttgcacgcct tgggtattcg tgtgtcgatg     41220
     ctcaccggtg acaacacccg caccgctgcc gccctggcta ccgaggccgg gatcgaggac     41280
     gtgcacgcgg acctgcgccc cgaagacaag gcccgcatcg tgggcgaact acgcgccgac     41340
     cggttcaccg cgatggtcgg cgacggcgtc aacgacgccc ccgcactggc caccgccgac     41400
     ctcggtgtgg cgatgggtgc gatgggtacc gacgtcgcca tcgaaaccgc cgacgtcgcc     41460
     ctgatgggtg aagacctgcg gcacctgccg cgtgctctcg agcacgcccg ccgcgcccgc     41520
     cggattatgc tgcagaacgt cggtttgtcg ttggggttga tcacggtcct gatcccgctt     41580
     gccctgttcg gggtgctcgg gttggcggcg gtggtgctgg tgcacgagct cgccgagatc     41640
     gtcgtcatcg ccaacggtgt ccgcgccgga cgcaccaaac cccttgcctc gcttccggaa     41700
     tcgacggcaa agcccgcccc ggtgctggct ggagcatccg cgtgaccgcc accgcgtcgt     41760
     ctgctcccac cgtgtcgcgg tgggggcggc gactgcggtg ggccatcacc gcggcggtac     41820
     tcgccggcct cgacctcgcg ctcaaagcgt gggcgcagac cgcgctggac ggggcgccgg     41880
     tcgaggcggg tccggtggat ctgcggttgg cgttcaaccc cggcgccgcg ttctcgatcg     41940
     ccgccgacgc accgagctgg gtgatgctgt ccatcaccac ggtgatcacc actggggttg     42000
     cggtgggcgg atgggtgctc gcgccgcgcg cgagcctgct cacccgggtc gcgctcgccg     42060
     caatactggg cggtgccgcc gccaacgtta tcgaccgggc accggacggg ttggtcaccg     42120
     actacttgca caccggctgg tggcccacct tcaacctcgc cgactccttc atcgtgctcg     42180
     gcgcgatcgc cctcatcatc accaccttga tcggaaactc cgatgagcga gaacaactct     42240
     cacccgatca ccacaccgac aagcgggact gaaccgggcc catcgcgtcg atgggcaggg     42300
     ttggcggcgc tggtcgtcgc cctgctcacc gtcgggctgg acctgatggt cctcaacgtc     42360
     gccctgccca ccctcgcgca ggacctgggt gcgagcacca cccaattgca gtggatcgtc     42420
     aacgcctaca ccctcgtctt cgccgcgctc atgctgcccg caggcggctt cggcgaccgc     42480
     tacggccgca aacggctact gctggtgggt ttggtcgcct tcgtcgccgc ctcggcgtgg     42540
     gccgcctaca gcgggtccac cggctcgctg atcgcagcac gcgcggtcat gggcatcggg     42600
     gccgcgatca tcgtcccgct ctcgctgggc atcctgccga ccctgttcgg ccccgaccag     42660
     cgtcgccgcg cgatcgcggt atgggtcggc gcactgggcg tcggcctgcc attgggcccg     42720
     atcgtcggcg gctggcttct gcagcatttc tggtggggct cggtgtttct catcaacgtc     42780
     ccggtcggtg tcgccgccct ggttgcctgc gttgtgctgt tgcccgaatc ggccgacccg     42840
     cacgcaccgc cgctggactg gctcggaatc atcaccgccg ttcccggtac ggcggcggtg     42900
     gtgttcgccg tcattcaggc gcctgagtac gggtggaccg atcccatcgt gctcaccact     42960
     ctcgccgccg gtgtcgtgct gatcgtggga ttcctggtgt gggaacggca tactcgctac     43020
     ccgctggtcg atctggggct gtttgccaat cccgcattca cctggcccac tctggccgcg     43080
     acggcgggca cgttcactct cgtgggcgtg ctgttcgtgc tgccgcaata cctgcagatc     43140
     ctgcgccact acgacgcctt cggcacaggc ttgcgcttgg ttcctttggt gctggcgatc     43200
     atcatcgccg cggccgccgt cgacaagatt gtcacccgcg tcggcgccaa gatcccgatc     43260
     gtcaccggaa tgctcatcgc tgcagcggga ttcgtgctcg cgtcccgcat cactgccgac     43320
     tccggctacg gcttcgtcgc ggtgtgcctc ggggttgtgg gcttgggcgc cgggctggcg     43380
     ttggcaccgg cggtcgacgc ggtcatggcg agtctgcccg aacaccgcag cgccgcagga     43440
     gctgggttgt tgatggccat tcgacaggtc ggtgccgcgt tcagcgtcgc cgtcttgggc     43500
     accttgctca ccctcgtcta cacccgcgac ctcgaccccc acctgagcgc gctacccgag     43560
     gctgtggtgg gcgcggcgcg cgacaacgtc gctggggcac aactggccgc gaccggcgtt     43620
     cccggcccag cgggtgccga tctggccgcc accagcgccc acgcctacac cgaagccatg     43680
     tccgcggtat tcctggccag cgccgccgtc agcgcggtac ttgccgcggc tatcgccgcg     43740
     aaactcccca aacagacgcc accgccgata ggaacgtcac cggcgcccgg tccgcgatga     43800
     actagacagt cggtagcgag ccgccgcggg tgcagctcaa ccacgcctgt tcgccgaatc     43860
     acagtgcact ctccgagaaa ggcatccgcc agcatggtta cctcgatcct gcaggccatc     43920
     ggactcttcc tggtgaccaa tatcgacgac atcatcgtgc tctcgctgtt ttttgcccgc     43980
     ggcgcgggaa ctcgcggaac cacggtcgcc atcgcgacgg gacaatatct cggtttcgga     44040
     gcgatcctcg ccgcgtccgt cctcgtctcc ctgggtgtga cggcgttgtt gccggaagaa     44100
     gctatcgcct acttcgggtt gattcctctg ctgctgggtc tgctcgccgc ctggagagcg     44160
     tggcgaaaca gcggcgacga cgatgaacgg ttcgagggca agaaggtagc agtgtggacg     44220
     gtggccgcgg tgaccttcgc caacggaggc gacaacatcg gcgtctacgt cccggtcttc     44280
     gccaccgtgg gaacggcagc gatcgtcgcc tactcggtcg tgttcctgct gttggtcggg     44340
     gtactggtga tcaccgcgaa gttcctcacc acccgcaagg ccattgccga gatcttggaa     44400
     cggtgggaac acatcctgtt cccactcgtg ctggtcgttc tcggaatcgt catcctcgtc     44460
     agcggcggcg cattcggcct ctgatcggat accactcaca tatccgcgca accagatcac     44520
     caggatggga gcacagcagg gtgacttgcc tctacccgcg ctcgagttgc cgaccgctgt     44580
     ccggccgcga ccgcagacgg ggcgtgccga ggtgagcgcc cccgagcatc gctggtcagg     44640
     cggcgtttcg ctgactcccg gtctcatgac attcaccggc gagatcggcg acgcacctgc     44700
     ccacgcgcac gccgccgtgc aggtgctctt cgtcgcgcgc gggcgactga ccctcaccga     44760
     cgcgaccgga tacaccacac ccgccctcgc cgcgatcatc ccacccggcg tggtccacca     44820
     ggtccacacc gaacccggta ccagcggatt cctcgccttc ctggaccccg acagcgcgac     44880
     cgcccacgca gcgctggccc aactggacgg gcaaccccgc caggcagcca ccacctgggt     44940
     cagcgccgcc acacccgcac catccctgtc tgtcggcgac ccggtcacca ggcccgtgcg     45000
     ccggtcctcg catccggtcg tggcgcaggc gctgcgccgg gcaaccgact gggtgggagg     45060
     gccaccctcg ctgggtgaac tcgccgccga catcggaatt tcggtcagtc gcctctccca     45120
     tatattcacc gcgcaggtcg gattgccgta tgtggcgtgg cggcggtggg tgcggctaca     45180
     gctcggattc gcggtcgtgc gcggcggcgg ttccctgacc gccgccgcgc acgcagcggg     45240
     attcgccgac agcgcccacc tcacccgcac ctgccgcgac ctgatcggca tctctccgac     45300
     cgaagcactc atcgccaccg gatggcggcc cccaccagca cgcgaccgag ccgtcaccga     45360
     ataacgcgac tcccggcgcg cggactacct cactgcccgg ccacaggcac ctcgcccggc     45420
     acagtttcta ccgagccagg gggcaccggg gacggtgccg gtgcagcatc tgccggtgcc     45480
     ggtgccggtg gagcttctgc ccgcgtaggt gtcggggacg cggcagattg cgtcggatga     45540
     tcggaggccg gttggggcag cccgagtgtg gtgacgacac cggtcgcctc gttgaacacc     45600
     aacgacccgc gaccgaaatc gacccgcaca ccacccggga cgggatactc gttgctgcgc     45660
     ggcgcgccca gcacgccgtt gtccccgccg agctgggcga accgttgccc gatgcgcccg     45720
     gctacttcat agacctgacc gtcgggggct tggaacaggt acccgttgac gaacctggcg     45780
     tactgtccgc cctcggcagt gggcaccggc tccgaggcgg ccaaccccag ccgcccctgc     45840
     ggtccaccgg catcgaccca acgccgagcc aacacattgc ggtcgaccag atccaacagt     45900
     ttgcccgtca acaccgccaa cgccgacaca tcagcatcag catcggcatc gggttgcgca     45960
     ggcgccggtg ccgaatcctg gccgcccggt gcctgtctgg gccccgcccc cgaactcaca     46020
     cccgccgcga tagcacggat acggtccatg agcgcatagg cggcgtcccc ggcgcaggtg     46080
     gtgttaccga catcgcggtg ggagaacacc accggcaact gcacctgttc accctcgcca     46140
     tacggagtga attcggtgcc ctcggagatc atcgtggtgg tccctcgagg atccaaaccc     46200
     gcaacacgag cacgccaccc gatgaactga cccatcgcgg tgatcgccgc ctgggtcggt     46260
     tcctcggact cgtgatcacc catgaacgcc accccggcgg tgttttcgtt gaacccgccc     46320
     gtgtgcgcgc cctgcacggg ccggtccaaa ccaccgaaat gtccttcgaa gatctggccg     46380
     tatttgtcga cgagcgcgtg gtagccgata tcgcaccacc ccaacgtttc ggcgtggtag     46440
     gcgtagatgc cgcgcacgat cgccgcggac tcggctttgc tgtagtcgtt gcggcctgcg     46500
     gtgtgatgca ccacgatccc gcccaggccg tcgtcgtagg tcgggtcctc acaccggatc     46560
     gattcatcgg cgccccactg ggcgcggctg atcacccggg gcccgccacc ggtcagcgga     46620
     gccgcgatcg ccgacaggtt ctcctcacca cgaccgggat cgagcaacac cgcgctcatc     46680
     tccgggactg cgagcccgag atggtcaggg cccgcgaccg gggtaggtcc ctgaaatccg     46740
     ggttcggccg tggcggtagg ttcgtgggtg cttaggattt gcaccgcgtc ggtgtcaccc     46800
     acatacaccg gttcactacc ctgcatgcgc cccgggccgg gcgacgagcc gaaatactgt     46860
     cgtcggtccc ggcctcgaac cacggacccc aggaaccgtc gagttggcgg gcccgcacca     46920
     tcgtggtgac accctccaga ttcggcgcgg tcaacccgat catgctgaaa cgactctcgc     46980
     gggtgagttc tgtgacctgc gcgccgaccc gatcgaccag ctgctcgggc accacacccg     47040
     gatccaacgc cggagtccgg gccgatatcg gcgccgcccc cgcggcggca acaaacccga     47100
     tcggcccgac ccgggaaccc tccggaagcg gcggcgcgcc gggtacaagc cgcagatccg     47160
     cgaccctcag gtccggcaac tgcatgccgg ccagctcgcg taacggcaac accaccctcg     47220
     gcgcccccga caaccccacc tgggtggtcg cggtaggcga aactccatcg gcttcactgt     47280
     cgttggagaa ccggaactgc cccccaccac cgaggaaacc ggccgtgacc ggcgccgtga     47340
     ccacagctac cgcgaccagg ggaagcacat aggttcgttt gcgggcgtag ttcggcacca     47400
     gtactcctac ttcggtagaa accgcgatgg cgggtccgaa ccatccgacg gaaccagcac     47460
     caccgatcac accaaccaca accaacccaa agaatgaagt gttacttgag actgtagcca     47520
     gggtgtagcc gtcctctgat gcgacacacg ggccagccgc cagatcgatg agccgtcatc     47580
     ggcacggata gtcagctgat ttcttcaagc ccgccctacc acctgcgcgc gaagctgaag     47640
     ccgtgaccac gctcatctcg cccctgatcc gctacggcta cgcgccggtg atgctgctcg     47700
     gaatcaacgg caccggaata gccctagccg ccaccggcgc cagcaagctc tggctcatcg     47760
     ccctgctcgg gctcgcggtc gcggtctcgt tcaccgccga acgcctcctg ccgtaccaag     47820
     cagcctggaa caactctcac ggtgacaccg gccgcgacac cgcccacacc ctcgtcaacg     47880
     aaaccctcat cctgggcagc gtggccgcca ttcccgtcct ggccgcggtc gtccctggtg     47940
     acgggatctg gccgggcagt tggcctttcg tcgtccaggt tctggtcgcg atcctggtcg     48000
     ccgatctcgg gatcaccctg gcccactacg caagccacaa gatcggtgtt ctgtggcggt     48060
     tccatgctgt gcaccacagc gtgcaacgct tctacgggct caacggtctg atgaaacacc     48120
     ccctgcacca aacgatcgag atgaccgccg gagtcacccc gctgctgctg gccgggatct     48180
     cggtcccggt cgcggcggtc ttgtcactgg cggtggcggt gcagttgctg ctgcagcact     48240
     ccaacgccga ctatcgcgtc gggcctttca aatatgttct ggcactgaat gaaggccacc     48300
     gtttccacca cctgaaatgg gcgggcatcg gtgacgtcaa cttcgggttg ttcaccctga     48360
     tctgggatca cctgctgggc acctacagct acgacccgca ccggcggttc tccagcgccg     48420
     acctcggtat ggctgccaaa cccgactacc ccgtcggcta cctcgcccag ctcgccgaac     48480
     cgttcacccg ccacggcgcc tgcgaaccca cacccgaggc gagcgtcgtg ctccgcgcca     48540
     ccgaacaggc gaagaacgcc tgactctcac ccactaccgc tcaacctgaa aggacatgac     48600
     catggcgaag attcgcgccg ctgcccgcgc ccgctaccac gaagagatgc aggccgcgaa     48660
     caccacgacc gacccggccc gccgctggaa ccatctcgaa cgcgcccaca tcctgtccca     48720
     acccgacccc tggctgcaca ccgccaacca catcgcaatg ttcgccctcg cggtgcgtca     48780
     acgcgaccgg cgagaagccc tcgggcagat catccggatc attgttgccg caccaggatc     48840
     cctggccggg ctcgctccgg aaggcaacac cggtcgcgcg aatgtcggtc tgcgccaaac     48900
     catgaccacc ccacccgatc tcgccgcact gttggatccg agtccaacca ggtagccgcc     48960
     cgttcagggt tgatcggtga ggggtgtcgg tagcatggcc gccgtgcgca atgacttccg     49020
     atttgtctgt ttcgtccgga ggtggatccg atgaccgccc gctcggtatc acgccgcacg     49080
     cggcttctga ccaccgtcat cgcggtgctg gtgatcgtcg tcggcgcggt ggtgttggcc     49140
     gctgcccgca ccgacgacaa tcgcccggga aacagtgtgg aatcgacgac cggcgagccg     49200
     gcgctggcgg tgcgcccgga cagccaccgc ctgtccgggc ccaccgatgc ccgggtgacg     49260
     ttggtggagt tcctggactt cgagtgtgag gcgtgccggg cgatgttccc gatcatggaa     49320
     cagctgcgcg ccgactacag cgatcgcgtc gcgttcgtgg tgcgatactt cccgatcccg     49380
     tcgcatttca actccggccg cgccgcgcgc gccgcgcaag cagccgccga ccagggcagg     49440
     ttcgaacaga tgtatcagcg cctgttcgaa acccaagccg actggggaga gcagcgggcc     49500
     ccagccgacg aggtgttccg gggtctggcc gccgagctgg gtttggacct gggcgcctac     49560
     gacctggcct acaacgaccc ggccacggcc gcgcgagtac gagccgactt cgacgagggc     49620
     ttggcgctgg gggtggtcgg cacccccagc ttcttcctca acggtgagaa gatcagcggc     49680
     ggcagctacc gcgacatggc cgcagccctt gacgccgccc tggattgacc tcgcccggcc     49740
     cggtcttcat gccctggcgc gaccgattcc gggagcgaaa cggccggtgc tggccaggta     49800
     cgcctgatag tcgggtccgt gtacgcgagt caggtagggc tcttcgacga tgcggacctg     49860
     tagctcgatc gtggtcagca gcagggcgaa tccggctacg gccacggggt tgggaatgag     49920
     cagggtgatc ccggcggcga agagcagcat cgcggtgaag atcggattgc ggacgagtct     49980
     gaacaccccg gtgcgcacca gtgtcgtggt ttcggtgtcg tcaacgccga tgcgccagga     50040
     atcgcccatc tggttctggg cgtacaccgt cgccgcgatc ccggccaggg ccgcgacgag     50100
     gccgatcccc tgaatcgggg cagcggtcaa gattgccacc ggcgccacga gatcggccag     50160
     ttgcagtagc ggtgccgcca caccgacccc gatcgcgagg aggaacccga cgccggcgat     50220
     ccattccagc gaacccgggc ggccactgat gccgcggaat ccagtggagc cggtcgcgcg     50280
     gtgctggcgc cagctgcgcc agccgaagcc cagcgcggcg aagagcagat acagggccag     50340
     tgcccaccaa gcggtcatga gtgtttcctc gattggagat gatgtcgaaa tctgtgggcc     50400
     tgcccggttc gggcgaggtc accaggtcgt gttccggcag cgttcggtgc tgccgtcggt     50460
     ttcgatctgc acggtggcgt ggccgaggtg gtactcctcg gccaacagtt gctgggctga     50520
     gcccagtacg gtgtccaggt cggcgtcgcg gtcgatcacc acatgcgcgg aggcgacctc     50580
     catgcccggg gtcagggtcc atacgtgcag gtcgtgtacc tcgcgcacac cgtcgagccc     50640
     gcgcagggac tgctcgatct cggtgaggtc gagttcggcg ggtgcgtgct ggaacaggat     50700
     gcgcaaggct tggcggccga ggctgaacgc gcgcggcagc acgaacagcc cgatcgccac     50760
     gccgatcgcg gggtcggcgt agcgccagcc gaagaacagg gtgatcagcc cactggccag     50820
     gaccccgagc gagccgagca tgtcggccat gacttcgagg tacgcgccac gcacgttgag     50880
     gctgtccttg gcgccctggc gcaggatcag catgctgatc acgttcatcg ccaagcctac     50940
     gaccgccacg atcgccaccg gaagaccagg cacttccgga ggatccgaca gccgtccgat     51000
     ggcctcgtag aggacccagc ctgcgaccgc gaacagcaag actgcgttga acagggcggc     51060
     aaagacctca ccgcgataca tcccgaacga gcgagcccca cctcgggtgg cgtggcgggc     51120
     gatcatgatc gccaccagcg ccatcgacac accgaacacg tcggtgaaca cgtgcgccga     51180
     atccgacaac agcgccagcg acgaggtcga cagaccgacc acgacctggg tgatgaatgt     51240
     gaccaggccc aggccgatcg cgaccgccag tcgggtggtg taccgcgccg aggcgctgcc     51300
     ctgatttgga ttgctcgtgc cgtggctgtg tcctgcgccc atcgtcggaa ctccttgccg     51360
     ctgtggtggc ttcaccatcg cccatacccg acaacatgaa tcttaacatg cgcatgcgtg     51420
     catgttaagt actcggggtg aagcggctgc ttctgcgacc ggccgaaatt ccgggtgcgc     51480
     agggagggct cgccgcctca ctactacgat gcatagtaga agagtgttcg ggcgtgtcga     51540
     gcagtcttgc gaagggatgc atacatgcgg cctcatatcc ggtggcttgt ggttttcgtg     51600
     atcgtgtttg cggcgttggc ggcggctttg tggccgcggt cggattcgac gaccgcgctg     51660
     cccgaaagag tgttcgggca acccgatgcg gcgaccggcc gtatcgaaga tgggccgccg     51720
     caggatcagc gagtcggtgc gccagcgctc ccgccgtgcc cgattcccgg tggcgtatct     51780
     gctggtggcg ggccgctgcg cggtgtgctc gcgcgatgcc tgggctcggc cgaacaggtc     51840
     gatctcggag tcgccctgac cggagaaccg acattgatca acctgtgggc gtcatggtgt     51900
     gcgccatgtc gaagcgagat tccggtgctg aatgcgtacg cctccgatcc ggactcgatt     51960
     cgcgtggtgg ggatcaacgt gcaagacgac cccaccaccg cagcagaact tctagcagaa     52020
     ctacaagcgg gctacccatc cttcgtcgat ggcggcgcgg tgcagaaggc gttgccggca     52080
     cccccggtgc tgccgctgag cttcctcgtt caacgcgacg gcaccgtccg gcgcatcacc     52140
     acaccagcgg ttttcgacaa ccctgcccaa atcgatgcca cgatccgcga gatgacccga     52200
     tgacccacct acgcacgacg aaagccgcac gccatggtca ccgctacggc cgcgcgaggc     52260
     accggcagct ccggctgctg gcggcgatgg cgctggtcat cgccgcggtt accgctgtga     52320
     tcagctgtgc ctcgggctcc gactcggtcg ccaccggtgg cggcacgttc gatttcgtct     52380
     ccccgggcgg gcagaccgat atcttctacg atccgccgga aagccgaggc aagatcggtg     52440
     ttctcgccgg tcccgatctc atggccgagg acaagaccgt ctcggtatcc gactacaccg     52500
     ggcaggtcgt ggtgatcaat ctgtggggtc agtggtgtgg gccgtgccgg gctgaagccg     52560
     acgacctcga acgggcctac gccgccacca aggcatcggg tgtgcagttc gtgggaatca     52620
     acgtccgcga ccagcaacgc gacaaagccc aggacttcgt gattgataac aaggtcagtt     52680
     atccgtcgat ctatgacccg ccgatgcgca cgctggtcgc cctcggcggc agctacccga     52740
     ccagtgtcat tccctccacc ctcattctgg acaggaagca gcgggtcgcg gcggtgttct     52800
     tgcgcgccct gctgaccagc gacctgcagc cagtcatcga gcgcctggcg gccgagcagt     52860
     gaccgcactc gcccaaggca tcggtaccag ttttcaagac gctgccgcga ccgggccgtt     52920
     gttcctggct ctggccgcgt gcatggtggc cggcctggtc tccttcgcct cgccgtgtgt     52980
     ggtgccgctg gtcccgggat atctgtccta tctcgccggt gtctccggtg ccagcgcaac     53040
     gctttcacaa gctgatgaca tcgggccggg ccggagttcg gaccggtggc gcgtggcggg     53100
     cgcggccacc ttgttcgtcg ccggattcac cgtcgtgttc gtgctggcga ctgcctcggt     53160
     gttcggtgtg atcaccgcgc tgcggctcaa tgccgatcta ctccagcgca tcggcggggt     53220
     ggtcacgatc gtgatggggc tggctttcat cggattgatc ccggcgctgc agcgcgacac     53280
     ccggttcgcc cccgtgcgag tgtcttccct tctcggcgca ccgcttctgg gagcggtgtt     53340
     cgggctgggt tggacgccgt gtctgggacc cactttgacc ggagtgctat cggtcgcagc     53400
     cgggaccgag ggaacgaccg cgacccgcgg ggtggtgttg atcgtggcgt actgcctcgg     53460
     tctcggcatg ccgttcgtgg ttctcggatt cgggtcgtcg cgtgcactgc gcggcatcgg     53520
     ctggttgcgg cggaataccc gcaggattca gacgatcggc ggcatcctgc tcattctcgt     53580
     cggcaccgcg ctgatcaccg ggatatgggc gcaattcgtc gcctggatcc gcgacgagtt     53640
     cgtcaccgca gtagtcctgc cgatctgacc caccttgcgt gtgccgccga tgggttcggc     53700
     ccagcgtgcg tggatcagtc gatgccccaa cgctgttcgg tgagcacgcc gttgccttcg     53760
     agccaggcga ccggatcgat cttgttgctg tcctggtccc agatctcgag gtgcaggtgc     53820
     gggccggtgg actgtccacg gttgccgacc gcggcgatca cgtcaccagc gctcacccgg     53880
     tctccggcct gcacgtagta ctcgttgatg tggccgtaga ccgcgatcgt gccgtcgtcc     53940
     tgctgcacac gcacccattg cccgaaaccc gacgccggac cggcctcgat caccgtgccg     54000
     cccatggccg aacggatcgg agtacccaac gcatcggcga tgtcgacacc gtagtggaac     54060
     gcaccccagc ggctgccata tccggagctg atctctcgcc cgaccggcag cactgcgggc     54120
     gccgctgcgg gcgcggtcac cgacggggaa gccgtctgca ggtccttgat gatctgttcg     54180
     gcctgcgcga gcggcgcggc aagctcatcg ggcaagcccc ccaacccgaa tggagccgtc     54240
     gctggtgtgg atgccggtgc cgcggcggag acggccgcat cggagtccgc gtcggcatcc     54300
     gaaatcccgc cggcccgaag gtcggtcgtt gccgcggtcg cgggcgcggc ttgggccatc     54360
     gtgcccagca gggccccggc ggccaccgcg acgccggcta cacctttgaa ccgatctgtg     54420
     gagtcggctg ccatgcggtg tcgtgcacga ggttcgtcgg tgacctctcc gagcagttcc     54480
     ttcacggaca gggaaccgga ggtcattcgg tggtgcggca cagcaggtcc taacgtcggc     54540
     gaacggtcgt ggagtggtct attggtaggt cgatgatgcc gtgggtccgg gtggggtgaa     54600
     ctcaattcat cggcaacgtg ggcgcaccgc gctgggcgag catggcacga atcgcctgcg     54660
     actccgcggt ctgcgcgtca tcgatctgct tggccagcgc cgcgacagcg gggaccgtcg     54720
     cgttgtcacg ggccgcccgc gccatcgaca ccccaccttc gtggtgacga agcaacagct     54780
     gcagatacag ggtgtcgaat gcggcacccc gggccctacg cagctgcgcc agttcctcgg     54840
     tcgtggccat tccgggcatt cgcattgatt cctgggcggg catctgatga tcagtccccg     54900
     cggtgtggga gtccccgcgg cgcatccaga gcatcggctg ctcagacgac agcggtcgat     54960
     cccacaacat cagccagcca cgcatcatcc ccaactggct ctgctgggtg gtcagcacgt     55020
     cgaaggccaa cgtccgcacc gcaggatctt cggcctgctc caacgctgtc gccgacatct     55080
     cgacagcttg attgtggtgg gtcgccatgt cctgggcgaa ccccacatcc acgacgtcca     55140
     gcgctggcgc cgaggagtcc gaaccgagca ctccgcgcac ccagaacccc gcgagcagtc     55200
     ccacgatcac cgcggcaacc aaggctgctg cccagatcgc gctcgatcgg cgccgcgctg     55260
     gcggggtcgc ttcgggcgtt ggcgattcag atgtcaccgc cgacctcctg aaggggtggt     55320
     ggaaccggca ccggcggggg ggagcggaac ggcgtcgggc cccggcggac tgggatcaaa     55380
     cggtggcggc gcgtcagggt cgaacccgcc accggaggca cagctcgcgc ctggctcagg     55440
     gtgggtgttc gggttctgac gcaaagctgt cacgaatcgg cggatgcggg gatcatcgac     55500
     actgtcgagc ttgagctggc gaccccagga ctgcagcgcc acagcagaat ccagattcgg     55560
     atacggcgac atgaacatat acggcttgcc ctcgacctcg ccgcgcaacg ccgcgagatc     55620
     ctcgccgctg agacgatcag cgttgtaggt cacccagata gcgccgtgct cgagcgaatg     55680
     aacagcgttc tcgctgcgga tcggagttgt atacacctct cctgtgcagg tggcccagct     55740
     ctgatcatgc gggccaccga acggcggtgc ctggtcgtag gcgactcgct gggtcgcccg     55800
     cacatgacta cccgccggat actcctgctt ggtgactccg tcgatcatct cggaggggtc     55860
     ggactggcca ctgcctggaa catagcgctg cgcctcggag tactcccgat acttcggcac     55920
     gtaatacaac gcaagcccaa cggtcaacag gatgatcgcc gctgctgccc cgatcaacag     55980
     ccatggcggc tgcttgccgc cgatggcggc ggcggtggcc tttttcccgg cacgggggcc     56040
     gcgtttcgaa ctgcgcgccc cggacttgtt gttcatgcgg tattccttcg tgctgacgaa     56100
     ccagcatcgg tgacgtggcc ggtcgaaatg atcgcggagg caggagccgc gtcgtgttcg     56160
     cgtaccaaag aggcaaccgg gcgagagacc gccgagcggt cgggacgacg gggatacaga     56220
     tcattcaaaa aggcgttgta ggcggccaac tcatcatccc cgaccaggtc tgaccggcga     56280
     tcggctacgg cgttgtcgcg catttcgtca cgccgccagc ggatggcgaa gacgatgacg     56340
     acgacgagag cgaccggctc gccgtaggac cacgccagcg caccggcgag atactggtcg     56400
     cgcatcgcct cgatgcccca ctgcggcggc ggagtcgcga agaactccac cagcggcgtg     56460
     gtcgccatca tcaagattac gccgaagaac acatgcaaag gcatctcgac gaacagatcg     56520
     aagaaccggc cgaggttcgt ctgccggatc ggcaggggac ccacggacaa gatcggcacg     56580
     acgaacaaca agccgctgag caggaagaac agttcgagta gttggtggcc gaggaccgtg     56640
     gaggcgacgt tgtcgaatac cggtgtcaga tagatgccgt agtagctgaa caggaacagc     56700
     gggatggtga aacccgggtg cagcatccat cgcatcgtgc ggctgcgtaa cccgctcacc     56760
     gccacggcga gcacgagtcg accgagcccc cgatggggtg tggcgcgaag cagcatcagc     56820
     cctggacaac cccacaccaa caacggtggg atcgtcatcg acagcgtcag gtgctggaac     56880
     atccacacgc tgaacaactg gtagccatag gcttcgatcc ccagtccggt gatggcggcc     56940
     agcagcagac acccggcgag gaagcatgcg gtgcgccacc agggccaggc ccgctgcaat     57000
     cggcgtagcc gtacgagacc gatcaggtag aggatcgagg ccgccagcgc cagcgcgggc     57060
     agtacaggga acgacggggg attccatgcc agcatcgaac cgatcgatgg cggcgtatcg     57120
     ggcaacggga tcgcagcgag tagctcgggc gagatcatgg cagtttcagc gcttggttcg     57180
     tgtggcggca cgcagtgtca ccacggcccc accgatcagc acgatcaccg ccacaatcag     57240
     tggccacggc aggctcgacg acagcgccgt agccgaagat tcgccagctg ctgtgacact     57300
     ggacggcgac ggcgcaccgg acggtgctgt ggtcgtcgcc gacccgctgg cgtaggtgaa     57360
     ctcgtaggag ccggtaatgg gatgcccgtc gtcggagaca acccggtagg ccacggtgta     57420
     cttctgggcc ggcatggtcg ggctcaccgc cacccgcacc gtcttaccct cgaccttgga     57480
     aacctgcgcc gcccagctgg tccccgcggc atcggtcagg ccgacgttgg cgaatgcggt     57540
     cccgatctgc tgattgaacg tcaacgtgat cagcgtgaga ggcgtgtcga cgactgcgtc     57600
     agcggctgga accgaggagt cgagctgact gtgcgctcgt gccgaccccg ccgtcagtgt     57660
     caaccccaga gctgtcagca tcaccgcaat cgcagtccgt ccgagcactt ccggcctcca     57720
     gattcgtacg cagtgcgcgg aggccgtcgt cgccgcgcgg cgtccaccga cccgacgccc     57780
     gtcaactatg ctacatagtt gaccgctcgc gtccagtctc cgattcagga catgaccaca     57840
     caagccacta cggcacaggt cagcagcccg gccggtgcgg cgactgcggc gacgatcgga     57900
     gacaaaccca tcagcaccca ccgcgacgat cgccgcggcg ggttggaaga ctccagccgc     57960
     tgcaggcgct gctgcaagac ctgccctgcc agcgacaacg tcgaggccgg ttcggtgcct     58020
     gtcgtcgcgg cgactgcgca cagtgctgaa cggatggtcg ccgggctcgt cgcagctgcg     58080
     gcgcagtcgt cggcggcgaa ctcggccaac gccgcgacag ctttcggtgc atcggcgaac     58140
     agcgggatcc agggcatggc tgcggcgaga acctcacaac ccctgatcag ccgatggtgc     58200
     ccgccgcgaa ggtgggccag ttcatgggcc agcaccgctt gacgttgacc atcgttgagc     58260
     ttgcgggcca acccctcggt ggctacgacc atcccggggc ggccgtcgac gctgtaggcc     58320
     atcggcttgg ggtggtcgag ccacatcacg ggcatgtcct cgtctccgcg gcgcgccacc     58380
     acgctgacga catcccgatg gtaggcgcgc acccgcgctc ctgcccgggt gtggcgccgt     58440
     gcgctcagcg cgacccgata cgagagaccg acgacaccgg caagtgcggc gactgtcagc     58500
     gggtcggcaa gccagtgtgg caccgagtgg actacgcggg tcaggcacaa catcgcagct     58560
     tcggctacac ccactccggg tgcgtgtccg ggccacagcg ccgcggtcac tgcgacaccc     58620
     gcgagcacga ctgccgaacc caagctgatc agccagcatg ccaccgcggt acgcggtgtc     58680
     atcgacggtg tgatgcgttg caggatggcc ggcgaagcga gcgacagcag tgccgccgcc     58740
     cacgccgcgc ccaaggctac gatcatttcc tcgaacgctt cctggggcgg gtacgcccgc     58800
     ggtggaatgc ttcggattcg gcctcggtca cgatcgaagc caggtggagc aggaccgact     58860
     cggggtcgtt gctcgagtcg atgatgccgc gtacaacctc ggcggtcgct tcggcacgtg     58920
     agcgggtggg ccggtacagg tatgcccggc ggtgcatcac ccgcaccacc cattccttct     58980
     cgtgcagatg agtcagaacg gtcaggatgg tggtgtaggc atacggatcg ggcaggcgct     59040
     cgaggatctc gcgcaccgtc agcgcttcgg aggtgcccca caaaacgtcc atcacccggg     59100
     cttccagagt gcccaatccg ttcatcgcct tgtccttcct gcacgtcgcc gctcgcggtg     59160
     ttctcagctc acgatcggga tcccgtcccc gcgagacgcc gacagtggcc gaactcgatg     59220
     ggaatctggc cgaagtcacc ggaccaacta ttcctgatcg tcgaggtagc gcgccacacc     59280
     acccattcgg cttcagccca gatctacgta ccgctaagta ctatgcaaca tagttgatcc     59340
     tgagaagtgt cttagagtta gctggaatgt gatgtcggcc acggtctcac agctgggtca     59400
     gcccttatgg ttccggtcgt gccgttcgtc ccctcatcag gttctggcac gcaaccggtg     59460
     aagcgatgac ttcccccggc agggaaccat cgcttcaccg ggcactaagg agtccaggcg     59520
     ccgtctcggc ccgctcccac cttcgaccga cgacggcacc ccgtcgacgt gacctgcgaa     59580
     ccgataccgg tggaggaacc aacaatgtct caggccgaag cgcccgaaag cgcagacgac     59640
     ctgcacacat caccatcatc accctcgaga gatcggctcc gcggcatttt gcgccacgat     59700
     ctgccctcat cagtggtggt attcctggtg gcgctgccgt tgtcgctggg catcgcgatc     59760
     gcctccgacg cgccgatcat ggccggcctc atcgccgcag tcatcggtgg catcgtcgca     59820
     ggtgcggtgg gcggctcgcc catgctggcc agtggcccgg cggcgggatt gaccgtcgtc     59880
     gtggccgagc tggtcgccaa gttcggctgg caggtcacct gcgcgatcac cgtcgccgcc     59940
     ggtgcgctgc agatcctgtt cggcctcagc cgcatcgccc gcgccgcgtt ggcgatctcg     60000
     ccggtggtcg tgcacgccat gctcgccgga atcggcatca cgatcgcgct gcaacaggta     60060
     cacgtactgc tcggcgggac ttcacgaagc tcggtgtggc agaacctcag tcagctcccc     60120
     gcgcaactga cacgcctgca ctggggtgac ctgacgatcg ggcttatcgt catcgtgacg     60180
     ctgctttcgt ggaagaaggt cccaggcgcg ctgggacgta tccccggcgc cctggtcgcg     60240
     gtagtcgccg cgaccgccgt gtcgctggtg gtgccgctgg gcgtggaacg catcgtgatg     60300
     aacggatcgt tgttcgacgc gatcgctctg cctgcgctgc ctgatggcaa gtggctggcg     60360
     gtagcgaccg gcgtgttgac cgtggcgttg atcgccagcg tggaaagtct gctctccgcg     60420
     gtggcagtgg acaagatgca ctctggcgcg cgaaccgatc tgaaccgcga actcatcggc     60480
     cagggcaccg ccaatatcgc ctccggcatg ctcggcgggc tcccgatcac cggtgtcatt     60540
     gtgcgcagcg cgaccaacgt cgccgccggc gcgaagtcca aggcatcgac gatcctgcac     60600
     ggggtgtgga ttctgttgtt ctcggtgctg ctggccgggg tcgtgcagca gattcccaag     60660
     gcggcactgg ccgggctgtt gatcgtgatc ggtatccaac tggtcaagct cgcccatatc     60720
     cgtctcgcgc accgcaccgg cgacctgtgg gtctacctga tcactgtggc cggggtgatg     60780
     ttcctcaacc tgctcgaagg cgtcctgatc ggcctgatcg tcgcgatcgc gctgttcgtc     60840
     tggcgcgccg cgcgcgccga cattcacgcc gaaccggtcg gtgatctgga ctcgcttcgc     60900
     tggcgcgttg tcatcgaagg ctcatgtagt ttcctatcgc tgcccaaact ttcgagcacg     60960
     ctggactcgg tacccgaagg cgccgatgtg accatcgaac tcaccgtcga cttcatcgac     61020
     cacgccgcca cggaggtgct gcacgaatgg caacgccgcc accgggatgc cggcggcacc     61080
     gtcctcatcg acgaactcgg ctctcacgct ctctcggcca ccacccaggg cccgcctcaa     61140
     cgtgcgtcct cggcccaagc tcggggtgtg gagccgtgga aggcatggca ggacacgaac     61200
     gcgcaagcgg tgccgcactt cgacgcgctg cggcccatgc tcgacggaat ctcgcgctat     61260
     caccgccgcc acgcgccgtt gatgcgggcg catctgagcg agctgcgcga ccgtcaggat     61320
     ccgaccacgt tcttcttgac ctgtggcgat tcccgagtcg tgcccaacct catcacccac     61380
     agtggacccg gtgacctgtt cacaatccgc aacatcggca acctcatccc ctccgacggc     61440
     ctcgatactt ctgtcgatgc cgcgctggcc ttcgcggtcg aagaactcgg tgtctccacc     61500
     atcgtcgtct gcgggcactc cggatgcgga gcgatgggcg cactgctggg caagccgacc     61560
     aagaactcac cggcagtgcg tgactggctt gcccacgccg agccgagcct gcgggcatac     61620
     cacgacaacc atcccgttgc tgctgccgcc gaggcggccg gattcgatgc ctacgaccag     61680
     ctggccatcg tcaatgtcgc cgtgcagatc gccacggcga cccaacatcc atcgctggtc     61740
     tcggcagtag cacaaggaca ggtacagatc gtgggtctgt tcttcgacat cgccacggcc     61800
     actgtctggc atgtcagccc gaccacagtc accgcgcacc ataaccagct cgccaccagc     61860
     accgtgcacg cctagtcggg agaccatgac taacacgttg atcaccggat ccggtgcgtc     61920
     cacaacggcc cgcaccggtg tcggtcgacg ttgatcatgc aatggtcact agtgaccggg     61980
     ccgttgccgt ggctgttgtc aggagtcggg gctctctgcg cggcttggtt gatcggagcg     62040
     cgacgacgtc tgagcgctca ggccgtcgcc gagtgcgcgg gactgggctt cggtgcggcc     62100
     atcgtcatct gggtggtggt cgaacgatgg tggcgaccgt tccccgacgc gctgccacgc     62160
     tcggtgtaca cctgggtggg catcgcggtc gcggcgctgg ctttgctcgc tgttcggata     62220
     tcggtgacac cgcgatggat ccgacggatc gccgcagtga cagccgcagt atgcgtgatc     62280
     accgcgtgcg cggtgcagat caatctggag ttcggcgcgt acccgactct ggaagacctg     62340
     ctcggaacgg gcagcgacaa ccggatatcg ctgaccgcgg tgccggccgc gcaacctaac     62400
     ccggtgaccg gctggccgat cgaaagcgtg tggagccctc cgccgcccac acaggtcgac     62460
     ggccgtgtcg ttcgcgcggt gatcccgggg acacgctcgg ggttccgcgc tcggcctgcc     62520
     gaaatctatc tgcccccggc ctatttcacc gatccccgcc cgttgttgcc agtgctggtt     62580
     ctgctgcccg gacagcccgg gagtcccgtc gattggctca acggcggacg tgtggaccag     62640
     accatggacg ccttcgccgc cgcacacggc gggcttgcgc ccgtgacggt gatcgctgac     62700
     gcgaccgggg gagcgtggcg aaacccactg tgtttggact ctcgtctcgg aaaggtcgcc     62760
     tcgtacctag ctatcgatgt tccggcgtgg gtgaacggac gtttgcaggt tgatcccgac     62820
     ccgagacgtt gggcgatcgg tggcatgtcc tatggcggaa cctgcgcgct gcagatcgcc     62880
     accaactatc ccgatcgcta ccccagtttc ctcgacctgt ccggcgacgc cgaacccagc     62940
     ctcggtgacc ggcgacaaac cgtgcaggcc gccttcggcg gtgacaccgc cgccttcgaa     63000
     cgcgtcaacc cgccgacgct gctgaggact cgccgctacc cgaactcggc gggagctctc     63060
     gtcaccggca ccgaggacga caccacgctc agcgcccaac gcagcattgc cgccgctgcc     63120
     cgagccgcgg gcatgacgat cacgacccgc gagctgccgg gaggccacaa ttggtcggtg     63180
     tggtcggctg gactgcgcat cgagatggac tggctcgcac agcgactcgg ccttacgcga     63240
     tgatcgctgg gatcgactac gccgacagcg cgcccgagtc ggcacatgat ccagcaggtg     63300
     agggacggcg tgaggtcctt cgcggcagcc atcagcggga gccattcggt gccgcgccac     63360
     attgttgggg cggcagggcc gacaaggagc atggagatca gcacccgagg actgccgagc     63420
     gaacgccgct gcggtgtgtg ggctgtcagc atgccaaccg aactgaattg ggcccccata     63480
     tatctggctg gtgtgcgtga atgacctgac atcccccagc tcttggtgga tctcttcgtt     63540
     gggcgcgcac ggcactcatc agcacaggaa tccccggtcc atgctgcgca cgctcatcca     63600
     gtacggactg gatgggatcg gtaccgacgg atcggtgagc cgcgcgatca atcgctccgc     63660
     ggacgccacc cagtggttgc atccggtgat gctcgccgtg gacagattcg gcattgtgtt     63720
     ggctccgttg gcgctgttcg ccgcaaggtg gagtacccgc agaactgccg ctgctgctcc     63780
     gtttccggcg atcagcacgg cggttgcggc atccggactg gcgtatctgc tcgcccggat     63840
     caccgcggcg tcggcgcagc accacccgcc atgcgcgatc gatcagacaa gaatagtgct     63900
     cgagtactgc accaacacct attcccttcc cgatgccacg ctgagcgctg ctgccgcggt     63960
     ggcggcggtg ctcgcgcaga tcgaccgaaa tctggggatt gcggtgtggg ccagcgtcag     64020
     cggattcctg gttgcccggg tctacgtcgg tcacgactac ctcatcgatg tcgtgctggc     64080
     gctcacgatc gggacctcag tggcggtagt cctcacctcg atcacgcgcg cggccgcgcc     64140
     cctggtgaac cgaaccatga ccaggaccag acggcggcgg tgcgcccgtc gtacagcgac     64200
     gggtcacccg cgggcaggat cggataccga ggctcggtga accggcccgt gaggatcagc     64260
     acaatgccca tcgccagccc ctgcatgaac atcagccgcg tggtccacct gcagcgtcgt     64320
     gtgttccaga ccgaattcgt cgtgcaggac cgattcgatc cccgatctca cggaatggca     64380
     gtcggccgca tcggcgacga gcacatgcgc cgacagcgac ggctgccccg aggtgatctg     64440
     ccaaatgtgc agatcgtgga tctcgctcac ctgcggcacc gaggccaggc ggctaccgat     64500
     ctggtccggg tcgagatgtg caggcgcggc ctcgagaaag atgcgcccgg actcgcgaac     64560
     aagcgaccat ccagccttgg ccatcagcac cgccactacc agcgcggcga tcgcgtcggc     64620
     gcgggcgaat ccggacagcc acaccacagc gccggcgatg gcggtgccga tgaacgcgta     64680
     caagtcgttg aggatgtgct ggaacgcacc ctcgacattg aggctggtgc ggttggcctg     64740
     gctgatactc catgccgcga cgatgttgac cacaatgccc accaaggcgg tgatcaagac     64800
     cagcggaccg gaaacctcgg gcggattgac gagacgctgg acgccctcgt agagaaacca     64860
     tgccgcgagc agcagcaggg tgatcccatt ggcttgagca gacaggatct cggcacgttt     64920
     gaatccgtag gtgaaccgcc cccgcgcggg ccgtttggcc agccggatcg cgatcagcgc     64980
     cagcacgatc gacgcggcgt cggtgagcat gtgcgcggca tcggagagca atgccagcga     65040
     ttgcgccatc acaccgacga tcacctccac tgccatgaac gcgacaatca acccgagtgc     65100
     caggaccagc cagcgcctat ctgcatcggc cgatacgccg tgcgaatgac catggccatg     65160
     gtgtgcgttg gcgttgttgt cgtgggcatg tccgccggtc gtggcggtgt gctccgccag     65220
     cgcgtgctcg gctcccatag tcgacatccc ttctgttggc aggcccaatg gccgagggca     65280
     gcgtagctga tcggtgttgc atgcgcatat ttgaatatga tttccgttgc ccggccggct     65340
     cgacgccgtc cggaaaacgg cggtgattga tgagagtaac tatcccgcaa cggcattgag     65400
     gcctaggtca cgttgggtca cggtgatcgc cttcagttcg gtaggcccgc agcgccaggt     65460
     ccgatcggtc cgatgcgact cgccgtgcgg tgcggtgacc gtgatcatcc aggcgtgacg     65520
     gggcgtacga tcggctgccg tgcggcgcta cgtgcggtac ccgagcgtgt ggccggcgat     65580
     cgccatcgtc acggcaagta tcttgctggc cctggctctg tctgactgcc gcctcctcgg     65640
     gcccggcgac atcgcccaac acctccatcg caccaccacc acagcaccag catcggtatc     65700
     ggtatcggca tcggcatcaa gtgcagcggc cctcgaaggc tgcgggcacg ctgatctcgg     65760
     agctgatcac acacactgtc cgtatgacgg ggtgcgggcg accggggttc ttcctcgcgg     65820
     cgaggaccgc gtatcgatcc cagcggtgac ggagatggct accgagcagg ctgtagtgca     65880
     agaggaccac agccgggcgc ccccacgtgg cggcgcgccg ttctccgcgg cgggcgctca     65940
     gatattgatc cgtttcggaa tcagcaggcg ctgatcggtc agcgtcaggc cgacgtgcag     66000
     tgatccgtcg gccggtgtcg gctgccctgc tcatgctcgc tgccgaacag aacggacatc     66060
     gtcatgaatg ctgtgctcga cgatctgggc ttcactcctg cgactctgct gaccaccggt     66120
     acgcgctgcc tgcgccccgc cactttggtc ggtaacaccc cggtcctgtg gatcggggct     66180
     cccctggcgc cccgcggaca cgggttctgg gccaaactcg aagccgccaa ccccggcggc     66240
     ggcatgaagg accggcccgc cctgtgcatg gtcgaacggg ccctcggccg cggtgacctc     66300
     acccctggcg cccggatcat cgaatcaacc agcggaacaa tggggttggg gttggcgctt     66360
     gctgccacga cgtacggcca tccgctcacc ctggtcagcg accctggcat ggaacctctg     66420
     atgtgcagca tgctcgccgc ctacggcgcc accgtcgaca ctgtgcacgc accccatccg     66480
     gtcggggggt ggcagcaggc tcgccgtgac cgtgtcgatg cgctgctggc caccgacccg     66540
     acagcgtggt gtcccgacca gtacaacaac cccgacaaca tcgacgccta cagcccactc     66600
     gcgctggaac tgatcgccca actggggcgc gtcgatgtac tggtctgttc ggtcggcacc     66660
     ggcgggcact cggcgggcat cgcccgcgtc ctgcgccggt actgcccaca gctgcggttg     66720
     gtcggcgtgg acaccatcgc ctccaccatc ttcggccaac ccgccggtac ccggttgatg     66780
     cgcgggctgg gctcgagtat ctatccgggc aatgtcgatt acgccgcgtt cgacgaagtg     66840
     cactgggtcg ccccgggcga agcggtgtgg gccgcccgga ccctggcacg cactcaccac     66900
     gcgactggtg ggtggagcgt gggcgcggtc gcgctggttg caggctggac cgcggccacc     66960
     accaaccccg acacgcgcat cgccgcggtc tttcccgacg ggccccaccg ctactacgac     67020
     accgtcttca acgacaacta ctgccgcgtc aacgacctac tcgatcacgc gccgcctacc     67080
     gaacccgtca ccatcgccga ccccgccgag gctgtggtca cctcgtggac gcgctgcacc     67140
     aacgtgatcg acccacatca gttgcaatct gcgaacaccc acgcggtcgc cgaggccatc     67200
     gggtgatcgc gaccgttggc tcatggcgcg agctcaaccg gcccagtcag ctgctgatga     67260
     tcaatcagtt cgccatcaac ctgggcttct atatgctcat gccctatctc gccgggtatc     67320
     tttccggcgc gctcgggctg gccgcgtgga cggtcggact cgtgctcgga gtgcgcaact     67380
     tctcccagca agggatgttc ctgatcgggg gaactctggc cgacaggctc ggcttcaagc     67440
     cgctgatcgt cgccgggtgt ctgctgcgca ccgccggatt cggtctactc gccgtagtcg     67500
     acaccttgcc cgcactggtg atcgcctcgg cggccacagg cttcgccggc gccctgttca     67560
     accctgcggt ccgcggctac ctcgcggccg acgcagggaa gcagcgggtg gaaaccttcg     67620
     cgatgttcaa cctgttctat caggccggca tcctggccgg cccgctcgtc gggctcgggt     67680
     tgatgaccct ggactttcag gtgactgccg cctgtgcggc cgcggtgttc gcgatcctga     67740
     ccgtcggtca actcgcagcg ctgccgtctc accccgtctg cgcaggcggt gaaaagacct     67800
     ccgtcggcca ggactggcgg acggtcgtca ccaaccgaac gttcgtcggg ttctcgatcg     67860
     cgatgatcgg cgcctacgtg ctctccttcc aggtctatct cgcgatgccc ctgcacgcag     67920
     cgatcctgag cggtcagcat cctggcaccg ggttggtgac agccgtgttc gtcgtgttcg     67980
     gcaccgtgtc ggtgctcggg cagatgcgca tcacacgatg gctgtccgtt cgctacgggc     68040
     gccgaggggg cctggcaatc ggagtgggga cgctcggtgt cgcgttcacg ccgatgttgt     68100
     tgttccccgg ccccggtggc agcgcagcgg tggcggcgct gttgatatcg gcggcgttgc     68160
     ttgccatcgg cagcgcggcg gtcttcccgt tcgagatgga caccattgtc gcggtgtccg     68220
     ggaaccgtct cgtcgccacc cattacgggt tctacaacac cgtggtcggt accggtgtcc     68280
     tggtcggcaa cctcggcacc gcgacgctgc tcgacctcgc ccgtcgcagc ggatccggcg     68340
     cgctggcctg gtcggtgttg gtggccatcg gcgtcgtggc agcgatcggc gtctacatcc     68400
     tgggacgaat cgtgccccct gagacctcgc aaccagccga ggtcgcagtc agtcggtcgt     68460
     aatcggcaaa ggactgttgg acgtgtggcg gccaggatcg gattcccgtc ggattcgatc     68520
     tcggccgtcc gtcgacagcg gacgacgttg gtcggccggt cggcactgga tgcccatacc     68580
     ggccggtggc aatgtttcgg catgttgaat ccaaattttc ggtatgccaa actatcggga     68640
     ctatgaatga tccgagccgc cgttttctgt tgggcggtgc actggcgagc accgccggat     68700
     tggcgctggc gggccgcagc ctgctcgacg cgtcaccagc caaagcccaa gcaccagtcc     68760
     ctgccggcca cggcggcgga gccgacggcc ccaccttccg catcgggcag accgtcgacc     68820
     acaccgccaa cgggttcaac ccgacccagg tcctacgcga cttcgactac ggcaccacca     68880
     cgcggttgcc cgacgggcgg accttgcgcg agtgggaggt cttcgccagc gacgaggaca     68940
     tcgaagtcgc ccccggtgtc accttccccg cctggacact caacgcccgc gtccccggcc     69000
     cgaccctgcg ctgccgggaa ggagaattgc tgcgggtgca tttccgcaac ggctccgagc     69060
     atccgcacac cctgcacttc cacggcatcc accccgccga gatggacggc atcgccggcc     69120
     tcggcgccgg gatcatccag ccaggtcagt ccacgaccta cgagttcgac gcgaccccgt     69180
     tcgggctgca cctgttccac tgccacgtcg gcccgctggc cgagcacatc gcgcgcggca     69240
     tgtacggcac attcatcgtc gacccaccga ccccgcgccc acccgcggac gagatggtga     69300
     tggtgatgca cggctacaac accactttcg acggtgaagg caaccagctc tacgcggtca     69360
     acgggatccc gttccactac atgcacgaac cggtgcgggt gaaacgcaac gaactggtcc     69420
     gtatctacct ggtcaacgtg ctcgagtacg acccgatcaa cagcttccat gtccacggca     69480
     acttcttcga ctactacccg accggcaccc ggctgcagtc ctcggaattc accgacacga     69540
     tcgtgcaggg ccaaggccag cgcgggatct gcgagatgcg gttcccgcac ccgggcaagt     69600
     acatgttcca tgcccacaaa accgaatttg ccgaactcgg gtggatgggg ttcttcgagg     69660
     tgagcgactg atgagcacca ccacccccgc tacgcgccga ccttggctgc tcggcgtggc     69720
     cgccctgatc ctgttggtac tggcgttgat cgggctcgcc ctgctcggcg gggcgagcct     69780
     gcccgaccgc gccggcccac cggtcgagga gatcggcgtc gaacaagtcg tcctcgaacc     69840
     cggcacgatc gagctgaacc tgcgcaacac cgggcccgac ccagtcgcaa tcgcgcagat     69900
     cttcgtcaac gacacctacg tcgacttcac cggccccgcc gaaccgatcg ggcggttgtc     69960
     ctctgcgcac ctggtgctgg actacccgtg gcagaacggg cagccctaca aggtctcgat     70020
     gctcacctcc accggactgg tgatcgaaca cgacatcgcc gccgcagtcg aaaccccaag     70080
     ggcgggagcg tcgttcttcg ggttgatggc attgctggga acctacgtcg gcatcatccc     70140
     cgtcgtgctg ggcatgctgt tcctgccctt cctgcgctcg gtcggcacca ccaccgtgcg     70200
     agtcctgctc ggtttcacca tcgggctgct ggtgttcctc gcctgggaag gcacccgcga     70260
     aggattcgag atcgccgaca cctccggcgg cccgttcggc ggggcatcgc tggtcgtcct     70320
     gggcgcgatc ttggctttcc tgacgctgac cgcggtcgat caatggctgc gcagccaccg     70380
     aaccgccgcc gccgagcaag gcgccgcgag cggcacccga ttggcattga tgatcgcgat     70440
     cggcatcggc ttgcacaacc tcggcgaagg cctcgccatc ggatccgcct acgccatcgg     70500
     cgaactcgcg ctcggcacct tcctcgtcat cggcttcacc attcagaaca cgaccgaggg     70560
     cctggccgtc gtctcacctc tgaccgagcg ccgcccctcg ctggccgcgt tggccgggct     70620
     ggggctcatc gccggtgcac cggcgatcct gggcgcggtc atcggggccg gtgccaacaa     70680
     tcccgaagtc tccgcgctac tcctcggcat cggcgttggc gcgatcatcc aggtgatcgt     70740
     gcagatcacc cccagtgtgc gcgaacccgg tacgaccacg atcggtatcc gcaccctcgc     70800
     cgggatcgcg gccggtctgg tcacgatgtg ggcgaccgga ctgctggtgg ccgcatgaac     70860
     acagactctg tcaccacgac acctatcacc cggcgtactg ccctggccgg tgcgtgcacc     70920
     ctgtgcgccg tcgcggtcac cggctgcgcg accgggcaag cttcacaatc ggatggtcag     70980
     ccggtgcgcg tcgcgcgcgc cgggatcgac atcggcggtg ccgcagtgtt tcccgaacat     71040
     cggatcctgg tgacccaacc cagcgacggg gtgtacaagg cgttctccgc ggtgtgcacc     71100
     catcaaggct gcgcggtcac cgacgtcgac ggcgacgtcg tgaaatgccc gtgccacggc     71160
     agcaaattcc ggctcaccga cggttctgtc gccaaaggcc ccgctcaacg tccgctgccc     71220
     gagcgggctg tcatggtcga cggcaacact ctcatcgtca gctgaaccaa cgaacccgac     71280
     gaaagctgca tttcccagcg ggtttacggg ccagcactcg gaatgtcgca ccgccacggg     71340
     tgcgccgacg gcatcgtcat cgggccgaca ctggcacccc aagaactgtc gagacctgct     71400
     gtgccacact tttgccggtg agccccccga cggatgtggc tggacggccg catcgacgta     71460
     ttcatggcgg agacgcagcg ccggggactg gtctgccccc cgcgagcccg tcggtctgga     71520
     aatccaagcc agggtcgagg ccgtcgcgat ggcgttgcgg gtgaccgaac agaccgctcg     71580
     cagagacttc ggcgacgaga ccatacagaa catggccagt tccatggcat tccaactcgc     71640
     acacgagcag cccggcgccg acgtcctcac cctcacaccg gactcgcgtc gtctcgactg     71700
     gggtggccgg gcggaccaac gccggtgtgg cgatcggtgc tcagctcgcc ctgaccgcga     71760
     ctccgaccgc gaacacgccc ggaccagatc catcagatcg tcaacctggt gtcttctggg     71820
     tctcatcgaa gcactctgcc gtccgcccgg ccaaatcgcg gttcccgaag cgttaattca     71880
     tcgaacggtg cgcgagttca gcaaggcgat cgcgctgctc gacacaggag cgcgccccga     71940
     agagggcggc gaccccaccg aactgcgggc cgcactgacc gccaacgtca ccgctctcga     72000
     atccacactg taggaactat ttcgatgcag gcctccgccg ggcgggccgc tcggccagcc     72060
     cgagaccgaa catcacatca ggatggatcc gcaggcccgc gacggcttgt tcggaatcgg     72120
     tgatcccgtc gtagtcgtcg aaggtgatca cgagctcgtc gccacgtttg gtgccgcgcc     72180
     cgaccgcgat tccggcatcg agaagccggc gggtgtcgat gtcgcggtcg gcgttgacct     72240
     ccgagggcag cgggatcggc ccgcccggga ccgggcgcag gatttccttg cgcaccaatc     72300
     gcagcaattg gatcgcggtg tcggcgtcca ggccgcgccg catcgcggtc ggccgcgcca     72360
     acgccgcccg gagcgggcca ggcagtgcgc ccgggcgcag cgcgagatgt agcacgacgt     72420
     cggtggcgac gacctgcaac gcggtctgat ccagttgcgc gcgtagatat gtcagggcgg     72480
     cctcgaactc ggcgattgac catcgtgtcg ccgcgagcaa gacatcgacg ccgatcccgt     72540
     cccggctgac cagcaccgcg agcaaggttc gggcgtggct ggcggcgtcg atcgcgtcga     72600
     tcgcgtcgat cgcgtcgatc gcgtcgcgat cgtgttcggc gagccctttc gcggcgcgat     72660
     cggacagcag catctcatcc acgctcaaac ccagcagagc gtgtaggcgc gagagcatcg     72720
     tcagcgtcac cgtgcgctgg tcggggtcgc gttcgaggtc ggtgaggctg aatccggtct     72780
     cccgcacgac cgcagccgcc gagaacccca tttcgtgggc gcgggcagcg agcagcttgt     72840
     ggttgaggcg cagcttgacg gtcaccggct gtagtccatg tcgttgtgca gcggcgaacc     72900
     gacccaccac gcggtggccg tgcccgtcca cgaacccgcc gccgagatcg tcgtcggcag     72960
     cgcgatcccc gcacgcgcgg cggttgtggg cacgatctgg cctgcggagc tgatcgcacc     73020
     ggtgaacagc gatttcttcg gctccacacc acgtaacccc aggaaggtgc gggccgcggc     73080
     aagcatcggg cgcgcccggc ggggcacgct ggtgaccacc cagatcggag accgatcgaa     73140
     cagatagcgt tcggcgttgt tccagcgcag cattcccgcg tccatcgaca acccggcgat     73200
     cgggatccgg gccagttcat gacggtcgaa cccggtgaac aacgcgcacg ccaacgccgc     73260
     ggcatgcacc gggctcaccg tgcccgctcg gatccgcgcg gccaccgccg cggtgatcgg     73320
     gcgcccggtc atgccgggcc cggccgcgcg ggtcaaatgg ccgggcagct ggatcagcag     73380
     cccgtgcagc agggctccgg cctgggcacc gcgcaacagg gtgatcgtgt ggttacgggt     73440
     cggggaatca gcgaccaggc cggtgaggaa gcagtccaac ccgtcgtcgt catcgaaccg     73500
     gtagggcagc ttgtgcatct ccgaactcct gggtccgttc aaacacagca gccccaccgc     73560
     gatatggcgt aattcagatt cgtcgtagcg ctgcgcgagc gcttccgcgc cccgccgcag     73620
     ctccaacgac cgcacaccag tcggccccat ccgccgcaac gcttcctcgg ccctggttgt     73680
     cggcagcacc ggtcccggat ggccgtgcaa ccatcggcac gccgcggcca tcccggcacg     73740
     gtagacctcg tccacttggg cgaagtccgt gcgcgagagc cgccggaacg cctcggcgcg     73800
     aaacgccacc acgtcggcgt cgggcacatc gggcaacacc tcgacctcgg cgtcgacatc     73860
     gggtgagcgt tcgggcggga agtggcgaag cagcgtgctc accggtgcca ccacacgcgg     73920
     gttcaccccg gccgggagca tcgccagcac ggcggggcgt gaggttgcgt ggcagaccag     73980
     caccaacccg accccggtct cgcgccacag atcgagcagc gcgttccagg agtccttgtg     74040
     tagtcgttgc gcgcgcaaca ccaccagccg ctcgatgtcc tcggccgcga cccatgcgcg     74100
     taccgcgtgc cacaggctcg acggggcgtt ggccttctcc gccgcgagat accgcaccgg     74160
     tcggcccagc gcggcgagga tgtccaaggc cagcgcagag gaggagtgcg tcgccggtgt     74220
     cgggtgcacc gtgacgaccg gtccggtctg gtcgtgcacg tcgagcaggg ccgcgaccac     74280
     ggccgcgtcg tcgagcggat ccagcagcac ggtgacgcgg tggcggcgcc gacggcgtac     74340
     cggcagcgat tcccacgcgt tcgccgcgtc caagtcgacg atcgggtcgc aggccaagcc     74400
     ctgctcgctg gtcatgagct gcgcccggac agtttggaga acacgtaacc gaggacgtcg     74460
     ccgtcgacgg tgtcgcgccc gatcttgtcc agcgtgcgcg cggcgtgggc ggtgatcttg     74520
     gcccaggacc ggaagttgcc gtgcccggcg ctcttgtctg cgaacgcgat cagctccggg     74580
     tcggtgttcg cccaaatccg gtggtaggcc gggatgacgc gcagcacctg cgcgcgcggc     74640
     atccgccgga actcctgcca cacatacacc cggctcgaca gcatcggttc ccggcgcagc     74700
     acctcataac agtcaccgcc gccgacgaac acgatcgcca tgtcggtgaa ccggtcgtcc     74760
     cacagatgac gccagtactc gaaacactcc ctcgacatcc actgcgcctc atcgcagacc     74820
     agcacccgaa accgttcggc cagaacatct ttgagcacac gatcgaactc gatgggctta     74880
     cgcggcgggt ccccgccgat cgccaacgcc tcgaacaacg tgtgccggat atcgcgcggg     74940
     gtgggccggg cccggaactg cacccggcac accgaccccg cgggctgctc ccgcagagac     75000
     gtgttgaccg acaacgtctt tccgagtccg gcgtcgccgt gcacacacat catcgccttg     75060
     gcctcgatca catcggcgag gttgtcgcgc actgccagca gcgcgtcggt ggccacgaca     75120
     tgcgcgccgg gcaggttcag atagtgatcg gcgccctcgt catcggcggc ctcggtcggt     75180
     gtgatcggtc ctcgggtcac cgcgtgcggc ccttcttctg cggttcgggt gcgtccaaat     75240
     cgactggcag cacccatccc ggtgccggtg gggaatgtgg aatcaggttc ggccgcgcca     75300
     ggctcgcgag ctcggtgtag tcctcgtcgc cgagttcggc ttcgacttcg gccacggtca     75360
     tcgcgcccag gcgctgcgcc ggtgccacgg tcgtcaccgc cgcgtaccgg gtgcgccggg     75420
     ccttctcagc agtcttgaga tcgcggcgca gctgggcggc cttgcggtcg cgtgcccgcc     75480
     gaacgcgccc gatctgttca ccggtggcct gatcagccag ccacgccgaa cccagatgcc     75540
     tgctgctggc caggtcgaac acctcgacct cgtgatcgtg gttgggcatg taccgcaacc     75600
     gaactcgcgc cccgaccatc ccgaccatcc aatccgcgac atagtggcgc ccgcgccccc     75660
     gcgcgacgcc cttggtggtg atcttgcggt gcgcccggtc gtcttcgagg gtgaacatcc     75720
     acagcttgtt cgcgtcgagt tcgtgcagcg gggtcggatc ggccagccac gattccagcg     75780
     gcgacgaccc gtcgagacgg tcgatgttgt gctcggtggt ggtgttccac cagttcaccc     75840
     aacccagcag gtcggcgacg aacacttcga acggcaacgc tggcgcgtcc ggatcggtgg     75900
     gggtaccgtt catcccgacc ggggcgtggg tgtagcgcgg catttccgcg atcagcatcc     75960
     gctccaccgc accgttgacc gtctccacac tccctttcaa gtgtggggtg tagccaggca     76020
     ggtccaccac ccgcaccgcg aacgcgccca tcgcgtcgct gaccgtgcgc gagaggaagt     76080
     ctttgccctg atcgatccgg acgagggtgg gcaccccgcc ggctgggcca tagggcggtg     76140
     tccgcaggat cgccgcgcgc aacgcggcca ggatcgcttc gcggttcggg gtcttcggcg     76200
     tgacggccac gcccatgatc acgcagtgct cggtatcgac gaaccaggtc acccacggct     76260
     tcatcagccg cccgtcgaca tcgacttcca ccgctgcttc cacgtggtct gcttcccagg     76320
     ccgcgttgcg gtaggtgctg ggtcgtttga ggaagacgtc gaacttgcgg cgcgagcgtt     76380
     caccctcgcg gataccggcg atgtcgccgc gggtcatgtc ctcacggatc gcccggtgca     76440
     acgtcgccag gctcggtgcc ggtggaccgc cggcacgttc gcgttctcgc agttcgcggt     76500
     gcagcgcgga ggcattgcca cgccagtacg cgaaccgaac ccgcaactgt gcgtcgatcc     76560
     ggaaccgagc tcgccgctcg tctttgcgca ccgcgccgcg gcggtcggcg agccaccgcc     76620
     acaccgttcg ttcggtgaca ccgagggttt gcgcggtcaa ccgcacatga tcgctgctca     76680
     gatcgccgtg ctggtccaag accgccaggc ggtcgaccgc ggcgtgctgt agcgcgcgct     76740
     tcgcagcatc ggccaccagc ttcgccttcc gaacccgctg gcctgcacca aatccggggc     76800
     aagcgcactg cccctcattc gatcacgaca acctgctcgc cggtcggttt actgacattc     76860
     tgatgacgaa ttgctactga catttcaatg acgagtctca cgcagggcgc atttagatac     76920
     attagaataa caggtgtcgg tgcggggtct cgaaccgggc acggcggtgc gacttcccgc     76980
     tggagtgaca gtgaggcgag ctggacttgt cccagctggt gtcagtagtt ttcgcagtga     77040
     gtgtcagtag agggtgcgcg gttgcccgct gaattgttag tggggtgagc tggggcctcg     77100
     tgggttactt cgggtcgtcc gggaggtgtc ggacggggga ggagcgagtc ggtgcgcggt     77160
     ggatcaggga tgcgggaggc cgtgctcacc acgcggctgg cgttgcggct cttcgagccc     77220
     ggtcacgtcg cggcgctgca cgagatcttc gctgacccgg ccacccaccc catcggggag     77280
     gggcccttct ccgatatcgc cgcgaccgaa gcgtggattc agcaccggat cacccctcgg     77340
     gccggaaccg ggctgtgctg gtacggggtc caccaccgtg gcaccggtgc attgctgggc     77400
     aactgtggtg tcttccccag gcgcactggt gcgcgcgaac ccgagatcgg ctacgagatc     77460
     cgcgcccgcg accagggaca cggcttcgcc cgcgaagcgg ccaccgcggt cctcgccgag     77520
     gacctgcgtc cgcacccgtc catgtcgaat tcaccgcacc cgcacgaact cgtcggccgt     77580
     cgtgcaagtt tcggcatcgt ggaggaagcg gtcgtactcg gtgtcgggga cccgggccag     77640
     attgctcacc cggggccggc ccgggtgagg cagctgctcg atcagctgcg agaccggcat     77700
     cgtcgggtgc gccagttcga tggcggtgac gccgtcccag ccgatcgggc cgcgggtatg     77760
     ccagatgagc accaggcgaa cggtgccagc gcggcgcagc cacagcagcc aggccaccgt     77820
     gcccgggctg agcaggtgcg tgcagcacgg tctggttctc gatccggtcg gccagcagcc     77880
     acgccctcac cgtccgcacc gcccgcggca cgattctgtc tacccggctc ctaggatgta     77940
     aggcggctcg gcgggtcgaa tttccgccag ggagcgttgt cgaagtacct gagtacctgg     78000
     tgtggctgtg cgatcagagc agctagctga cgcaaccgca ggtgatattc gccgggcgcg     78060
     gtgccgacag cgatggcgtc gtccacgcga gtgcgcagct ggggattgac gttgggtaga     78120
     tagatctccg cgagttcggc gcgcaggctc gacagggctt catgttcctg attgcgagac     78180
     tcctcgaact gcgaggcgaa ctcgtttgcg cgctgtactg cctcgtcatc gacaatgcga     78240
     cctctcatct gtgcgatgac aaggtccaac tctgattcga agatctcctc ttccgggatt     78300
     ccggtggtgt cgggtcggag ttgttgtgcc gccgttagtg cagcgacggc ccgcgtcacg     78360
     gcctgctcgc ccgcctcggt ggcgggcagc gcggacgccg cgggtggcag cgggatggtc     78420
     cgcacgcgca cgatcaccgt cgcgtcgatg gcgagtgaga tcgacccggg cgactcatgg     78480
     gtgttgacgt agcgcaccgc ccgcgcgccg aggtcggtca gcgccgtcat cggcacatct     78540
     ccgaaccatg tgctcaattc gccgcggact cctggtgcca ggtcggtagc gccgagttgg     78600
     acctggacct gatgaagcca gtaccgatgt gtcggcgagt cctgatcatg catgcgccgc     78660
     agcatgttct cgactgcggc ggcgtaggtt cccagatgaa gggccagcga ggttcgtccc     78720
     tcgattgcct tctcgtgctc ggagggcgat agcaaagagc gcttgatcaa cgccgtgatg     78780
     tcactccgat acctcggaga cggccagtcc tggtatggac tggtgtgata ccagaggtgt     78840
     cggtccacct gatcatcgtg acagtcgatg tcatcgagat cgcgaagggc agggcgtgct     78900
     gtggagatgt cgatgctgtc cccgcactcg cacacggggt atgactcctc gtccccgccg     78960
     cattgctgtt catactcgcc ggccgtgacc tcgacgcgtc gcccgcagtc gcagtcgaac     79020
     caatagctga aatcgaactc gaaaccagca ggatgctcag ccgatatccc ggaattcacc     79080
     agcgcagtgt acgaaccctg cctgcggacg tctcgtcgca gtcgcaacgc ccagccggac     79140
     caccgccata ccgtccgctc tgcgaccccg agcgtttctg cgctcagctg cacgtgcgcg     79200
     ctgctcaacg ctccgcggcg atccaaggtg agcaacggct gcaccgcggc cttccgcagc     79260
     ccacgcccag ggacgtcgac caccaccgac ctcccgccga cgccgcgacc agcgccagca     79320
     ttcgaccacg gcaatcagca gcgcggcagc agaatctagg tcgatccgtc gtcctgccct     79380
     actgacaccg aagtgggaaa atctctgaca cttcggtggg aaatcgcaca ccgcgacggc     79440
     gcgctgccgg ttcctgcaag gtgagccgtg cccgcgccgc tacatgagcc ctaccgtgtc     79500
     gattagcgaa accgcggcac tgtcgcgggg tctccccgaa agttcaccgg ggagacccgc     79560
     ggccgtcggc tacgcgagca gccggtgggc cgccgtagcg acggcgcatg ccgccatgat     79620
     cgccgggatc gggcccgcca cgaggaatgc actggtcgca gccagggccg accaagtgcc     79680
     gatcaacgcc cagcggacgg gcagccgctg gggcgcacta ccctcaggct cgcggacagg     79740
     cgtgcgccga gttaccttgt tcatggttct gctttctctc aacggatgga aatcgggaac     79800
     ctcgcggcct ttgggggtgg agccccgaag gccgctcccc gatctcgttc gggatcgaac     79860
     tccaccgcag gcactgtccc tcgaatcggg cttctgacct gcggcttgag acctttgtac     79920
     cggcttccgc agggtctgta tactgggcga tggcgacgtc ttaacccgcc agaaagaccc     79980
     cggtcctcgt cgaaggcgaa gccgttttct ggcgggtcaa gacgttcaga tcaagaatcc     80040
     ggatcagttt gagaatttct ggtgattagc ttggcggtgg ttcggttcga cttcagccgc     80100
     ctgcccaccg agcgtgaacg caaggcgctg accatccggc gagaccgttt gaccgccgcg     80160
     cagaagacgc gcacggtagc ggtagccaac ctgggcaagc tctcggccga gcgcgagctg     80220
     accgccgtac gggtacgcga cgggttcgtc cggcttccct ttcccctggt cgacgacacc     80280
     tccgatcggt ccgcgccggc ccccgaacat cggccgacct cgacgcggct gatgacgccg     80340
     aacggcatcg gcctgcggct gatgctcatc gccttgttcg aagcccagtc gcgcaccgcg     80400
     cccggcaccc gcgccgacgg caccccgatt ccactgcacg cccgcgtcgg cagcggacgc     80460
     atcggctgga cgaccctgct gtcgagctcc gcccagccag ccggtgacgg caagtaccgc     80520
     atgagcgtcg tcgacaaaca gatgcggcag ttgcagacca ccttcaccaa gctcgagcgc     80580
     gagggactga tcgaacccgc cgatccgaaa cgccggggcc gcggccgata cgaaggattc     80640
     ttcctccgct acgagaacat ccgttccggc gaaaccggcg atcgctatcg cgtccccgac     80700
     agcgaagacc cgtacttcga catcccggtc tcgctgttca ccaacggctg gattcatgtc     80760
     ctcgaggaca gcgagttggc actattgctg atcaccatcc ggatgtacca ccgccacggc     80820
     gccgaacccc agaaactggc cgcgggtacg cgtctgctgc actacgggct gagtcgcgac     80880
     gctaccgaat cgcacctcat gctcacccgg ctgggcctga tcgaatccca tggagacccg     80940
     gcacgtacag accacgggaa ggtcaccgac tacaagaaca tcggtgcaca accacacgag     81000
     ttcctgttcc tccccgccgg cctcgatcgc gacgccagca cgacgacact cgaagaaatc     81060
     cagtttcagc tggaccggga gacaaagggg tccgcgagat ccatcgcgga cgcgaagacc     81120
     acgtagatct ccgagcccta ggggtccagg ttgaagtact cgccatcgtc gatctcgtgc     81180
     ctgtgccgag tgccgccctc ggaacgccag atgatcttga cggtgaagct cttcggcggc     81240
     tcgaatccca ccttttgggc cactgccgga agcttccact ctcctgtcag cgcagtcgtt     81300
     tccttgtgtt cgaccttgag gttttgtgct cgttgtttcg ctgctccact gggctcgcag     81360
     agtggcgctg acctcatagg cggtgtcgag tccttcgttc gccagcacaa ccaggcagct     81420
     gccgtgtcct gggccgatgc gcctggtgaa agccaacacc gaccactcga cgtccttgcg     81480
     ttccgtatcc ggcggttgct ggccgtgctc tcacaaccga gatgttgcca cgcccaccgg     81540
     cccggcgtgg cagattatcg accgcttggt tgctcgctcg cgtctctccc cggtcacccc     81600
     atgtgggtca gcccgcctgc cagtcctgtc ctgcggcgcc ggccgccacc gagacctcgg     81660
     tgaaggtgtc ggccgggtgg tggcggtcga ggagccgtcc gaactcgcgg gcgctggcag     81720
     gccagggatt cgtgatctgc ccgtcggagc ggcgcttgaa ccacgacggc acgccgtcgg     81780
     gccacacggt gcgggccagc tcggtgttca gccatcgccg atagttcgcc atcgaggccg     81840
     gggcgacctc gatcggcgct cctaggcggg cggtcagttc caggcaccgc atgatgtagc     81900
     gggcctggtg gcgcttcagc gcggggttgc tgttggccgg ggtgaagctg tgtggcccgg     81960
     cgatcaggta catcgacggg aatccgggga tggcgagccc gaagaacgcc tccgggcgac     82020
     cccagtgtgc ccattgcgcg tgcaggtccc ggccgccccg gccccggacg gtgatgccac     82080
     cgaggagctc tggggcgcgg aatccggtgg cccaaacgat cacgtcgtgg cggcggtgcg     82140
     tccggcggtg cggggtgtcg gccgtgcgga tgccctcttc ggtgatcctg tcgatggggt     82200
     cggtgaccag ctcgacatga ggcagggcca gggcggggta gaaccggctg tccatcagga     82260
     tgcgtttctc cccgatgcgg tagtgcgggg tgagcttgac ccgcagcgcg gggtcgggga     82320
     cctggcggcg caggtgggcg cgggcgatcc aggcagcggg ccgggccgac caccccccgc     82380
     gcatgatggg ggccaggacg aggtcggccc cgtgatagag gccggcccgg tagagacggt     82440
     gcaggccggg gatgtgctca agtgcccagc gggtgccggg tccgaagcgg gaatcgggtt     82500
     tgggcaggat ccacgcgggg gtgcgctggt agaccgtgac agatgccgcg gtacgggcca     82560
     actcgggaac catctgcgcc gcagacgatc ctgtgcctac caccgcgatg tgtcctgtcg     82620
     ggtcgacggt gtggtcccag cgggcggagt ggaatgcccg cccgccgaaa gtgtgggcgt     82680
     cagggatctg cgggactgct ggccgatgca actggccgac ggcccacacc acggcctcgg     82740
     tgtggaggtg ctgcccgcgt tcggtcgtca gcgtccagct gccgtctgcg tcgttgtaca     82800
     cggcggactt gacggaagtg ctgctgcgca ggtgctcccg cagcccgttc cgatcggcga     82860
     cggcgcgcat gtaggccagg atcgacgcct gatcggggta gcgcacctgc gcgtctcggt     82920
     gggggtcgaa agcgaacgag tacagatgcg acggcacatc gcaggcgcat ccggggtagg     82980
     tgttctcccg ccataccccg cccacgtcgt tgccctcttc gaggatgacg aagtcgtgga     83040
     cgcctgccgc tttcagttcg gcacccatgg tcagcccgcc gaatcctgcg ccgaccacca     83100
     cgacactgtg cctgagtacc ggcccggtca cggtcgcgct cccgatgctg atggcttcct     83160
     gcggagcgtc ccgcttctgg tgggcgacgc gctaccggct cgtccgttgt tcatggcgag     83220
     accgtcctct ccttacgcac attccagtgt gtctacaact gctgttagag cgagtgtatc     83280
     taatgtatcg gaataatgta gctgagaagt tgcgaccctt gcgacgggtg gcggtagccg     83340
     ttcggccacg cctgtccaag tccgcgtatt cgcttgtatg ctctaggagt gggttatcac     83400
     tttcgcgacg acgttgccga gtccgtgtac ctccacgacg tcacgaaagc cgaggtcatg     83460
     gaagcgctgg cgtacccgcg gcgatggccg cagcggatcg agtcgaaggt cgacgccagg     83520
     gtgctccaga tcttcagccg cacggctgaa ggcaacggag tcgcggtggt ggtgatccag     83580
     attgatcgct gggattggct gatctacgca gctcggcccc tcgaggtgga cgagaacgcc     83640
     gaatacaccg tttgggaggc acagcaatga acatcgaacg ccgaatcgaa gaactgaccg     83700
     cgcaggccgc cgacgccgac ctgatgggcg acttcctggc cgggcgcctg gtccgcagca     83760
     gcgaaccggc cgacgtgtcc gagctgcccg tgccggacgc ggccgaggtg gagtcggtgg     83820
     cgctgatccc cacgacggtc cggttctcca aggcccagcg ggacaagctc accgagctgg     83880
     cgaaggcgcg cggcaccgac gtgtcgagcc tgctgcgggc atgggtcgac caccagctcg     83940
     aggtgaccga gcacccggag cggcagctga tcaccgtcga cgaggcgatc caggcgttgc     84000
     ggaacctgcc gcattcggcc tgaccggaga acgggcggcg gggccggggg agccccgccg     84060
     cctcacagcg ggaacagcga ggattggtcg gcggcgtcgc cggtccagga caggacgttg     84120
     gggaggttcg cgtccggggc gaaggtcagg taggtcccgt cgacgctgtc gcagccgatc     84180
     gcggtcgcgt agtcgtagcg gcggcgcgag ttcacccggc ccatgtggac ccacttgccg     84240
     acgctggaag cgaccgcggc gaggttggcc gcctccgggc cgagcttcca ggcggtgtcc     84300
     ccggccagga acagggcgtc gatctcgtcc catcacccgc ctcgcccggc tctacgagat     84360
     cccgctgcga cgacccggcg gcaggcagcg gtccaagatc cccgacgact ggctgtggtg     84420
     ccaatacgtc gcctcggccg aaccctccca cagatcgccg cagccgtcgg catgagcaaa     84480
     tcagcgatca gccgccgcgc caaaaaggcc ggtatcccca tccggccgcc cggcggcccc     84540
     agccacgcca tagccgtcgc ggtcgccggg tacgaggtcc tgcgaccagc tatcgagtca     84600
     gtcgcgggat ttcaccgact gaagatcctg gcgaccaccg cccgacacaa cacctacgaa     84660
     tccgccgcag cggccttgca actcggcctc aacgacctgt actcgatcct catcgaagca     84720
     gaagccgacc tcggccttca cctcctcgac cggatcggca gcacgaccaa ggtccggctc     84780
     gctccgcacg gtcgcgatgc tgttgtcgct atgcaatcgc tgctcgccac acgacccgcc     84840
     tgagcagctc cctggccgaa gccctgcccg taccggtact tccgggcaac gaccacacga     84900
     aggtcgcatg cactgctcgg ccgaggttgc ttagcagaca tacggatcga cttctactgc     84960
     aagacaacaa caatcctgcg tcgccaacac aacatctcac cagatcgccg ccagtttgcg     85020
     gaggggagca gacaacccgc gtgttcgaat gtatgttcga agcagtggca ccgatgaggg     85080
     gtgtcgctcc cctcacatcg aggggacgca gcgcgacgaa ggagtaagca agctatggca     85140
     tgtcagacct tcccaccgtc accgttccag gtctgtggcg cgattctcga caagtacctg     85200
     caaacaggtg gcccgaacgg attcctgctg ttcccgaagt ctgacgagct caccaacccg     85260
     gacggattcg ggcgacgctc ggagttcctg ggcggcaaca tctactggtc gccgaatacc     85320
     aacgcgcatc cggtcgcgca cgaattcctc accaagtggg gagaatacgg atacgaaggc     85380
     gggttcatcg gctacccgtt gaccgatgag atcgtgctgt cggacggtat cggtcgacgc     85440
     caggagttcc agggctcctg gatctactgg cacgccctga ccggagccca caacatccag     85500
     ggtgcgatcc gggacaaatg gctcgaatcc ggcggcgagc gtgggcctct cggctacccc     85560
     agcaccgacg aagtcgtcac tcccgacggc aacggccggt tcaaccgatt cgaacgcggc     85620
     atgatctatt ggtcgccttc aaccggcgcc cacgcggtca gcggccgcat cctgaccctg     85680
     tggtcagcgg cgggctatga gaccagccac tacggatacc cgaccagcga cgccaccgcc     85740
     ggcgcagaac ccggctcgtt gatccagcag ttcgagcacg gctcgatcta cgtactcaac     85800
     gactacctgc gcgccctgct ggtcccggca caaggattcg ccagctacga caccggcctg     85860
     cacccgggct actgccccga cccgctgaac tcgcccccga cctgcccggt cgatctgtcc     85920
     gactacgaca ccgttcccga cccgttcgga acgctggtca cggcgaatat gcagaaggcg     85980
     gccctcgtgt cgacctactt cgcggccaac gggcgtccca acgcccacga gctgtgggag     86040
     cactactacc gcaacaccgg cgacgactac gtactcagca gcgcgttgct cgattcctgg     86100
     accgccgagg agagcaccga ctacccggga ttgcggccac cagcagaact ggtcaacgcg     86160
     aacaaggtgg aagcgatcaa cgccgcgatc gcggaaaccg cgcgtaccgg ccagactgcc     86220
     aaggtcatca tctccacgcc gtggcaggtg actgccggga tcagcaacga tcaggtgcag     86280
     tcgatcggtc gctacagcct gtgctcaacg accgcggtca tcgcccagcc tgccaatccc     86340
     ggccagaacc cgatcgagct ccggcaacag acccacatct acgacgtcta cgactacgcc     86400
     gccggcgacg actacggcaa ccccgcccag gatgcggtcg ctgtcgcggt cgaaggggag     86460
     aagctgggca tcgccaaacc gttcctggtg ctcggatcgt cgtcggtcca ctcctggtcc     86520
     ggcatccgct gaggatggct atcgccccgc cgcaccgtcg cggcggggcg atgccgcaca     86580
     atagccacac gggggactga accagagtgc ctcacccgac cgatcaagga acctgcccat     86640
     gtccagcgcc gccccaggga acgtgtcacg accgtgtagc gcgggatggg gcgtcggcgc     86700
     ggggctgttc gtctcgacag tggtgttcgt acccgctgtc ttcgtggtgc ggcagtggtt     86760
     ggatcttccc gagatcccgg cgacgccgtc acacctgcgt gctcacccgg tcgaggtacc     86820
     tgactcgtac tggatcacct ggctcgtcgc cgcagtcgta ctgctcgcgc cgggcgtggc     86880
     gctgatgctg tggccgagga tgcgacgggt cgcgatggga tacaccctta cggcagggtt     86940
     tgtcgccgga ctactggcgg cgttgacgat cgggttcgaa ctcggcggtt tcgctcctac     87000
     ctgatcacca gggcgaccga gggttgccga gggcgccagc ggccaaacac gactcaccga     87060
     gcatcttgcc ggagaaactt gcctcggcgg ccgacagcgc caggctgccg gtggacgaga     87120
     cgtccccgtc gagaaatgac atcgaactga gaatcctgcc tatgacatcg cggtgagaac     87180
     gggcgagaac gcgcaggtca atcgccatga ccgatgacac ggggtctgag gatctacatg     87240
     tcgccggtca ggtcgacatc gggaacagcg ccaggtcggt gccggtggcc tgcgcccacc     87300
     agtcggcgaa tccgggccgt tccttgtcgg cgacgacggc gggggcgaca acgaagaagt     87360
     gctccagctc gtgcgggccg gtgccgtccc ggccggggac gaccgcgcgg gcgatgccgt     87420
     cgtccccgag ctcgcggtgg gtgtcgacga gcgccgggga gccgtcgggc ccgccgatat     87480
     cgacccgcag cggagcgccg tcgagccagg cgaccatctc gtcgcgagag ccgacgtcga     87540
     ccgcgcgcac cgatcgcgcg accatcttgg caccgccggt ttgggtgcgc cgggcgaggc     87600
     ggcggacctc gtagagggcg tgcggttgct cggcgagcgc gctctcgaag gcggtcagga     87660
     cgccggtgag tccggccgcg cgcacgtagt cgatggcgcg cttgccgccg acgaggccct     87720
     gtttggcgtt gagcgcgagc gcggtgtgct ccatcagcag catccgcgcc ccggcgtccg     87780
     ggaactccgc gtagcgcgtc agagtggcgg cgcgattggc ggcggtgacc agcgcgaaag     87840
     gacagaacac gcacgccgac ttctgccagg cccggccggt cttctcgtcg atgtaggcga     87900
     gcacccgttc ccgatcccag ccccacgaga ccagcgggta ctcaccgcgc cgcagcgcgg     87960
     tgtcgtaccc ggcgtcgcgg cgggcccgcg acaattcccc ggcctcgaac cccacgacgt     88020
     ggcggtacgg ccgtccgtgc gtgatcgcgg cgatcaccgg gtcgagcact tcgcctttgg     88080
     ctgacatgct gcaccggcga ctgccaccga cctgcggctg aatgccggcc gtgagcatct     88140
     cggtgccgag ggtgtaggcg ccctcgatat ggaggcggtg cggcgatcgg gaatcgtcga     88200
     agacgacgac gccggtgcca tcagcgcgca cccggcggtc ggcccgcccg atctggatga     88260
     accgaatccg gtgctgggcc agtagcggga gcacgacctc ggtcacgtcc cgtgcggtgt     88320
     cttcccattc gtcgccgacc atggcggtga cgacggccag ctccgccagg tcgaagtcgc     88380
     ggctgtcggg gtcgaagatc cagcgcagca gcagggcggt gctgtcggcc ccgagtcttc     88440
     tcccgcttat tacgaggtgt tgcagtccag aggtgttgca gtccaagggg gaccagcgga     88500
     gggactgtac ggtttcggcg ctgtcccggc gcggcgctga ggttcgtcag acctgtgctt     88560
     ggatcgtggg aatcatgggt tcggagtagg ccatgtgcgc gatgatcggg gtatggctga     88620
     ggcggcgacg agcagccggt gctgctatgg ctgaagctgg ccgacttgat cgacaagctc     88680
     attcagcagc tggctgcctc ggtgctgaca agcgccgctg gcccccgctc ttgcttatct     88740
     gctgctgggg gccgaccacc gagccgagct cgcagcctgg gtgccatcca gaagatgatg     88800
     tgctgccacg aacctgccat catcggaacc gtcagcgcat gtaggagacg atgctcatca     88860
     ttccggcttc accgtggtag gcgttgtggc agtggaccat ccactgtcca ggattgtcgg     88920
     cttcgaagtc gacctcgagg gtctgcatgg gcagcacgat ggaggtgtcc ttgcgtggcc     88980
     cggtgcccgc agcggtgacg acctggaagg tgtgaccgtg caggtgcatg gggtggaaca     89040
     tcatcgtctt gttgacgaac cgcagccgaa cccgttgtcc ttcggtcaca tcgagcatgg     89100
     cgtgctcggg aaacgccttg ccgttgatca tccagaggta tttggccgca ttgttttcga     89160
     gggtgagatc gagtgtcttg tcgggcttgc ggaggggcag gcgtacggat tcggcggaga     89220
     ccagccggtc ggcggtgagc gggggtgccg ccagttcggc cgggcggacc tcggcgggtg     89280
     gcggtgcgcc ggcgccggtg cggaggaggg cgaagccttg gccggtcttg ccttcggcgg     89340
     aagcgaccag cgggaatacc ccgtcggcca gttcgacgac ggcgtcgtaa cgttcgccca     89400
     tgctgatgag caggctggag gtggtggccg gctgcacggc gaagccgtcg ctgtgggtga     89460
     cgcgcagttg gtggccgccg acggcgacgc ggaaggcggt atcggaggcg gcgttgatga     89520
     tccgcagccg gattcgctgg ccggggcgtg cggcgatcgt gaccggatcg gcgccggtgc     89580
     ggccgttgat caggtggtac ggatagtcgc tcacgtctcc ggtgtcggaa ccgagcggtg     89640
     cgttggggtc ggtgggcatc gccatcgtgg aggaaccgcc catggccatg ccgccgtggt     89700
     tcatgccgcc catgttcatg cccgacatgc ctttggcgcg tagctgatcc agttgcttgt     89760
     ccgggtcgcg gctgttgacg ccgtcgagcc agtcgtcgag caccacgacg gcttccaggt     89820
     cgtagtcctt gccgtcggcg gggtcctcga tgatcagcgg cgcgtacagg ccgcggtcga     89880
     gttggactcc gacgtgtggg tggaagaagt acgtgccggg gtcgggtgcg gtgaattcgt     89940
     agccgaaagt gccgcccgga gggatctgcg gttgtgtcac ctcgggtgcg ccgtccatgt     90000
     cgttgcgcag tgcgatcccg tgccaatgga ccgtcgatgg tacgggcagt gcgttggtga     90060
     gttcggcccg cagtacatct cccttggtga tgcggatttc ctggccgggc agtttgccgc     90120
     cgtaggccca ggtctggacc tgcacgccgc cgaggtcgac ggtggcgggc tcggcgtgca     90180
     agctcacgtc ccgaacggcg gcatccgccg cccgccgtgt gttctcggct gcgcggactg     90240
     cctcggagtc cggttcgacg agtgtgcgtg acgcggtgga atctttcgag caggcggcga     90300
     gaacggcggc tgcggtgacg ccggtgccga gggcgaggaa gccgcggcga gtcatcgacg     90360
     tcgggtgggg gaactggctg gatgacatgg tttctccctg ggtgacgatg ggggttccgc     90420
     cgtggtgtca gggcggatgc ccgtgatctg gtgcagccag gtcgggtcgg atgccgggga     90480
     gtgcatcgag ccgtaccggc tgtcgctgct cggatagacg gcgatgaacg ccgcgccgcc     90540
     tggattccga cagcatgggc ctaccgcttc cgggaatacg cggaagcggt aggcctgtca     90600
     gatcctcaga atcgatagtt cggccaggga aggcacgacc caagggggtg gtcgttcgcg     90660
     gtgcaggcgc aaggacgccg ttgtcggcat cgggccgatg ccgcgcgaga ggtggcccgc     90720
     tcgatacagc agtaccaggc cgatcgccag cgtcagggtc gacaggatga acacgcaggc     90780
     gtgcaccgcg tcatggccga gaccatggcc gccgcccccg atggtgacct catcgtggag     90840
     ggtcgtcccg gcggtgatcg acgcaggaga ggagccggcg tggtgggcgt cggacccgag     90900
     gtggaacccg ccggtatgca tgacggtgat gccgagaagc agcaccagca ggccgagcac     90960
     ccggactgac cgggatgctc gcgacgactg gtgctgcatc acaccgtcat catagtgtcg     91020
     gcatcgccct actcgagcag gttacccctg cggggtaatt tcgatgcagg ttccgactgg     91080
     atatataccc catatgggta tatatagtgg tgtcgatgcg gatccgtgaa gtcgggaaaa     91140
     tggcggtcga aatgatgggg cgtgatcgac gaagccgccc attgggggcg tcgttacctc     91200
     gcatcagcca ctcacaccgt cgggagcttt tcctcggtcc tgctacagtg ggctcactgt     91260
     gaggttcccc ggtcgattgc gacatgccgg ctccgtggtg gcgctgctcg ccgcggtgct     91320
     ggtcgtcgtg ccgctgatcg actgctcggt ggctcgcggt gacgtgcacg tccacgcttc     91380
     ggcccatgcg ggtgctggcc accacctcgc ctcgtccccg gggggcgatc acgtccacgc     91440
     ggtgatcatc gatgcgctgg acggtcattg cttggcgcac ctcgatcact gcatcgccaa     91500
     gtcggtggtg cgtggtgccg ccgagaatct tccgccgcaa aaactgctgc tcttcgccct     91560
     ggcatcggcg ctgctcgccg ctgttgccgc ccggggtgtc gcgcccggag gggtgcgcgg     91620
     tccgccgatc tcgcgggtac ccgtcgctgg tggacgggcg actctgacgc agttctgtat     91680
     cgctcgacgc tgacaggtca gcgccaagcc gacgtgtttc tttgtgtcgg ccggtgtctg     91740
     ctgcctgctc acgtccgcgc cgcctacctg gcggttcgat acagaaagcg acagtcatgg     91800
     acaagctcgt tctcgatgcg cgcaccgatc gttcatcagc cctgatggtc gcgcccgcgc     91860
     ctgcccgctt cccgcaatcg ctgatcggca acacccccgt gttgtgggtc ggtgcgccgc     91920
     tcgcgcccaa gggacggggg ttctgggcga agctcgaagg attcaatccc ggcggtatga     91980
     aggaccggcc cgcgctgcat atggtgctca aggccgagca gcgcggtgat ctgacgccgg     92040
     gggcgcggat catcgaatcc accagcggca ctctcggttt agggttggcg ctggcgggaa     92100
     tcgccaccca tcacccggtg atggtggtga cggatccggg tctggagccg atcgtcgcac     92160
     ggatgctcac cgcctacggc acccaggtcg acgtggtcac cgaggcgcat cccgcgggcg     92220
     gctggcagca ggcccgccgt gaccgggtcg cggagctgct ggctgctgat cccgatgcgt     92280
     ggtgcccgga tcagtacagc aaccccgaca atgtcgacgg ctatgaatcg ctggcgctcg     92340
     agctggtcga gcagctcggt ggggtggacg tgctggtatg cgcggtcggc accggagggc     92400
     actcggccgg ggtggcgcgg gtgctgcgcc agttcaatcc cgagatgaag ctgatcgggg     92460
     tcgacaccgt ggcgtccacg attttcggcc agcccgcggg gccacggttg atgcgggggc     92520
     tgggctcgag catctacccg gtcaacgtcg actacgacgc attcgacgag gtgcactggg     92580
     tcgcgccgtc ggaggcggtg tgggcgtgcc gtaccctggc ggcgacccat cacgcgaccg     92640
     gcggttggag cgtcggcgcg gtggcgctgg tcgcgggctg ggcggcccgc acccacgaca     92700
     ccgatacccg gatcgcggcg gtgttccccg acgggccgca ccgctacttc gacaccatct     92760
     acaacgacgc ctactgcgac gagcacggcc tgctcgacgc ggacccgccg gtggaaccgg     92820
     acacgatcgc ccatcccgcc gagcgcgtgg tgcggtcgtg gactagaacc accaccgtcg     92880
     tcgatcccag gcagttcatc cacgaccagg agttggcctc gtgagcgtcc tggcgaaatt     92940
     ccgtagcttc gacctgcctg cccggctgtt gatgatcaac cagttcggca tcaacctcgg     93000
     cttctacatg ctgatgccgt atctggccgg ttacctggcc ggtccgttgg ggctggcggc     93060
     gtgggcggtg gggctggtgc tgggtgtgcg gaacttctcc cagcagggca tgttcctcat     93120
     cggcggcacc ctggccgacc ggttggggta caagccgctg atcgtcgcgg gctgtctgct     93180
     gcgcaccggc ggcttcgcgc tgctggtgtt cgccacctca ctgccgggac tactggtcgc     93240
     ctcggccgcg accgggtttg ccggagcgct gttcaacccg gccgtgcgcg cctacctcgc     93300
     cgccgacacc ggtgaccggc gggtcgaggc gttcgcggtg ttcaacatct tctatcaggc     93360
     gggcatcctc gccgggcccc tggtcgggct ggcgttgatg gctctggatt tccggatgac     93420
     cgccgctgcc gctgccgtgg tgttcgcgat cctcaccgtg gcccagttgt tcgcgctgtc     93480
     gacgcggcga gccgagatcc gcgccgagcg gacctcggtg ctcgacgact ggcgcaccgt     93540
     ggtcgccaac cgccggttcg tatggtttgc ggtggcgatg atcggctcct acgtgctgtc     93600
     gttccagatc tacctcgctc tgccgctgca agcggaattc gtcgcaggcg ctcaggctca     93660
     gacgctggtc tcggcgctgt tcgccatctc cggtctggtg gcggtcgccg gtcagctgcg     93720
     catcaccgcc tggttccgcg acaggtgggg caccggagca agcctggtcg tcgggctggg     93780
     catcctcgcg gcctcgttcc ttccgctcgc gctcattccg gaccccgatc ggttcggtgt     93840
     cccggccgcg gctgccgcgc tactcctctg cgcgatgctg ctggccgtgg gaactgcggc     93900
     ggtgttcccg ttcgagatgg acaccgtcgt gtccttgtcc ggtgggcggc tcgtcgccac     93960
     gcactacggg ttctacaaca ccgtcgtcgg ggtcggcatc ctcaccggca acctcgctac     94020
     cggcgccgtg gtcggcgccg cacgcgccgc cggcatggac tgggcactct gggtcggcct     94080
     gagcgtgatc ggtgttgttg ccgcgctcgc tctccatcgc ctggaccgcc cgcagcacgc     94140
     cgaggaagat ggccagtcga ccgacgttcg gggccgccac cgcatccccg aagaccacgc     94200
     catcggcacc acgctggtcg agcaggaatt cgactacacc ggacgcggtc actggccgac     94260
     gaagatcccc gccgggcgac gctgaccacg gcctactggt gcagtgccct tcgtgtccgg     94320
     ggtgctgatc tgccggaaac gctggcagat gtcgtcatcg ccgggcaggt gcttctcgca     94380
     cgctcacctc tgcccgagca ttgccttcat ctggtcgatc tcgcgctgct gtgccgacac     94440
     gatctcggcg gccagctgct tggcttggtc gttggctccg gtgtcgagtt cggtctgggc     94500
     catctgcacg gcgccggtgt gatggccgat catcatctgc agccacatcc ggtcgaattc     94560
     cgccccggac atgccctgca gcgacgacat ctgctccggc gacatcatgc ccggcatgtc     94620
     atgacccatc gggcccatcg ggccggcggt cggggatggc accggcttgc cgaactcctc     94680
     gagcagcgaa cggatctgtg ccatctcggg ctcctgcgcg gctttgacag ccgaggcgag     94740
     atcgagcatc tgcgggttct gcgagtgcga gggcaccata tccgccatct gaacggcctg     94800
     cgcgtggtgg agatacatca tctgcagaaa cgtcacatcg gcatcgttgt aggtggccgc     94860
     cggcgcggac gtcgcggcgc cgacggtcgt cgacgtcgcg ggcgcgctcg ctcccgcggt     94920
     cgtggttggc ttgccggcct cgtcgctgtc gccgcatccg gccagaacga acagcaggac     94980
     agcaacgccg ggaacatatc gccgaagcgt ggtggaacgc agaggcatga cgaactccta     95040
     gctagagccg gggacaacgt gaccttcaca ttgagaaatg tgtgaaacga accgctgagc     95100
     ccgaggaagg gggccttcca tcgttgccgc tgaccatcga aaaaccgccg acaacgatgc     95160
     cgaagcaccg gctgattcta gaccgctggt gcgcgccggg gccgcagctg cgaggttttc     95220
     cgctcgtgtc cgatgcgaaa gcggtcggtt gtgtcctgtg agggcacata atcaggccgt     95280
     cgcattccgg cgcgcgtgtg tcacggcagt aagtgtcttt gggtcccttc gtcgctgaca     95340
     ttggcccata ggcatccgac gctgcggcag agattgttga ccttacttct cgaaggagtg     95400
     ggtcgcccgg catccatggg atgtggggaa tggttggcag aggacttcgg cgatggcgga     95460
     tgcggcatac ggcttgtggc cgttggtcat tttgaacacg gcgttgttcg tggcgttcgc     95520
     gctgagtttc ttccatccgc gcacgaaccg cgactggcgg gtgatgagtg gttacaccgc     95580
     gttcctggtg gcgctgttca ccgagatgta cggcacgccg ctgacgatct atctgctggg     95640
     gagctggctg ggctcgcgtt ttccgctgct gcgcgacagc cacgcgggtg ggcacctgtg     95700
     gaacgatctg accggctgga ccggcgaccc gcacctgagc ccgtttcatc tggccagcta     95760
     tgcggctata ggtggtgggt tctggttgat tgccgcggcg tggcggccgc tgcacgaggc     95820
     cgcccgcgcg aaccggttgg ccaccaccgg cccctacgcg cgggtgcgcc acccccagta     95880
     cgacggattc ctgctggtga tgatcgggtt cctgctgcaa tggccgacca taccgacact     95940
     ggtgatgttc ccgatcctgg tcgtggtgta cgcgcggctg gcacgcagcg aggaacgcga     96000
     ggtcgccacc cgattcggcc gcgagtggac cgactacgcc gcccgcacac cagcattcat     96060
     tccgcacttg ggcgtgggtg cgagcttgcg cgccgctggt gctggaaggt cgcgatgacc     96120
     ggccgagtcc gaccggcatc acccgccggt cggcttacac cgacgcaccc tgcgccccac     96180
     tcacgaagac gaaatcgggg ccgatgagca ggaggtcggt aacaccggca cgcatctgtg     96240
     tgcacgtatc aagcgatgac accgctacgc cgaccgaggc actgccatca ccgaccgcat     96300
     gagcaagacc cgcgccgcgc tcgccagggc cgcggtcggg acatggtggg gcttgttcga     96360
     catggtgggg ccttttcatc gggctgttca ccgtcggaac ggcgtggttc gccgtgatca     96420
     tcggcggcct gatccggacg gtatgtggtg cgattcggtt acctcgcgag cgcgcacgta     96480
     gaaagatatc ggacgacctg tatcggtgag gtcggcggtg ataccggcgg tggggccgtt     96540
     cagccgagcg cccggatgag atcatcgcag gcttgttcgc agcggcggca cgcttcggcg     96600
     cacacgcggc agtgctcgtg agtgtcagcg tgggcggagc attcgtcgcc gcaggctttg     96660
     caggctgtgg cgcacgcctg cagaatcgcg cgggtgatgt tggcgtcgta accagtgtgc     96720
     cgggacagga ctgatgcggt ggcgttgcag atgtccgcgc agtccatgtc ggtgcgaatg     96780
     cacttggtga gctcgccgac caagccctcc gacaggcagg catccgcgca cgcggtacac     96840
     gcctgggcgc aggcgatgca atcctcgatg cacctggtca gcttgtcgcg atcgacatcg     96900
     ccgaggtcgg ccggataggt ggcgagcatg tccttgaccg tggtcatggg gatattgcct     96960
     cccttcactg cccggaggcc gggccggccg ggatggcgcg cctcttcgac ctcctgccgc     97020
     gtgggtagcc accgcgaagc gacgcaaacg cgcccagtgg gcggtccccc aagcagccga     97080
     gcccacctgc cggcgtaccc aacgtggtga tcgttttctc ggttgccctc ggccccgggc     97140
     cgccgtgtcc tacgcgacta ccggtgttgc ctcggatgtt ccggtgtgcg tgggtttcgg     97200
     tgtggggagc cggagtcgtt tgagggcgag ggcgttgacg gcgacgatga ggctggatcc     97260
     ggacatggat agtgcggcga tctccgggcg cagcatcagg ccgaaggcgg gttcgaagac     97320
     gccggcggcg atgggcaggg cgatggtgtt gtagccgatg gcccaggcca ggttttggcg     97380
     cattttgccc agtgtgccgc ggccgatgcg cagggcggtg ggcacgtcga gcgggtcgga     97440
     tcgcatgagc acgacatcgg cggtttcgat ggcgacgtcg gtgccggcgc cgatggcgat     97500
     gccgaggtcg gcttgggcga gggcgggggc gtcgttgacg ccgtcgccga ccatggcgac     97560
     ctggcggccg ctgcgttgta gttcggcgat cttggtggct ttgtcgccgg gcagtacttc     97620
     ggcgatgacg gtgtcgatgc cgagccgctc ggcgatgcgt ttcgcggtgg cttcgttgtc     97680
     gccggtgagc atgaccacct cgacgccgag gtcgtgcagc gcggcgacgg ccgccggtga     97740
     ggtttcgcgg ggcgcgtcgg cgatgccgat gaccgctgcg gccttgccgt ccacggcggc     97800
     gatcaccgcg gtgcgtccgg tggcggccag ttcgtcgcgg cgggcggcca gcgcgccgag     97860
     gtcgatgtcc tctcgttcgg ccagccgccg gttaccgacg acgacacggc ggccttcgac     97920
     ctcggcgatc gcaccgtggc cggggacgtt ctcgaacttt tcggcccgaa cctgacctac     97980
     ccctgcgttt tccgcgtagc ggacgacggc ctgggcgagg gggtgttcgg attcgcgttc     98040
     caccgcggcg atcaggcgca gcacttcggt ttcgccgatg ccgtcggtga tgacgtcggt     98100
     gacctcgggt tcgcccttgg tgagggttcc ggtcttgtcc attaccacca cctggatgcg     98160
     ggctgaagtc tccagtgcca tcgcgttttt gaacaacaca ccgcgtttgg cgccgagccc     98220
     ggtgccgacc atgatcgcgg taggggtggc cagcccgagg gcgtccgggc aggtgatgac     98280
     caccacggtg atcgcgaaca gaatcgccgc cgagaacggg cgatcggaca acagcagcca     98340
     ggccgccagc gtgacgccac caccgatcag cgcgacgaac accagccaga acgccgcctt     98400
     atcggccaga cgctggcccg gagccttcga attctgcgct tcctgcacca gttgcacgat     98460
     ctgcgccaga gcggtgtccg caccgacctt ggtcgcgcgc acccgcaagg tgccgttgga     98520
     gttgatggtc gcgccgacga ccgccgcgcc gggggccttg tgcaccggca ggctctcgcc     98580
     ggtgaccatc gactcgtcga cctcgctgtc accgtcctcc acgaccccat cgacggcgat     98640
     cttcgcgcct gggcgcacca gcagcagatc accgaccgcg acctcggcgg tgggaatctc     98700
     gacgggttcg ccgtcgcgca gcaccagcgc tttcggcggc gcgaggtcga ggagggtgcg     98760
     gatggcgtcg ttggcgccgc cgcgggcgcg catctcgaac cagtgcccga gcagtacaaa     98820
     cgcggccagc acggtggcgg cctcgtagaa cacttcgccg ccgccggtca gtgtgatcac     98880
     cagcgagtac agccagcccg agccgatcgc gacagcgacc agcaccatca tgtccagtgt     98940
     gcgggcccgc agcgcccgca cagccccgtc gaagaagatc cacgacgagt agaagatgac     99000
     cggcaggctc agcaacaacg cccagacgtc ctcacgcaga ccgaacggca ccggaacgtc     99060
     cagccgcagc acgtcgcgcc cgatcggcga ccagatcacg atcgggatcg agaacagcac     99120
     tgccacgagg aaccgatttc gcatgtcggc caccatcgat gccatcgaca tcccggcatg     99180
     cccgccgtga cccatcgcgt catgcggaga acgcaggtcg ccggcgccgg ccgggtgctc     99240
     ggtatgagca ggggcggccg cgatgtgccc agcatgctcg atgggttccg tggtcgcgag     99300
     ctgaccggcg tctccggttt gcttatcttc ggtgggtggg tccggttcgg tcagcgggtc     99360
     gcagatgtgg gccggcaccg accgtccggc gcagtggtag ccgcattcga tgacccagtc     99420
     ccgcagcgcg gcgatcgtgg tctgtgtctg gtcgtagacc acagtcgcgg tctgcgccac     99480
     cgggttgacc tcgacctgat atacgccggg gcggcgagcg agcctcgcgg cgacaacatt     99540
     ctgctgcgag gcgaacagca ggccacgcac atccagcacc gcggtgacac gttccttcgg     99600
     cgaatgcgta tgggcatcga aatgggttgc cacggggtca ctcctccaga agccggttat     99660
     tcaacggtgt tgcctgcgga cggtgatttc cggtgcggat gggcgggcga cctcatcgaa     99720
     tggtgagcgc ctccctatac gagtagcgag cggtggtgta gccgccgtcc ccggcgcgaa     99780
     actctgcgcg tcgccgcagg gttggagcgg tgcggtctgc gccgggcgga cagtcatggc     99840
     accctccgag tactactcgg cccttactat cggtcgccgc cgctgttcgt acccggtccg     99900
     gaaccgatat cgccgcgcaa tgtagccagt cgctggtggt attcgtcggc atcgatctca     99960
     ccgcgggcga atcgctcggc cagcacctgc tccgcactcg ggcgcacgat cggcgcgccg    100020
     ccgaccggcg cggacggcag ggccaggtac cggaccgtca gaattacccc ggcgagcacc    100080
     agcgcccaga acaacaccat cccgaccgtc atgagcccgt aaccccaccg gctcatcccg    100140
     tcgccatacc agaacatcat cgtgcactcc tcgatcgata cgaactcacc gctgtcgtcg    100200
     cgacatcctc atacccgctg tcgtgtggtt cggcgcgagc gatccgcact cccaacggtc    100260
     cgcgtcgccg agcgcggccg gtagagacca ggtgcccttc tggcgcatcc gaaggtccct    100320
     acccccggcg ggtatcacca agcagacttg atacatacgc tgccgccagc tgccactgca    100380
     ggcgaatacg gaacggatgc gagcgcttgc gactgtcgac cagcagtcga gggtcagctt    100440
     ctgcgctgtc gggatatcgg cgcgcgaata ggcgcacaca tggatgatcg cacccctcgt    100500
     catggaggtg atcggatggg cgaggtactg cacaccgcga tcgaggtcgt ggccatcgcg    100560
     gtcgggaccg ggatcctcct actgatcgtg ctgtgcgcac ccagcgtatc ggagctggcc    100620
     gacatcctcc gacagcaccg ctgcacaacc ggccggcacg atgcgccgac aatcccgaat    100680
     ccgagacacc accgccgaac cgcgccgctc ctcctcacac cgcaaactcc atctgcctgg    100740
     tcgacatctg cagacgaaca gttcacgcgc actcttctcg ccgacgaaga cgctgccgct    100800
     cgccagctac tcaccgggcg aatgagcaag tccgcctacc ggatacggat gcaggagttg    100860
     gcgcgccgca acgagcgaac ttcccgaccg ccaccctgat cgaccgatac gacgccgcaa    100920
     cctgcacagc cagctcggtg atcagcattc accgtgccat cgaccgcagc accttgacag    100980
     cgacgcaggc cgcggtcgaa ctgggcccgc atcggccgtg acaccaccat cacgtacggc    101040
     cggggagccg attcgggggc gtgtcacatc ggctgcccca tcatcgggca accgcccatc    101100
     aggctgcaca tccattgaca caacatgtgc atggggttca tatcgtcgat ctccttctcg    101160
     tcgagcgatc cggccgcagc ggccggcccg caggggttgg acgtgccggt gtcgtcgagg    101220
     ttgccgcgtc aataccccgc attggtaggg acctttggcg gtcggatgga ggtcgttcgg    101280
     cgccgctgga ggcgacctcg tcccatcctc ggctacgggt gtgcgagcgc agagtggagg    101340
     tgatcgcgag agaagggaat gcgatgaata ctcggtatct tccgtggtac gcgctcgcgt    101400
     tggccgtgtt ggtcgctggc ctcgccattt cgggagtgtc ggtgtcgacg ctgctgctca    101460
     tgctggtggt tttggcctgc ccgctgatga tgatgttcat gatgggcggc cacggacacg    101520
     gcggcaatga cgataagcca tatgagatgg gcaaacgcca cgaccatggc cccacttccg    101580
     gccggtcttg aacgcgccgc agaggtgtgt gagtcatctt ggagaacacc gtgactactg    101640
     accccgacgc agtcgaggcc acggcggacg agccggtcac cgcagtcaca cgagacacga    101700
     cgccgcttct ggtggctgag gggctcgaga aggcttatcg ccgtggtggc cggttccttt    101760
     cccctcgcgt gccggtgttg cgtgggttcg atctgcggct gctgcccggt gaagtggtcg    101820
     gcttggtcgg ggagaacggg tcgggcaaat cgacggtcat gaagatcctg gtcggtgacc    101880
     tgtctgcgga cgcgggcact gtcacgcggt cgggccggtt ggggtactgc ccgcagcaac    101940
     cagtcctgta tgagcggctg acctgcgatg agcacatcga attgttcgcc cgcgcctacc    102000
     ggatgacccg cgaagctgaa caccaggcgc ggcgtgagtt gtatgccgcg ttgggattcg    102060
     aacgctacgc gagcactcgc gccgaccggc tctccggcgg caccctggcg aagctcaacc    102120
     tcgcgctggg gttgctggcc gaccccgagg tgctgctgct ggacgaaccg tatgccggat    102180
     tcgactggga cacctacctc aaattctggg aattcgtcgc cctccgccgc agcaccggcc    102240
     ggtcagtgct catcatcagc cacttcgtcg ccgacgagca ccgcttcgac cgtatcgtcg    102300
     aactgcgcga cgggcgggcg gtcgaacgat gaccgcggta gcggcggtcc cggccccgcc    102360
     acgaccggcg gtctggccgt ttgtgcggtg cttcgtcgaa gactacttcc gcaacccggt    102420
     caacctgatc gtgctgctgc tcgtgcccac cgtcttcgtg ctggtcgcgg ctggaagcat    102480
     cgcccaggcg atggaactgc tgggccgcag tctcggatcc cgcccggccg tggagacggc    102540
     gaccgctggg tgggcagcgg cgttcctgtc cggtatcgcc atgtatttcc aggtccgatc    102600
     cgcgcgggcc accgatcggc ggctggtgct ggccgggctg tccccggcgc ggctggtcgc    102660
     cgcgcgagcg gcggccgggc tggtgctggg ggtgctcgtc tcggcggtgt cgctgctcgc    102720
     actcacagcc cgcaccggta tcggtgaccc gatccgggtg atacccgcga cggtgatgtt    102780
     cgcggtgatc tacctggcga taggcgcggt agtcggcata ctcgccacca acccggtcaa    102840
     cggggcggtc gtgatcttgt tcgtgtggat tatcgacgtg ttcatcggcc aggtcggcga    102900
     caccaccgag cagatcagcc gctggtttcc cacccatttc gttgcccgat ggatggtcgg    102960
     gcttccaacc ggccacgccg gacgccttgg tgacctcggc gcatcactgg tctgggtgac    103020
     cgcggccgca ctggtcgccg cggccgcact ggtcaccagc tcccgcacca ccacccgccg    103080
     ggctgccgga cagttgcgca ccgctctgcg cctgggtgtg gtggagctga gccgcaaccc    103140
     ggctctcgcg gtgttgctga tcgtggttcc cgtggtcttc gtgctcctgg ccgaaatcac    103200
     gaccccggca cggtccatcg tgatgcccct acgcgagaac ggcgcaaccg tcacctcgac    103260
     gttctggttc cctgaggtac acgccggaac gatgacaccg atcgcggtcg gctccctggc    103320
     cacgctggcc ggactgttcc tcgctctcga cgccgccgac ggcgatcgcc gactgcggct    103380
     cgccggatac cgcgctgggg tcctgctcac ggcgcggctg ggagttatcg cgatggcggt    103440
     actcgtggtc accgccgcgg cactcgcgat caccgcgacc gtattcgacg cccgccaatg    103500
     gaccggatac gccgcagcga atctgctact ggccgcaacc tatgcgctca tcggggtgat    103560
     catcggaccc ttgttcggcc gggtcgcggg ggtgttcgtc gccttcctca tcccgtttct    103620
     cgacctcggt ctggtgcaaa gcccgatgct gcgtcccgaa ccccagccct gggcgcgcac    103680
     cctgcccggc tacggcggca gccgcgtcct gatcgacacc ggcctcaccg atcacttcga    103740
     cgagatcggg gcactgctta tcgcactggc ctggttgacc ggcctggccg ctgtcgctgc    103800
     gctgctctac atcgggggat acccatccca ccgcagtatc cgattcggat cgtcacatca    103860
     ataggctgcc cgagagatcc gacgcttcca acatggatga cgacaccagg aacccgaggt    103920
     gccgaccccc agctcaacgc atcacagcga tgacaggtca gatcactgtg gggctgtggt    103980
     agggcctgct cctacttcct cagcgtcgac taccgggact ggaaactcga cgacccgtag    104040
     ggaaggcgtg ggcgccggcg acccatttgg gacgagatcc gcaggctcat cgaagaactc    104100
     gtcgccgaac cgttgcccac ttgcgcctga ccgcacgccg ctttccgcgc ctcgtggcgg    104160
     agcggagggt catgtcgagc tactttgcgg cctcatgccg gcttccggat gctgggccgt    104220
     gttgtcagct cgtgtgcgag gcgcgccgtt ggagaatggt gacttcgtgg ggtccgccgc    104280
     gagaagacgg gcgttctcag tggccagttc gtggatgatc tgtgcgtaga cggccacctg    104340
     ctgctcgagt tcggccttgt cggcgcgcag ttgctcgttg cgggcggtca gatcgatgac    104400
     gcgggcttgc agatgctgat aggcggcggg gacgccgttg gcatgggctc tgcgtgacag    104460
     gaattcctct cgcaggtcga tgtgcttgtg ggtcagcacc cagcgtttga cgccggcttc    104520
     ggcggcgagc tggagtacgg tcaacgcgcc ggtggagttt gtcggttcac cgggcgagta    104580
     ggcgttgcat ggctgcccga attgcggcgc gttcgtcgct gtctgatggg ttcacgcgct    104640
     gttccgatgc tcggcgatga tcttgtcgat gcgggtcagc tcacggcgtt cccgcagggt    104700
     gcggatcggc ggtgcgagcg gatcggccac gatgagacgc agttggtcgg cgtggcggct    104760
     cagttcggcg atgtcgcggt cggttcgggc gatgttggcg caggtggggc ggcaatcgtt    104820
     gacgtcgggg gtgcggcgag tgccctgctc gtcgctggcg agccgacacg ctgccttcgc    104880
     gggatcgagg acacaggtca tcgcgttgcc cttgtagatc tgaagatcgg ggttcgccag    104940
     cagcgctgcc gcgtcgcggg agctgcgcag gactcgaccg gcgaaacggg tcgccgactc    105000
     gacccgttgg cgatagacct ccgccgcggg gcccgagacg tgctctccgt cgcgtagacg    105060
     ctggtgggcg tcggcgcgat tgtcgagccg ggtgagccat tcctcgaaga cgaggtcgtc    105120
     gggaaatccg gagtcgtagc tgccggcgta tccgagggtc ataccggtgc ggacgtggcc    105180
     gtactggatc gcggcggcga ccaggccgcg ggggcgtcgc acgatgaacc acgccagcgt    105240
     gcgacgtagc cgtccgagac tgatacttgc cttgaccggg tcgggcggga tcgcgtcggt    105300
     tcggccgtgc tcggcgcaat agcggttgac ccagtcgagg agcgcctcga tgtccctggt    105360
     catcagttgg tcatttcggg cggcgtggac gactctggcc ttgagccggt cgggtgagga    105420
     gatgccgttg acctctatcg tattcggaaa cagcagcgca gagtcgtgga gcctgcccac    105480
     gacctcgacg gcaaccgcga ccggttccac cacgacccag ggatcgacgc ggtactcgcc    105540
     gtcgggtacg gctgcgccgt cctggccgcg gacccccttg aagtgcttgc cgcgcaacag    105600
     gaccaaaccg gtggccgggt cgcggtcgat gcagcagcgt tccaggttca gggtctcgcc    105660
     gggccgttgc ccggacaagt aggcgatgac gacgaagcag gctgtcgcca ggtgacgcgc    105720
     caggatcgga gcctgcaggt aggggatcga ccgactccgc cacggacgac cgtcgagcac    105780
     agcggtgatg ggcgcgaaca ggtaggtgtc gtcatcgatg ggcatctggc cgcgttcagc    105840
     gaagagtgag gtgatcgact tgtgggcaac cgggatgcct gcctgcgcgc tcagaaagta    105900
     ggtgttcacc agcagccggc cgtccgcggt gcgtcggccc gggagagcca gaccgcgtct    105960
     gcggtactcg tccagatgcg cggccaggag ttgtctcgcc tcgccggggc gccgccgatg    106020
     actgtagatc tcgtccttgg ggacccgggt ccgtcgggcg cggtaggccg cccccgacag    106080
     ttcgaggtac tcggtgaacg ccgcgatgat gtcatcggcg aagacctcga tgaacctcag    106140
     cgaccacgcc agcagggcgg tcatggtgtc ggggtgcacg cgtaatgtgc ggttctccgc    106200
     gagttctcgt gactggccga gaacgtcgcg gatacggtcg ccgttccacg gcgggccttg    106260
     gggtagccga tcggctgggc agagtcggtc ccgtaccgac cacgcccgca cgaccgctgc    106320
     gagtaggtcc tcacgctggc tgtgagatat ttccgcggcg cggacatcta tggcgtaggt    106380
     gtccaggtcg gcggcagtga catcggcgaa gcgggtgatg gcgcgtgcgt gcagccattg    106440
     ggtgaagctg cgcaggaatc gcgagacggc cgacacgctg gacaccgaca gccgggcagt    106500
     ggtgaaccgg tagttcacgg gctggtcggg ctcggcgttg agcagcagcc acacgatctg    106560
     tttgaccggt agccggaact cgtcgggcac ctgggcgaag tcgacggcca gcgccgaact    106620
     gtggtgttgc aggagcccgg gactcagatt ccatcggtcc tgaccgaacc gggacaaggc    106680
     atgctggtcg gtgccgggac gcagcgatcg gttgagcagt accacggtgt cggggctggg    106740
     tagatcatcg ccggtcggag tgagtgcggt ggtcactgta agtccagtcc gtgggtgaga    106800
     aatcggtcga ccagcagccg atcgaaacgg gaggcgttcg cgcgggcgtc ggcgaccgcc    106860
     gtcgtggtgt gttgctcgag aaggtcgagc agcctggtcg cggggtcggc gaagcgctca    106920
     gcccatgtca gcggcgtcat cccgggccta cgcgcgagca gtgcgtcgtg gacgaggacc    106980
     tgcaccggta ggtgcgccgg tgtcgctcgc gcgcacggac acgataggca cagcagaaac    107040
     gaagcctgac acggctttcc gggcggcgag tgcgggctgt tgagattgtc ggtgcacccg    107100
     gccaccacgg tgtcgagcct gccgtcgacc agttcggtca acgtctgcgc tgagactccg    107160
     aacctggcgg cgacaccagc ggggtcggtg cgtgcctgcg cgatgtcttc ggaggacagc    107220
     acggggattg tggcggcggt gcgggccttg gcgacctgtt cactcaacac gtcggcgacg    107280
     acctgttgat actcggcgag attgccgcga ttgcgcgcca aatactcgtt caccagcgtg    107340
     atctcggtgt gcgcgaccgg acgctgatac cgctcaagga acgtcaggcg cagtcgccga    107400
     gaccgcactc gcaacacagc cggtgcgctg gtgtcgggat cggcgatgtc ggtgggcagt    107460
     ttcgcgtcct cgccccagaa cagcaggatc gatttcggga cctgtacccg gaacccggcg    107520
     atgtcgcgtc ccttgccgtt gcccttgtgg gtgaaggcga cgaagaggcc gtcgctgccg    107580
     gtcttggctc tgacgcggtg ccccaattcg agcagcagtg tgtagagccc gaacggtgta    107640
     gtgaggtcat cgcgtccggc aggccgggca ccgtccggtg tgaggtcctg caacggcacg    107700
     gtcatggccg cgcggcgggt tccccggcgt ggcttgagcc agtcgaccag gatcgtcggc    107760
     gcagcaccgg tgtcggcgtc ggtccggtgg tggtggacgg tggcagcgcg gatagtgccg    107820
     aggttgtggc cggtcaagcc gatcatcagc gccacggcgg caccgatttc cagataggtc    107880
     ggatacaggt gcgccaacac ggtcgagctg ccgccatggc gactgacgac ggcggcctga    107940
     tgcgctttac cggccgcagg ttgtactgct ccggcgcgcg gcacatcacc ctcgcggtcg    108000
     acgtagtcca acagccaccc caattcccac cgctgtgcgt cggtcacctg gtcgacccgg    108060
     tcggcacgcc aatgctccag caggcggttc gcggcgcgga ttcgcctcgc cgcggcgcgt    108120
     agctgggagc gagcgtgagc gaggatgcga ttgaattccg cttcggtgta gcttgtttcg    108180
     cgttcatcgt tcttggcgac ccgggcggtg gacagacggg cggcgaactc ggcgggaaca    108240
     tcgggagcga accgaagaac cgaacgtaga gtggccagat cccggtgcaa cgtggttccg    108300
     acgcctccgg acaggatgta gccatccaaa tgtacagccc gcagcccgtt gggcgacagt    108360
     ggcggattgt cgagaccggc gagatagcga gcgaaccgta gaaacgtcga cacgatgtcg    108420
     gaagccgatg tcgctgttcg acgcgggccg gacggtcggg tcgcccccgc agccgcggtg    108480
     gcgaaccagt tgcgcagttc gcgtggcact ggcaggcaca tgaagtccag gtcgacatgg    108540
     tcgccgccgt tctcggggaa gaaacgcact cggcactcgt tgtggccgag gaacaatcgc    108600
     tgcggtgtcc ggtacccgag ggcaggctgg acggcggccc gaccgcggct cacgcgccga    108660
     ctcccgcggg ccgagtgatg acctgagggt ggcgggagaa catctccgcc atcagtgcag    108720
     acatccccgc accgtgggca tgctcgataa gcagtgacac atccaagtcg cggaacggct    108780
     ccaaatacac atccatcgtg acggcgatgt ccgcatgacc tagcagggtc ttcaccaggt    108840
     accaggtgtc gccgaactgc gcacggaagt cccgcagctc ctcgctgctc aagtgggcga    108900
     atcgctgttc gtagatcagc cttcccaccg agaaccagcg cagcgcaaac gaatgccgca    108960
     gcatatgcgc ggtcgccgac accgacccca gcccggcgcg tgcgagccgt tcgttggcct    109020
     gggtgaacgt gtgctcccac ccagccgcca gacgtggtag cccggtttcg ttgagccaca    109080
     acgaaaccgg ctccaagccc gtcctggtct gccggaaaat ccgtgcccgc gttctggcgt    109140
     tgagcgtgtc cagcgcgacg tccgacacgg cgccgtcgcc cgcgcggagc cggacgcggc    109200
     ggccgcagtc ctggcccacc agcagcaacg ggtcactgac ctggtcgtag aggcccttcg    109260
     ccctggcacg gccaaccgca gcggcgcggc cggactccac gtaggacagc acatccacca    109320
     gcaccgagcg aggcatccaa tacctgcggc cccggccacc cttgccgcac gaggacgcga    109380
     gccgacaggt gtaatagcca cgcgactcgt cgtccgcggg aagctcgacc gtcagcagcg    109440
     ttgcccactc cgacagacgc aggccagtgc catacaggcc atcggtgaac gcgcagtcgc    109500
     gctgagagtt tcgaccgcgc caaccacgca gctcgcggcc actgcggtcc aaaccccgca    109560
     agccgagatc acgccagcac gcatagccgc cctgatccag ccacttcaca tcccgatccc    109620
     gcaccacatg cggcgtcgcc acgaacggct cggcccgccc cagaggacct tgccgaggcc    109680
     acgaggccag ccgacgatca accggattgc gtacgtccaa ccgttcctgc gcccactcat    109740
     agaaggcgtt gatcgcctga atgttgtcgc tcaccgacga accagcgacc cgcaacggat    109800
     tggcctcatc agtcatgcgc cagaacttga acgcatccac gtcctccggc ccgacaccgc    109860
     gccaacatcc acccacggca tcgaggtagc ccagccacac gcacagacca cgcgcgtact    109920
     tctctcgcgt gctggccgag cggttacgca tacgccgcga cgcgaagaac gcgttgacct    109980
     cgacgaccac ccgaccgtcg ctattgatca gaaactcctg cccctccacc gtggcgttgc    110040
     gcgcacacag ggcggcgacg tccagccctt cgggcagagc gagcccaccc acaatggcgg    110100
     accggccgat gtaatagctg caccgttgca gccgccaaac acccggcacc gtcgcggaat    110160
     agtcgtcaga tcgcacgagg cgtaactctg gcacggcgac taccaccgac acaggcactc    110220
     cccgatcatc ggcccagcaa caactggaaa ccggctaaag acccatgcca taggacagca    110280
     cgactcgggg cgcaggttcg tgcgcggcga gctgcttccg cagtgccgcg gacacggcgg    110340
     gcccggtcac cggttcgccc gatcgcggac gcgcagtgcc accccgcccg agcccggcgg    110400
     gcaggtgcag cccgccatgt gcagctcgtc ggtgatgcgc cgccaggtgc ggtagtgccg    110460
     gagtccgctc tcgacggcca ccgcaccggc aaggaacatc aggctcgaga tgatcgcggg    110520
     gaactccgac gtcaccgcgc cgagggcgta catcgagccc ccggccagcc agccgctggc    110580
     cacaacggcg tgtgcctggg cgagccaact ctggtcgtgc tgttcgtcgt gacgtcggtc    110640
     gtgctgaaag ctgttcacgg gaaaactcct cggagtgcgc gagtggggtg tgtggtgggc    110700
     gggtgagcgc gccgtgtccg gctcggcgtc ggcgccgccc gtgacgagag agcgcgtgcg    110760
     gaagtcggcc gtgaatcggt cggtgagccg cgccagcaga gcgagcagtt ggtcgcgggg    110820
     aacgtcgacc gactggaagg acccgccgaa gcgcaccgcg tcggcgtccg gggcgatggt    110880
     gagtcgttcc cggccgtcgc cgaggtcggt gacctcgagc cggtctccgt cggcgtcttc    110940
     gaagacggtg tgtggcatga cgcggatgct gtcaggcagg cccgccgggc ggacgccgtg    111000
     gcgcagcagg gcgacggtct cgagcgtcag cgcgctcgcg gtgcgcagcc ggagttcgag    111060
     ctcgtcgcgg aacggggtgt ccagcaccga gaaccacgcc cccgcgtccc ggtctttgcg    111120
     cgacatcacg cccgcccctc gtcggtcagc gaggcccacc agccttcgac gaggccgtgt    111180
     gctgtccagt ccgcgagctg ggcatgcgcg caatcgcgat gtgcgaccac cgccgcggcg    111240
     cgctcgaccg ggtagcagtg cgaatgcgtc gagcagccct gagtccaacc gggtacgtcc    111300
     tcgacgagag cgtcgaattt ggtggagggc attgccctgc tcccttcggg ggatatgcga    111360
     gtggggagcg gcgggcggaa gtgtccggtt tccgccccgt cgcttcgggt gacggaaagg    111420
     gtcagaaggg ggcttcgtcg tcgccccacg gggcgctcgg gtcaccgcgc ccgtcggcgg    111480
     gctcggcgtc cccgccgtcg gggttccagt cgtcggggac gccgacggcc cacaccacgg    111540
     ccttggtgat gtggtcccag gtgacgttgg cgagggcctg gacgttttcc aacgagctct    111600
     cgtcctcgac gcggacgccc gccgggatgc gccacaggtc gccccggaag tcccaagccg    111660
     agccggaatg ctgggtcgca gcgctgactt cctcggccgc ccaggcgcgg gcgtcggcct    111720
     cggtgacgaa ttccctctcg tcgaggaagc gccgctcgga cgcgggagga acgtcggaga    111780
     agacgacgta gaagcgatcg tggtccgcga caaccgctgc cagaggactc atgggaatgc    111840
     cctttcgtag ggtgcgagtg ggatcgaaga aggcggggtg tccggtcccg cttccttcta    111900
     tgtcatatat tacccggtat atccgaaagg tcacgcactt tccgatgggc gagttggatt    111960
     ggttcccgcc cgatcggtct cgggcgggaa gtcagtcggt gctgtagggg tcccggtgct    112020
     gggccggggc gcattgccga cggcgcagca cggcgagccg tcgcgtgtcc tgcgatcgga    112080
     cggggctcga tgggcgcgcc gccgggcatc cctccggttc gccgagcggt gcggtggcag    112140
     acagaaccgc gagggccgcc tcccagcgat cggcccggtc cgccgcccgc agctgcaccg    112200
     ccagaacggt caggctcgcc gcgccgacac cgacggcgac cacggcgagc ggcgcggaca    112260
     acggcatggt cgccaccgcc cacaggaacg acagcgccgc gaggcagccg tgcgccgccg    112320
     acagcgtggt cgcgccgggt cgctcgccgg tggcggggaa ccgtcgcgcg tctcggcggt    112380
     aggagagcgc gagcgcggcg aacacgacac ccggcccgcc gaggagcagg gccgggacgg    112440
     cgtacgaggc ggacacagcc gtcagctccg cacccgtgcg gcggctggcg cgcccgcgtc    112500
     ggcggcagcg acccggaccg gatcggctgc ggcggacggg ccgccggaac cggcgggggc    112560
     cggatcgggt tgcgtgacgg cggctgccgg agtgaccggc gtgcccgggg aggccgactc    112620
     aggttcggag ttctccgccg gcggcggagt cagcggcgct tcggccgcag cggtcgacgc    112680
     acgtgagggg cgcggccgag gcttggcctt cgcccgcttc gccacagcgc ggatagcgtc    112740
     ggtgggcttg agtccgatcc gttccagcgc ggccgcctcg gctccggcat tggtggccgc    112800
     ctcgtaggca gccaccacgg catcctcggc agcttcctca tcggcgatca accgcgctgt    112860
     ctcggcccgg cgcgtctcgg acgcctgctg ccattccccg accttcaccg cgagttcgcc    112920
     gatgcgcgtc tccatatcgt cgtcgatgac cgcccgccgg tacgcggaca gagcatcggt    112980
     cgccatcttc ttcgccatgg gaaacctctc gtcgctcagc gctcactaat ggagcgatcg    113040
     aatctagtgt atctaatgta tctacagaac ggaggtggtc aaccatgcga acgggagtcg    113100
     ggggcgtgcg cgcctcgccc gacgggtgtc ccgttcgttc agtctgcgca ccggggcggg    113160
     ctgggaccgg gcgcccgcag cctcgatcca gcccccatgt tcgcggcacc ggcctcgtcg    113220
     cgtaccgcgc ccgcccagcg aacgaaagcg tttcccacgt ggactcaccg tgagccgcag    113280
     cgtggctgac cagccttttc agttagacaa ccgtcttgtt cgctgccgtc cggcattact    113340
     cgaatgtcgg tgtcgtgcag cgcagcagtc gtttctacct atccgtgcac gtcgtggtga    113400
     cgaatgaagt tctgtcactg tggtcggcgg gatcgctgcc ctggtgaggg aatttcatcc    113460
     acgatgaaca tcgaggggtt gggttggcac tggcggtagt gcggtcgctg cgcgagacgc    113520
     gcagtttggt gaccgacgag gagctggccg attttgagct ggatgtgctg tcggagttcg    113580
     tgctcgcgcg ggcctcatcc ggcgttggag acagcacgat ccggggcgac accacgcatc    113640
     tcgggcaggt tcggcagtgg ttcggccggc cgttgtggga gatggaaccg caggacgcgg    113700
     atcggtactt cggcacggtg ctgcgccggg tgtcgtcgtc gaccagggcg gcccgagccc    113760
     ggaccgtggt gtcctatttc gagttcctcg agatccggta caaggtcgtg ttgcacgaga    113820
     tgaccggccg tgtggtcgag tgcccgatcg acgaggtgaa ccggccccga atgtcggtgg    113880
     acacgatggt gcggatccca ccgaccgagg ccgagctgga gcagctgttc acggggtggc    113940
     gcgaggatct ggtgacctgc cgcaagttcg cgccgagcgc ccgcaactac atggtcgccc    114000
     gtctggcggc cgatgtcggg ttgcgggtca acgaggcgtg catgctcgac ctcgacgaca    114060
     ttcgatggga gctgggcagg ttcggcaagc tcaacgtccg ccacggcaag ggcgcgttcc    114120
     gcagtggacc acggcaacgg ctcgtcccgc tgatcaacgg ggcggacacc gcgctgacct    114180
     ggttcgtcga ggacgtgtgg gcccagttcg acgctgacga gaccttgccg cgcgcaccgt    114240
     tgttcccgtc cgagcgccgc cgggcgggca gctcgggcac ccgggttacc cgggacgtga    114300
     ttcgtcgcgc tctgggtggt gcggttgatc gccacctgcc gacctggtcc gggcggctca    114360
     ccccgcacgt gttgcgccac tactgcgcca gccagctcta ccggaccggt gtcgacatcc    114420
     tcgcgatcca ggaattgctc gggcattcgt ggatcaccac gacgatgcgc tatgtccacc    114480
     cctacggaac ccgggtcgag gacgccgtca cggccgggca caaacgcgcc gccgcacgct    114540
     gggaaggact gatccgatga agtggaacct gcgcctggtc gccgcgaacc gcggcatctg    114600
     gaagtccagc gaactgcgcc ggatgctcgc cgcgcgtggc ctcgagatca gcaccggcaa    114660
     gatgtcggga atgtggtcga gcacgccggc ggtgctgcga ccggaggaac tcgacgtgct    114720
     ctgcgcggtg ctcaactgtg ggatagccga actcatcacc gccgaaccgg acaccgtcgc    114780
     ggcgccgact gatgccgggg agcatgtccg ggcggtcgga gatcagggcc cggagtcggt    114840
     ccggcggatc gttccgaagc ccaggacggg ccggtccctc ccgccccgat gaccgccacc    114900
     agttgccggg aatgcggcgg tcggatcgag gcgagtacgt gtccacgtgg cggccgccct    114960
     cgccaatact gcctgacctg ccgaccgtca aagacggcag aacgacgagc cgaaggcgcg    115020
     aaagactacc gagacggttc gtgtgttggg tgcggcacgc agctcgaacg cgccgcccgc    115080
     acgatcggac gcccccggat ctactgcgac gcatgccgcg gccgccgggc ccgcacccca    115140
     tcccggtccc gccgacgcaa cgacgccggg cctgcccagg acaaccgttc ggaggcatat    115200
     cgggatcgtc gatgcactcg ctgcgacgcc ccgatcgagg tcgacggtca acgaaagggc    115260
     cgtccccgga tctactgcga cggttgtttc ggccgccggg tccacgaaca gcgccgccac    115320
     cgaacgaggc cgcgctcgct cgatggtctt cggttcgccg aggtcttcgg cacaatcact    115380
     ggccgcgtcg agcacgaagt tctggagcga ctgttcgaca cagcccgggt cggccgctgg    115440
     agcgtcgcaa cggtgcagcg caggagcgag gagttgcgcc gcgtcttggc caccgccggg    115500
     gacgaaccga tctccctcag ccaggtccgc gccgaactcg gcaacgtctg gcagtcccgg    115560
     atcgcggctc gggtgctcga ccagtgcggt ctgcttatcg acgacaccga gtcaccgaca    115620
     cggcagtgga tcgaccgccg caccgccgag ctcccgccgg gattccgtga cgatgtccga    115680
     gcctggctgg tggtgctgca cgagggcgga cagcgagccc ggccacgggc ggaggcgacg    115740
     ttgcacgcct actacagtcg cgtacttccg ccgctgaccg aatgggggag cacccgatcg    115800
     cacctgcgtg aggtcaccca ggccgacgtg tccgtagcgc tgaaccggct gaacgggcac    115860
     aagcgggtcg ggacgttcgt cgcgttgcgt tcactgttcc ggttcgccaa acgacaccgg    115920
     ctgatcttcc tcgacccgac ccgtcgcctc cgtgctggcg ccgcaccgtc gcgggtgctg    115980
     ctgccgatga ccaccggcca ggtcgacgcg gtcaccgcaa cagccgtgac acccctccag    116040
     cgcgtcgtcg tcgctctggt cgcggtctat gccgttcgcg cgcacgcgtt gcgacagctc    116100
     gtgctcgacg atctcgacct agcgcgtcgg cggatccgga tcggcggctc tgttcaccag    116160
     ctcaccgagt tcacccacga cgttctcacg gactggctga cctaccggca acagcgatgg    116220
     ccgggcaccc cgaacccgca cgtgctggtc tcctccgatt cggttctcgg caattctccg    116280
     gtcgaggact actacctgac ctggcatctg agcctgctcg gcatccagct tgaacacatc    116340
     cgcggtgacc ggatcctcga agaagcgctc tcgacggaca ccgacccgct gcacctgacg    116400
     atcatgttcg ggctctccga gaagtccgcg gccgactacg ccaggcttgc ccgcggcatc    116460
     acggagcggc ccatcgaggc cgtcagtcac taccccgccg actgggactg atggaggcgg    116520
     cccgctgccg cggccgcctc cctgccatcg tctcgatgcc ggttctgccg aaaccggacg    116580
     ccttctcgca cgccggatcg cgaaacacgt tgggttcccg ctgaaacacc ttcactctcc    116640
     gtgaacccac tgctttccgg tgagcaagat atcccaaaac cccggggttt tgggttgcgc    116700
     ccggggacgg gcgcgggaca cactcgaagt gattcgagtg tgtctaaagc ctccagagga    116760
     tctggaggcg ccgatgtacc cagacctgcg gtccggccac atcggctggc ccggcaggcg    116820
     actgccggcc ctgcgagcgc accagtgcgc ccggtaggcg aaaggacgtg aagtgccccc    116880
     gaagagcaga cagggccatc ggcctcactc cgttgagaag cggacgcgcc gccatgaggc    116940
     gctgttcgca cccgcggagt gggcactagt ggccgccgcg gcggccactg tcgggctgaa    117000
     gcctggcgcc ttcatcgcca aggcagccgt tggtgccgcg cgtgcgttcg ccgcacagcg    117060
     caacggctca gccgtccgca ccagcggcca ggtggagatc ctcatcgccg aggttcggga    117120
     gttgcgccga ctgctgggca acgtggccgg gaatgtgaac gacgtcgcca agcacgcgaa    117180
     ctccaccggc gaactcggcc agaacgcaga cgcggtcctg gcctataccc gcaagatcaa    117240
     cagccgcatc gacacatggc tggtcgaaca gcttcggcac ggtgcgctgt gatcggcaag    117300
     gcgatcaggg gatgggacgg gcagcggctc gtgcggtatc tgttctcgaa gggcaagtac    117360
     aacgagcaca ccaaccccac cgtgatcgca gcgtggcaat ccgaccccga cgcccttcaa    117420
     ccggtatggg tcggccccga cgactgcgac ttcgcgcccg gtgagatcgg caaactcgcc    117480
     aaccaggtaa ccgccctgtc ggacgcgatc gggctgccca ccgaacagcc cgagcccggc    117540
     cagccgggct acaccaagca cggttacatc tggcacctgc cggtggccat cggcgccgaa    117600
     gacggggaac tcggccacga cacctggcgg cgcatcgccg aggacatgct gcacgagacc    117660
     gggatcgcga aagcgggcga cgccggcgcg tgccggtgga tcgcggtgca ccacggcaag    117720
     tccgtcgacg gcaacgacca cattcacatc gccgcggtcc tcgtgcgcgc cgacaccggc    117780
     aaacgcttct acccggacaa cgattggaaa gccgtacgcc gcgtcgcccg gcgctgggaa    117840
     caagctctcg gtctgcgaat gaccgccatc aacgatccgt cggccgtgcc caccccgacg    117900
     cgcggggaac aggaaaaggc gaagcgccgc cacgccgccg gcgacgacgg catgctgcga    117960
     gcgacaccag gtgccgcggc acgggtacag ctgcggcaga tgatcaccga gaccgccgcc    118020
     atcgcgacca gcgccgacga attcgttgcc cggctccgcg acgcgggcat gctcatcgac    118080
     ttcaagtacg acgccatcgg gcagatcaag ggatgggcgg tcgcggctcc cggagatgtg    118140
     tcggcgagaa ccggcgagcc catctacttc gcgcccagtc ggcacttggg cgcagatatg    118200
     tcttggccgc ggatcaccgc ccgctggtcg gcctccgtgc ctagccgccc cggcgccgcg    118260
     cgggaagcgg ccgccaccga gacagcacgc gagccgcatg cagtgctggc cgacagcgct    118320
     gagcgggtcc ggtcggtcac caccgccgtg cgcggtggcc gcgccgacgt ggcgaccttg    118380
     gcccgcgagt tgcaggacgt cataagcagc tgggcatcca tcgccgacgg tgcggcgcgc    118440
     cagggcccgc tctcccgggc cgcctgggtc tacgaccgcg cggcccgcac ccggcgcggt    118500
     ctggccgccg ttcccgccgg gcaactcgcc gccgaactgc gtgaggtctc gcgcggactc    118560
     gctgcggttc gaatgctgtc cggtcgcggc ctgcaacgag atccgagcct gcaactcggg    118620
     ctcgctatcg ccgaactgtt gctggagatc gccgcatggc accagcagaa ccagcgcatc    118680
     gctgccgccc gcagtgcccg cgaagccgtc ggcctggtgc gcgcgcacgg ggaggccacc    118740
     ggtgccgtcc cgggccagct cccgccgcgg cgcgccccgg cgggcaccgg gcacacgccc    118800
     accgtcacag cacaccccgg tccggccgcg cggccgggcg aaggccgccg cgaactgcct    118860
     gcggtgcgcg gcgtccgtga actgccgtcc ggcccaacaa ggaaggaaca ccgacgatga    118920
     accagccggt cattgaaacg cccgtgatgg gcatccctcg cgaggacacc atgcgcatgg    118980
     cactggcagc acgcacgctg tcgggagtgc tgaggcagct acgggaacgg cggggccgct    119040
     ccgcctggga cgacgccgag aacgccgccc gcaagaacgc ggtcatcgac cgccacacgg    119100
     tcaaccgatt cagccgggcc gacgccgagg aatggaacac cgcggaaagg gaaggccgca    119160
     tccgagccga acggcacccg gataccggca tgacaattcg tgtggcccca ctctcgcgcg    119220
     gccgattcgg ggtgcaagct ggatgggagg acaaccacgc cgaggccgtg gtcggctccg    119280
     aagatctcgc cgcccgggtg gccgactggc tgcgagccga cggctcagcc gatgctgtcg    119340
     acgatctacg ccgcaacgtc gaggacatgc acgccacgtc ccggccacgg cggcaacgca    119400
     ctctccgaga catcgagctc gccgaggccc gcgaatgggc gaaagagaac gatgccgact    119460
     ggtaccgctg gtgggagctg agctacacca acgccgacac catcgatgga cgccgcctcg    119520
     acgaggccga gatcatcaac aagtgggtcg acgccaccgg tggcgtcacc cgcagcgccg    119580
     tcggcgtggc tcggcgctgg ctggccgaac acgatccaga gtggaccaag aactgggtag    119640
     ccgaatacga caactgcgac acacgcgacg gacgccgcag cctcgaagct gagatcgttc    119700
     gccgatggcg cgcccagtcc cgcgctgggc gtggacgtgg cggagccggc caggagtggg    119760
     gggccgacac cggtgccgcg gaacagggcg gtgattcaca ggaccggagc actccgaccc    119820
     cactcgcgga ccggctgagg gggcgagtgc ccgatcgtgt tcttgacgat ccgcgttggc    119880
     atgtcgccga ggaccagttc gcggtgctca cctcgcaggg cgctgacccg gacaccctga    119940
     tcgaatccgt tgccgcgatc gacttcaaca acggcaagat tcgcgccccc agcgggttcg    120000
     cggcatgggc aatgcgcgaa gccgcgaaga aggggaaagc agccaacgcg cacacccgca    120060
     gcgaggaaga tgctcgccgc tcggtggcag aggaatggct catgagtgcg gacccggact    120120
     caccgttcga ccgagcccgc gcggcgcagt tggtcggcga gatcgacgat gacttcgacg    120180
     ccctgctcgc ccgcaagtac ccgggcatcc tcgatggcga tgccgagcag gcacgagcca    120240
     aggccgcaca gcacgagagc aacgccgata ccgctgacga ccaggctcgc aaggacaaca    120300
     ccgcggccca gcagacggac gaggccgagg ctgaggacac ggtattcgtg gtcgacagcg    120360
     acggcaccgt catcaccgtg ccgttcgttc cagcaccgga acccccgccc gaagccgaag    120420
     ccgaagcggc cagccacgcc gccgacgccg accgcgagca cgaggccgcc gactcccaac    120480
     accgcgccgc ccgcaccgcc gaagccgcag cgcaggctcc gctcacccca cccaaacaag    120540
     ccaaatccaa cgccaagacc cgtcggcgaa ccccaccgcc ggccacaccc gcggcgaccc    120600
     acacccggaa ccggggccgc gcgcactgag gccgccacct catcgtcggg tggcccgcgc    120660
     gggcgagatc ctgccgcggg tcacccggga tcagcgtcgc cagacagaaa cgcccgcccc    120720
     tcatctgtgg tgcttatgct gggcactgag cagtggaacg cgaatcactg gctgctctgg    120780
     gacatggccc tcccctccgg ccatgtacac gaagatgccc atcggttgaa tccgatgggc    120840
     atcttctttc ctcgtccagt cccagcgagc cggggtcagc cgccggggcg gctgcggtca    120900
     caggatcgcg cggaactcga tggtcaccac cacgctgacc agatactcga tcggtgcggc    120960
     gagcagcggc acgatcgtgt ggtcgatgcc gacgacggtc ggcgcgtagg tctcaccggt    121020
     cagggtggtc tcttcggccg ccgccgtgcg agcacgctcc tgacactgtt cgacaagagc    121080
     ctcgacgcta tcgggaatct cggcggatga ggagacggtc cgggtggccg cgtacgcgac    121140
     cacatcgtcg tgcagggaag tcgggctgct catgatctcg tgtccttaca tcgaagggat    121200
     tgggtcctcg gcccacgccc ctcatagcgg gcatgcgccg gagtcgggga gggttcagcg    121260
     gtcagcgctg gtgacagtgt cgatgaacgt gcgcccgtcg cggtggacgg tggtcacgtt    121320
     ctggcggtag gtcttggtct cgccggatgg cctgcgctcg aacacctcga cgaggtaccg    121380
     cgcaggttcc agttcggtga tcgtcaggca gtagttcgtc ttgtcgggga tggtgttgat    121440
     gcccttctgg atcgtgtccg cagaggagac gggggcctcc ggcagtacca gggcacgcac    121500
     ttgctcccct gaccgagcga cgtagtaggc gtgctggaac gcgaagatga cgggcacgct    121560
     cccgaccagc ccgccctggt tgtcgccgcg atgcaccctg ccctccgcgg tgttcgggca    121620
     cttcccgcca gcgagaaagc ccaccgttgt ggtcaccgct ggcggtggtg gggctacaga    121680
     cagagcgggt tgcggcggcg gggtgggctc caagctgttg agccccacag cgagcgcgcc    121740
     cagtccaagc gcactcacgg cggccgcaat gccgagcgcc ttgtaccgag gtcggcgact    121800
     gggcgcgggc gccggctcgg gggctttctc aacggcgtcc gccggttgga actcgtgctc    121860
     ctgttcgtcg ggctccggca ggacctctgg aatcttcagg ggcgagagaa ctggagtcca    121920
     ccggccagaa gccgggacag gtcgatcggt gttggcgttc atcctcgttc ccctttcaac    121980
     gtccgcgtcc gggagtccgc tgcggggcgg cgctggtatt tgctctactg gccggggtca    122040
     tcgacgcgcc ggcggccgcg gccgctccgg cggacggggt cagcggtccg ttcgccgccc    122100
     gcagcgcctg ctccccgcgc cgggcctctt gcaactgggc gaaggtcggg cgcccgctgc    122160
     tattgcgggc ggtagccgtc accgtcgagg tctggctgcg cgctacgggg gcggtagctt    122220
     cggcggcggt ggcctgctgc acgtagcgca gggcggcctc caccaccgcg ccagtcttgc    122280
     gggggtcacc gttgggaagt gcggcccatt gcggcgagcc cacctcgggg atctctcccc    122340
     gccgcattgc ggcgcgcaga tacgggcctg cccacgcctg taccgcatct acgctcaggc    122400
     gatccgccgt ggacggaaac cccggctgcg cagcagccgc ctcctgttct gccagcacat    122460
     cagcgcgcat aacaccgggc agggttttga gcttgtcggg acggaatccg gagaatcgaa    122520
     cgtctcccgc ctccaccacg ggcgcgccct ggaaccccat gtccagcaat cgctggcgtg    122580
     cggccgagtc ctgggtgaca tcgacgatcc gatagtcgaa cccgagattg tcgagggtgc    122640
     gcttggtggc atcgcactgc gggcactgcg gtttggtgta gacggtgatc tggacgcctt    122700
     cgcccggcgc gattgcagtc tgtgccatgg tcgtctccgg attctgttgg ttctgcactg    122760
     atttcgcggg cgctctctcg atcccgagtt cggtctctgc ttccggggcc cactgccacc    122820
     gccagcctgt ctcggggtcg aacgaccgcc ggaacacacc ctccatggcc ttctcggccg    122880
     ccgcgatggc ctcgtcggca ccggggaatc cgcgctcgag ttgctcatcg gtgacgggca    122940
     cgaactcgtc gaagtcgtgc ccgagatcga agtggttgct ggcgtccttg ccggtcgccg    123000
     cttccacgac gagcacttcc cctacacgac cgaccagcat ccgcttgacc tggagggcgt    123060
     gctggtagcc cgctgaatcg cgatcagcga tgatgattac tcgccgggcg ccggtgagct    123120
     ggcgggcgtg ctctagccga aacgaaccgg cacccattgc attgcaggtg gcgaaccgcc    123180
     cggcagcccg aattcggtcg acgtccttct ctccttcggg gaggtggatg tcttcgccgt    123240
     cagcgattgc ctgtaccacc tcgggaaggt gatacagcac cggttcgaac ccgcctttgc    123300
     tccaccgccc gccggcatcc atcttgcgct ggaagaacat cttgtcggtg ccgcgctcgt    123360
     gcggaacgtg cattcgcacg acctcgccga gggggcgtcc acggtggtcg gtgtagtggt    123420
     agatcgccgc ctggtagcga ggaccaacca ccttgccgag gcgttccttc ttcgagggct    123480
     tcggcggaac cggggcgtca cctcgtgctt tcggaacttc cggtcgcggc gctcgcggcc    123540
     gcgccggcga gccgggcacg cggacccact gccggtccca gatcgctgat tcaggcaacc    123600
     cgatcgtggc cagcacctgg gtgtcggagc atccggtgaa gcatctgacc acggtcttgt    123660
     gcttgtccgc gttgtagatc aggcccaagc tcggatcatc gtcctgatgc gccgggcagt    123720
     ggtacatcgt ccactgcccg cgcctcgatg ctggtcctgc ggggcggctg ttttcgaatg    123780
     cccactcgtc gagtgcctgg gtgatccggg caaacgacgg aggtgagccg gtcttatcag    123840
     ttctcacggc gcaccacctc cacgggtgct tatgaatctg tgcttatgaa tctgatggag    123900
     ctaatgtatc taaaacggag cctgccacag ggctgcgagt ccgccgggac tgcttaccta    123960
     cgctttgcta ctccagccag accggccagc gtcatgccca cggccgcgcc gaggacacca    124020
     cccactgctc ccagagcttt ccgccccgtc cgcctacggc ctcgcgtgtg ggccgggttc    124080
     ggatgcgcca tgttcacggc gaccaccacg accacgatca gcacagcaac gaccgggtac    124140
     accagtagaa gcgacatttc tgatgacctc ctctttcgtc gtcgatggcc aacctgcacg    124200
     tggtgcgaat gtatctaaag cagtgtcgca gtttcgccag ccggccgcaa tcatgccgcc    124260
     gaccgctgct cggtagtggc tgcgacctcg gcccactctc ggcagtaatc cagggccgtg    124320
     cccggagaga atcccgggac ggtttcttcc cagctcagcg acggattcac ggttgcgctg    124380
     aggctggggc cacacacgta ccacgcccag cgattgcctt cgggcaggcg gtcgagggtg    124440
     cgcgggtcct gcggaccgat caggaaccag tgttcgccaa ctcgcacggt ggagacgtcg    124500
     taggtcgcca tcagcgtatg cagcacacgc cgccagtcgg caccatcggc cttgaccagc    124560
     agagccagtc gcaacgcgcg gcagtaccgc aggtcagcgc agagatttcg gacccggtag    124620
     cggacggcat agacgagatc cgcagcgatg gtcgtggccc gcgcgttcat cgcgctgccc    124680
     tcctcgccgc ggcggccacc ggtgcggcct gagctgccgg tgcggcgccg aaggtgaatt    124740
     tccgtccacc ggtggcagct gctgcgggtg gcgtcagcgg accgcgggcg gccgcctgga    124800
     ttttcgacca catcccctgc cgttgcggtt cggtctggct cgcttgatgc gcggcacgca    124860
     gttcctggtt gattcggtcg gaggttatgc cgagttgttg tgtgcgggta agggcttcgt    124920
     ggaactcggt cactaccgcc gccagatcgg tctcagcctc cttggcctcg cgtgcctgtg    124980
     tcgacgcctt gtcgaagcgc tgcgccgccg ccgtgagatc agccagggca gcggcttgtc    125040
     cgggcgtaag ccacgccgag gggccttccg gctgtcgcgc ctggttgtgc atcgcgtctg    125100
     cctgccactg cgccagccgg aagggagccg aacgcaactg ccgcgtcacg gtggtgatgc    125160
     cgagacggat cgcggagacc ttctccgcga cacgagcttt gagcgcttcc atggcactgt    125220
     tgacctccca cttcactcgc accgcggccc ccggcacagc gtgcgcctgc gccagcgcct    125280
     ccacggccct acctcggtct gtcgcgctca ggtggggtaa ttcgtgaatc cgtcgctcaa    125340
     gccgagtagc ggcgtcgctc aactccgctt gcttgcgggc ccacgcctca tgctgctcct    125400
     ccttctcggg cttgaatccc gccgcgacga ccgccttctg gtggtgcagg atgtccagtt    125460
     cgagctgcgt gcgcgtgatc gagacatcca gctggcggga gcgggtgtcg ttgcgtacgg    125520
     cgcgcgagat ttcccggcgc acttgccgcg ggaccgcctc ggcggtcggg ttctgcgccc    125580
     gccacgcggc gatcgtctcc gccaccgctg cggcgagggt gtcgaactcg ggcccagcct    125640
     tcgcgtcggc catcgtcgac tccttcctct cggggatcgg tcgctagcag tgggtgccgg    125700
     tcaagaaggg cacagcaccc agagccgcta gttatgttaa tggttcgagt gtatctaaaa    125760
     catggtcggt gtcatccctg ttgaccagat cgtgcattag cgggcgggcc gcaccaaccc    125820
     ggaagtgggc gagtacttca tcgggaatag gccagcaccg tgcgcgggtg cagcaactgc    125880
     ggatcgatca cgcctccctc gtcgaggtga cggtcatagg ggatctcgtg cacggcgtgg    125940
     accaagtggt tgaaccacct cgtcgccgcg ctcgcgtcga acattcgccg gccgggctgc    126000
     tgatgggaga tcacgacgac ggtccgggac agcaagcccc ggtacagcca acggcgctcg    126060
     ccccgttcgt ccagcagtgg gtccccggtc acggggtcct tcgcgaaggc ggtgtgcagg    126120
     tactcggccg ccgccaccgc ctcgtcggcg gagtccttct tggcgtcgag ggggatcacc    126180
     agcgcatcgg cctcgtcgag aacggcctgg gtcgctgggt gggtgatccc ggttccgcaa    126240
     tcggccagca tcagcgggaa gtagtcgctc gccaggtcga ccagctggcg gtagtcgtgg    126300
     gcggagaagc tgtcggccgt cgccggatcg gctgccgagg ccaagatgtc caggcccgcc    126360
     ggtgtcagtt gcgtgtgagt gcgcacgtcc tgcacccgcc gcggccgcgg tccggccagc    126420
     agggtcaacg ccgaggactc ggtacgtgcc gttgtccggc gtgccaggtt gcccctatcg    126480
     ggattgacgt cgaacgcgat tacgccatcg gtccggcagg ctgcgaaggc gttgccgatc    126540
     cccatggcgg tcgttgtctt ccctgatccg cccttgagct gtaccactcc gatgcagaaa    126600
     tcggactcga tcgcggtgcg gattcgccgg tcgagctccc tggcgcgcac ttcggcgggg    126660
     ctctctccga ggttcagcgt tttgcccgac atcagataga gcgcacgccg ccaacccgac    126720
     cccggggctg ggcgaaccgg gtctcggcgc cagtcccgcg actctggggt gaccgccgct    126780
     gaccgatcag acgacgtgtg ccgccactcg ccggcatgcg cccgctggag cgggctgacg    126840
     ccctgtgcgg gaacgccgtc tgtccatagc ccgctgtcgg cgcgccctcc gtaggccgcg    126900
     gtgtccgtac tccacggcgc caccacgggt gggggcgagt actgcttggc catcctctat    126960
     tcccttctgc tcatgaggtt ttcgatgaga tcttgtcctc ggtcgactcc gattgggtgc    127020
     tccgctcgtc gctctcggcc ttctcggcga cggcctcttc ggcccagtcc gaccacgccg    127080
     ggtaggactc cgcttcggcc caccatgcgt tgcgcgcgtc ctgccacacc tcgacagagc    127140
     agctgaacga gcgccgaggc cgggtgccgg cctgatccgg gggtgtgcgc cgaccgggcg    127200
     gcaatctgtc cggtgcaggc tcgaacgtgg agataccgag cttctggcgc gtgcgcgcgg    127260
     tcttctcggc gagcgccgcc tcgagccatc cggtccaggt cgggtactgg cggagttgct    127320
     gaccccactt cttcttggcg gcgccccaca cctcgtcact gcacgaaaag ttctctcggc    127380
     tccatcgacg tccccccgcc gcgtcggact gtgtgtcggc cacaggctct tccttcctct    127440
     cgacggcgtc gcgggctggg tcgccccgac cagccgcagg gttccactgt atctaaaggg    127500
     gcgtccacac ctaatagccc gagtaccccg cgccgacctt tcggatctat cgcgccatta    127560
     gatacattag agccataccg agtttacccg cggcaaccgt cgcaggtgaa accgcaaaac    127620
     ggatgtttta gatacatcag ctacaacgga accattgggg ctggtgacca tcgccgcccc    127680
     gccgccgaac aaggaggcga acatggcgcg gcgaacgcga agaatgcaga gcgaaggcca    127740
     gctcagcctg gaagctctat ggggtgaccc ggaccctacc ccctcgaccg tcgacaaccg    127800
     aaaggacaat gagcgcgatg atcatcgatc aggtcaggac gtactactcg acgtacctgc    127860
     cacagacgac cgcgtcactg gacgacccgg aagagttctt ccaggagctg agcgaccaga    127920
     tcagccagcg agtcgagcag atcacggcac agctcgagac gaacgcgatc gtgccggggc    127980
     aggactacct ggagcgagtg ggaacgctga acaccctgcg agcccaggcg ctggaatcgg    128040
     cgctggcgga gctgctgtac tcgacacccc cggaagtcga cgaggacccg gaacccagcc    128100
     agaccgaacg cgacctgctg gtgatgcagc aggaggagcg ggcggtggat cagcggctgg    128160
     agatggcccc cggcagcccg gaggcgatcg agtgggatcg ccggtatccg catctggtcg    128220
     aggaagtgac ctggatgctg accgatcacg gggagctgac ggtcgagcag aagcgcgagc    128280
     aactggcgca gatcatgcac cggcaggacg aagcgcgggc ccggctccgt ccgtagagcc    128340
     ccgcaccggc gaaggtgggg acgtccttgc cgccggggaa cggcattacc tgatcgacgg    128400
     gctagaggtc tgggaagcaa ccgccagcga ctcccaggag ggccgatggg aacgtgcccg    128460
     cagcatcggc acggccacca gcgctgagga agcaatccgc ttggcgcggg ccgacgcgat    128520
     gttcaccccg gtcgagctgg caacgctgcg ctgcaaggtc gaggacgagg cgtattccta    128580
     cggtgggtac aaccgcccac tggagatttt caaccccggc accgcccctc gctacttgac    128640
     cgaggggccg ctcaagtcgt tgtccgtcgg ggagcggttc ggcccgacct ggcttctggt    128700
     ggagtcctat ctgcgcgcgc acccggacct ctacgacgag acacccagtt cggtagaagc    128760
     ccgccaggcg caccgcagtg cggccgccaa atcgctgacc accgaggccg ccgagcactt    128820
     ccgggccggc cgactcgccc gcgcgcgaga actcgtcgat caggccgaac tcgccaaccc    128880
     ctacgagacc gggacatacg acggcatccg ctcccgcatc gaccggctcg caggcatcgt    128940
     cgacgaactc ggtctctcac gaccgcaaga gcggttcgac ggactgcccg ggggcaagca    129000
     ggcacaggtc agcgtcggcg accacagctt ctccctcgag ccccgtgggg gcggccgttg    129060
     ggtcgtctat ccgaaaaccg gcggcgccga agaccagtcc acgctggcgg aacccatgcc    129120
     gaccagcgag gtgatgccgc gcattcgggc ctacctggcc agtctcccag acccgcagaa    129180
     tcccacacca gcagctcacg ctcccagcgc tgcgacgact gccgcagccc agcgcgaccc    129240
     gggcaatccc acgacccccg gggatgcccc ggcggaaccg cttccgattg tcatcgagca    129300
     caccgcggag gacacgctcg tccgcaacac cgacaagaac aacctccaac tccggcaggc    129360
     cctgcacgat gccaagttca attggtcgcg ccctcaacgg ttctggtacc agcgaagggc    129420
     aacagatttc gcggtccgta cccgtcgggt cggctacctc cgggcctcgc tgacccgcct    129480
     cgggttgccc ttcacagaga cgaatccggc gcgcgaagag tccaccaccc tcacggcagc    129540
     aggcgtcgca gaggccgctg cccccgagag cgcgcacgag cagcaaacaa ccgctgaaac    129600
     ccaacatgat tcgacggcgg aatcggcggc cgcggccgag gtttcaccga cggcgtcggg    129660
     cacgcccacg ccacctttat cgtcgcccga tgtcaccggg aacaccacga cggcgactcc    129720
     tacctcccag accgaatcac ccgccgaccg gcccgccgga actgccgaag tccgggtgcc    129780
     cgaacgaccg acggctccgc aggtcgacgt gccacgatcg acccagcgcc gcatcgaggc    129840
     gaacctggca gcggccagga cccttcagct ggtggaggcc gagagccgtc cgccgaccgc    129900
     cgccgagcgg gaagtgctgg cgaaatggac ctcctggggt gctgctcccc agatcttcga    129960
     cgctgagcgc gaagagttcc gctcggacgc cgagtcgcta cgggcgctga tcggcgagga    130020
     aggctggaaa caagccaacc gcacagtcct caacgctcac tacaccgatc cgatgatcgt    130080
     tcgggcgatg tgggaccacc ttcgggcact cgggttcacc ggtggacagg tactcgagcc    130140
     aggctgcggg gcgggagcct ttatcgggca cgccccggag gcggcatcga tgaccggcat    130200
     cgagctggac tccaccacag cgcgcatcgc acaagtgctg tacccccacg ccagcatccg    130260
     cgtcgagtcc ttcgcggaca cccgtctccc cgaagggcac ttcgacgctg cgatcggaaa    130320
     cgtgccgttc tcctcggccc gcctccacga cccggtccac aacgccggcg agcacaccat    130380
     gcacaaccac ttcatcctca agtcgttggc gctgaccaag cccggcggcg tggtggcggt    130440
     ggtgaccagc tcgttcacga tggacaacaa gaaccccgcc gctcgccgcg aaatcgcggc    130500
     gcaagcggac ttcctgggtg cgatccggct gcccaacggc acgcaccgac gggtcgcagg    130560
     taccgacgta ctcaccgaca tcctgatcct gcgccgccgc gacggcgaag cccgccgact    130620
     cggcgggccc ttcgagctcg ccgtcaccgc cgaactcccg ctgacccggg gacaagggga    130680
     gacggaatct gtactggtca acgagtactt cctcaacaat cccgagatgg tgctcggcga    130740
     actgcgggcg ggcaccagcg tttacggcgg gctctcggtc gaggtgctcg accgcggcga    130800
     cctcgagcag cacctgcgcg ccgcgctggc tcgaatcgcc gaacgcgccc tgtccgaggg    130860
     catagctcat cagcccaggg aactggccag cggcgagcgc cgggcagccg cagccgctcc    130920
     cggcgatccg aacgagttcc ccggccatct gcgcaccacg gcgagcggat tcgaagtact    130980
     gcacaccgac ggcacctaca gcgagctgaa ggtgcccagc acccaagccg acgagctgcg    131040
     ggcactgctc gacctgagag atactgcggt tgccctcctg gaaaacgagg ccgcgagcgc    131100
     cgaggactcc gacgagatcg aggccctgcg cacgcgcctc aaccagcgct acgaccgcta    131160
     cgtcgagcgc tacggagcga tcaaccgatg ctcctggcat ccgaccggcc gtgtcgacga    131220
     cgccggggag ccggtgatgt ccgtacgccg gccgccggtg atgcgagtgt tccgcgacga    131280
     tccgcacgcg cccgtcgtgc tggccctcga ggactacgac gccaccaccg acagcgcggt    131340
     gaagatggcc atcatgcgtc agcgcgtcgt cgcgccgcgt agtccgcgcc tgggtgcaga    131400
     cactgccgag gacgcggtgg cgatctgcct ggacacacac ggcaagatcg atctgccggt    131460
     catcgcgggc ctgctcggcg tcgacgacga cgaagcccgc gtccaatgcc gtggtctcat    131520
     ctaccccgac cccgccgaca acggccggta cgttccagct gcggaatacc tctcggggaa    131580
     cgtgcgggtc aaactcgacc aggcccgcga ggcggccgcg gcgaacccgg agacctacag    131640
     cgacaacgtc accgcgctga ccgcagtcat cccgcccgac ctcggacccg ccgagatcga    131700
     cgcccgcctc ggcgcggtgt ggatcgaagc gcccgacgtg caggcgttcc tcaacgagat    131760
     cctcaacgac gacacgatca ccgtcgagca caccaaggcg ggggagtgga aggtcaccgg    131820
     cggccgccgc ggcatcctgt cgacccagga attcggcacc tcccgcgtac cggcgcccaa    131880
     gctcgcccag gccctgctgc gacaggcccc gatccgcgtc tacgacccgg acgagagcgg    131940
     tgaggcgcgc atccccaacc ccaccgaaac tgaagccgcc aacgagaagg ccgagcagct    132000
     caacgagcgg ttctccgaat gggtgtggga gaacccggtc cgcgccgccc ggctgagcga    132060
     ggaatacaac cggcgcttca acaacctggt gctgcgcaac tacgaggccg acggcaagat    132120
     gctcaccctg cccggcctgt ccaaggtcta caccccgcgc ccgcaccagc gcgccgcggt    132180
     ggctcgcatg atcgccgaac cgaacgtcgg cctgttccac gccgtcggcg caggcaagac    132240
     gttggaaatg gcaatgggcg ttatggagct caaacgcctt gggctggtga acaaaccggc    132300
     catcatggtg cccaattcca tgctcgacca gttcgcccgc gaattcctcc aggcataccc    132360
     gcaggcgcgc atcctcgccg ctggcaccga ggatctggcc ggggagaagc gacgacagtt    132420
     cgtcgcccgc gcggccactg gcgactggga cgcgatcatc ctgacacgcg ggtccttcca    132480
     gcgcctcgag gtctcccgtg agaccgcgca ctggtacttc gatcgtgaaa tcgagccccg    132540
     acgccagtac ctggcggaac tgatgtccgg cagcgcgaaa cgcagcgtcg tcaagcgcat    132600
     cgaagacgcg atcctcaagt ccgaggagaa gctgaagaag aagctcggcg gccccaccga    132660
     tccgggcatc accttcgagc agaccggcat cgactacatc gtggtcgacg agttgcacga    132720
     cttcaagaac ctggctaccg acacccagat cgagtccgcc gccattgcgg gcagccagcg    132780
     ggcacagaag ctgcacatgg tggtggagta cctgcgcgac aagcacaacg gtcgcgccat    132840
     caccggcgcc accgccaccc cgctggcgaa ctcgatcacc gaggcgtacg tcgtgcaacg    132900
     ctacctgcgc ccggacctgc tcgaaggggc cggaatccgc aacttcgacg agtgggcggc    132960
     caccttcggc aagaccaaga ccgagctgga gatgtcggtc gacggcaact cctggaacct    133020
     caagacccgg ctcgtgggct tccgcaatgt tcctgagctg caacgcatgt tccacgtcgc    133080
     cgccgacgtc aaactgcccg aggatctgaa cctcccggtg cccaagctcg ctcgccgcgc    133140
     cgacggacaa cgcgcaccgg aggtcatctc ggtgccagcc accgagaccc agctcgagta    133200
     cgtccgcgaa ctcggacatc gcgcccagat ggtgaagtcg cgggcggtcg acccgacccg    133260
     cgacaacatg ctcaaaattt cctccgacgg ccgcgccgca gcgctggatc tccggctcgt    133320
     caagtcactc ggcctcaccc ctggcaccgc agaagagcag gggagcccca cgctgaccac    133380
     cgcagaggga gccgccattg ccggatacct ccactcgaaa tctccgagcc cgtccacagc    133440
     gaggtatgtc gcactgttcg cgcagcgagg ccgccacgaa tcgcagcgcc aggaatcaca    133500
     ggagatcggc gaggaagagt tcggcctcaa gctcgaggcg gcagcggact ggatgttcga    133560
     gaagtggcag gccgccaagg accaggtcta cctcggccgt gacgggcagc cccacccccg    133620
     ccgcggcgga ctcgtcgtcg cattctgcga tctgggcacc cccggtgagg actggaacgc    133680
     ctacgacgag ctcaaagcca agctcatcgc ccgaggcgct ccgccggagc tgttcgccta    133740
     catccacgac gcgaagaacg acaagggcaa agcggcgctg ttcaccaagg cccgaaacgg    133800
     cagcatccag ttcctgttcg gttccacgtc caagatgggc gtcggcgtga acatccagga    133860
     ccgcatggtc gccatgttgc acgtcgactg cccctggcgg cccgccgaca tcgagcaacg    133920
     cgacggccgt ggcatccgac agggcaacca gaacgaggag atcgcggtcg gccgggttgt    133980
     caccgaaggt accttcgacg ccaggatgtg ggcggcccag gcgcggaagg cggccatggt    134040
     caatcagttc atgaagggct cgctgaccgt ccgcgagatc gacgacatcg gcgacgcggc    134100
     gctgaacgcc aacgaggccc tcgctatcgc cagcggcaat ccgctggtgc tggagaaggc    134160
     cgagatcgac atcgaggtca ccaaactcga acgcctgcgc cgcgcgcacc agcgcagcca    134220
     gtccatgctg caaatccgca tccgtgacgc caacgacgcg atcccgaaac tggaggccga    134280
     gatcgacgcc tacacccggg cgatcgagca ccgcagaccc accaagggcg acgcattcgc    134340
     cgccaaggtc agcggacggt tctacgacca tcgcggcgac gccggcgacg ccctggccgc    134400
     ccggcttctc aagctgatcg aagacccccg ggcggtgtgg aaggagttcg aggaccacgg    134460
     agtggccgag atcgcaggct tcaccttgga cgcccgcaac gtcccgaccg gccgcgccgc    134520
     tctggtgtcg gtggtgttct ccgacatcgg cgacgacgtc tacgtcacgc tcgacaaggc    134580
     gacgctccag aagggcggga ccgcggtaat gctccgcctg gagaacgccg tcaacggctt    134640
     ggacaagcgg ctcgaggttg ccaccgggcg gctcgaaacc gagcgcacgg aacgagagcg    134700
     ctccgaactc cgcctcggca aaccgttcga gcacagcgaa cggctggatg cgctccggga    134760
     acggcagaag gagatcaaca aagagctgct cggcagcaag gaaacggaga ccgagaacgc    134820
     ctccaccgat ccggcggcgg cgcccggcga ggccgaatcc atccggtcgg ccgcaatgca    134880
     cgacgccgca gcgatggttc accagatggg aggcgccgca gttgtcagcg gcgccaacgg    134940
     gatcacgatc atcagcgatc ggggcggccg ggctcggtga cgaactgcgc gatgtggtcg    135000
     aggcgcccgg ccagggtgcg ggcaagcgtg gacttgcccg cacctggagg gccgctcacg    135060
     acgatgatca tttgagcgcg ggttcggggt tgcggccgag gatgtagtag tgggcgatcg    135120
     actcccggag ctgtccggac ggctcgcatt cgagcagttg tgctcgcagg tcggtctcga    135180
     atcgttctgc gagagtgggg tcctggcgaa tccgggcggt gtaggaggtc gaccacaaga    135240
     acccgaggaa ctcatccatc gtccaggtgt gcggtgtggg gaactggtgc tcggcgacgt    135300
     cgacgtaccc tgcttcgcgc agcacgtctt cgtgagtgcg ccgcgcggga gtgttgctct    135360
     cggcgggggc aggcgccgcg ctcgcggggc gtccgggttc gccggaccat cgggctacga    135420
     catcgacggc gacggcttgc cagggctcgg ttccgctcca gggtgtgctg ctgcccaaga    135480
     tggccaggca tccgcccggg gccagccact ggcggacgcg ctcggcgatc agcggtcggt    135540
     ccaagcggtg gaacgcattg ccgatcgtga ccagctgcgc cgccggttcg tcgatgacca    135600
     ggtcttcggc cttgccggtg ctccaggaga tgttgattgc gccagcttgc tcggccttcg    135660
     cgcgtccgac ctcgatcatg tcgggctcga ggtccacggc atagacgtgg ccgaaccggg    135720
     tgtgcagggg aatcgcgatt tcgccagtgc cgcaggcgag gtcgaccaac acgccgccct    135780
     ctcccacccg attgatgagg tcgtcgagca gtggctgggg gtaggccggg cggtaccggc    135840
     tgtagtactc ggctgcgccg cggaagaggt cttctcggta gccaggtcgc atgggccagc    135900
     tcgggggggt cgacggggtc ttggtcatgt cgggttctcg ctccttgctc tcgcggtgcg    135960
     atgcggctgg gttgctgggt tcgttcatgg tcaggggacg aggtccgggc ggtcgaactg    136020
     acgccggtag gcgctgaacc cctccccaca gacccgcgag cacaccttga gtttcccgcc    136080
     cgcgatggtg tcggtgctcc agctgcgttc cacggccgtg aagaattcgc tggcgaggat    136140
     ttcatcgagc gggtgctcgg cggcgtcgag ggtgttggct ccgccggagg cggtgagcag    136200
     gtcgtggacc tgggcgtcgg tggcggcttg tccacgatac agctggggca gggtcgcttg    136260
     gacgtagagc cagcagcacg ggtacacgtg tccggtcgcc gagacgaaga tggcgctcga    136320
     gtcgagggcc tggcactgga tggtgcaggt gtcgaagaac gcgtcgaagt actcggcgcg    136380
     ggcctcgatg ctgcgcgccc agagcacgac ctcgttgacg agccgttcgt cggccggcgg    136440
     ccgcagttcc ccgacgactg ccccggtgcg gtcgtagatc ggggcggcat cgatgccgtc    136500
     accgggacgc agttcaggag cgggttcata cagggggcgc aggaagcgag cggtcttctt    136560
     gacgctgaac tcggcgaatc cgagttcagc ggcacgggcg cgggcggagt cgatctcgtg    136620
     ttcgttgtgg gcgaaggcga tgtagtccca ctgggcgcgg ccgccggcgt cgatgaacgc    136680
     ggcggcgttg gccaggactt tgtcgatgtc gactttgcgc cggtacacgc tgttggtggc    136740
     cagcccgtcg atggcgaaga tcgtggtgat gccggggatt tcggccagcc gtgcccacca    136800
     ggtcggggtg cgcaggccgc cgttggagta gatgcggatg gtggtggacg ggttgatggt    136860
     gtggatgtgg tggcagatgt cgagcagctc gggagcgatg gcggggtcgc cgtaggcgcc    136920
     gcagatgtcg acgatctcga gttgggccag gacgtgttcg ggcaggcagg cgcggaactg    136980
     gtccagggtc atcgaggttt cggtgaggcc gggggcggtg gcgccgaaga ggttgcgggc    137040
     gcacatgggg cattcggcgt tgcagcgggt ggagacctcg aggtggagtt ggcgcaggtc    137100
     ggggacggtg tacatggttc tcacctcggg ttcaggggtg gacggcggtc gggtcggact    137160
     tggtggcctt gattccggcg atgcagttgc aggaccgcgc tgtgcaggtg atgcccgcgg    137220
     tgggcagggc caggttgttg tcgaagatcg ttccgatccg gccgccctcg cgacacgacg    137280
     ccggccagat ctcgtcgaat cggatgaaca gggattcggc gccgacgttg caggtccagc    137340
     cgggccaggt gttggctccg gtgtcgatga tctgcgacgg ggtcaggact tggtgggtgc    137400
     cgtcgaggta ttcgacgtcg aggtcgcctt tgagcagtgc ggattcgcgg gagccgggct    137460
     ggtcgacctc ggtggcgagg gcggcggtga gcgcggcgtg ctggtcgggg ctgtagtcgg    137520
     cgcggcgagc ccagccgtcg aggaacatga tcttgcggtg caccggcgcc ttgccgtcgg    137580
     cctggacggc tgcggcgagg ttcatggtgg tgtcgaaggc ggcggggtcg atcaccacgt    137640
     tgacatcgac gctggtcgtc gcggcgatgg tgtcgacgac ggcgcggaag tggccgggtt    137700
     cggcgcgttc gtggtggtag ctgagcagta cgtggtcgaa ggcgggtgcg tgggtggccc    137760
     accagggctg cggccgggtg ccgttggaca ggaccgcgac gtcgatgccg agggcgcgca    137820
     ggtcggcggc catgcggggc agctgtggcc acagggtgat ctcgccgccg ctgagcagga    137880
     aggtgatgtc gcggccgcgg taatgctcgg cgacggtgcg ggtgaagcgg tgcaccgagt    137940
     tgtagtcggg ccagcgaacc cggttgtcat gcaagtaaat tgggcagtag tggcaggcgt    138000
     agttgcagac gctagacatg atccactcca cgacgacgcg accggtgtcg gcggtgtcgg    138060
     cgggggtgat ccggagcggg attcgggtca tgaccctccg ttcgggcggg tggcgatgat    138120
     cagctcggtg gtgaggtgtt cggtgagcac ggcgtcggcc ccgaactttt ccacgagcgc    138180
     ggcccgcagg tcgtccgcga acgccgcgcg agcggactcg tcgctgaatt ggcctggtgc    138240
     gctgtaggag aaggagaact ggagcccgat cacggaatcg atgtcccggt ccagatccca    138300
     gtgccaggtc gtgacgtcga tgtcggagaa cgccgaggtg gccaggactt cggtgtgggt    138360
     aaggcgggga tgggtgtagg tgctggtgcc ggcgcgccga gccgcgccga ggtgggcggt    138420
     gcgaacctcg gtgacgatgt cgttccacgg cggtgcggtg gcggtggccg ggggcccgcc    138480
     gctggccagc acgaccgcac cggccgcggt gaggcgatgg tcgaggtcgg ccagcagtga    138540
     ggcgcggtcg gtccagtgga agctggcgcc catggtgacc agatcaaggg cgggcagatc    138600
     gagcgcgtcg aggtggtagg agtcgccctc gcgccagctg atgttgtcga tcccggccgc    138660
     cgtggcgagt ttcgcgcctt catgcagcat ctgggtatcg gggtcgacgg cgtgcacgtg    138720
     ggcgaccaac ggtgccaggc gcagcgcgat ctggccggtg ccgcaaccga ggtcgagtac    138780
     ctgctgggtg ccgtcgagat caaagcgttc gctcacggtg gtgaacagtg cggccgggta    138840
     gccggggcgg tgccgggcgt agaagggggc ggcgccggtg aacaggccgt gggggtcgta    138900
     ggtcattcag cgggctcctt gccggatgag ggggtcacag gtggtgctgt cgagcaacgc    138960
     gagggcggcc tcgtgcagcg ccgtggcggc gatcccggtg tgatcgagta gttcgtcgtg    139020
     gctcatcggg aggggcgggt tggcccagcc ccgcacgacg acggtgcgcg gcgcgccgcg    139080
     ttccccgagc agcgcatgga ctgcggccgg gtggcaggtg gtcgcgatga ggaccgcggc    139140
     cccgggtggg aacagccgct cgaagtcggc ggccgagatc gcggcgtcgc gccggccggg    139200
     tgcgccgagg ctggtcaggt cgtggatgtg caggtaccgc aggcgggttg cggtgcgggt    139260
     ggcggtgatg gttgttgcgg ctcgggtgag ttcgcgggcg gcgatgtcac cgatcgagac    139320
     cagcaccatc tcgggatcga ggtcgtcggc gatgtgcggc cagacggcgt acccgtcgcg    139380
     cagctccgcg tcgatggtgg tgtgcggatg ggcgggcatc gggtgtttgg aggcgacgac    139440
     caggctggcg cggccgagtt tgcgcacggc gaaggtgagt gcggccgcgg tgcgggtggc    139500
     gtcggcgggc agatagatgt gcacgctcgg gtcggcggtg ccgatggcga tgtcgatgag    139560
     cccggggttg gcgtgggtga tggtgttgtg ccagccgagg ctggtcagca ggtacaccag    139620
     gctcgggccc ggcgggcgtc cggcagccgc ggcgagccgg tgcgcgagga gctgctgggc    139680
     cagcagcgag gcggtgatcg gggcgaacgc ctcgtagccg acgaccacgc cgcggcgacc    139740
     ggtagcctga tagccctgag cccaggcgtg gcacagctcc tcgttgagca cttcgatcgt    139800
     ccagccggaa tcgggggctc ccagctcgat ccggttggag gccagttcat ccgggctgaa    139860
     caccctcagc ccgtagacgg tgttcagttc gcgtagggtg gcggtgatcg cggcaccaaa    139920
     gtctgctccg gcgacccggt cggcgactgc gctggcggcg gcaatgcagc cgcgcggtgc    139980
     gtggagttcg acccggccgg ttgcggcagg tgcgagagcg cggcgcaccg tcgcggtcgg    140040
     cgccccgccg gtgaacagtt cctgcgggcg gtagcccgac agccagcgct ccagcgcaac    140100
     gaattccgca ttgtcgtcgc gcgggttgcg caagggaacc ttgtgcactc gcggcgtttg    140160
     tgcaatctgt tgcccagcaa ccgttttcgg cacgccgtgg cccttgtcga cggtaacgac    140220
     gacaacggtc gacggtccgt actgcaaggg ccgcagcccg gtcaaggcgc gggccacggc    140280
     ggcggtgatc tcgtcggtgg acggtccggc ggtgatcacc tcatagccca ggccgccgag    140340
     gtggcgggcg agatcgcagg ggtcgagggc ggccagcagc gaggccgagc ccatgcgcag    140400
     gccgttggcg aggatgaccg gcagcacgcg gccgtgggtg ccggtgccga tcagggcgcg    140460
     tgcgcccagc caggctgccg cagtcgcgcc ggtttcgcac tcgccgtcgc cgatcaccgc    140520
     gacgacgagc cggtcggggg cgtccaagcc catgccgtgg gcgatcgcca gagcgggccc    140580
     gagttggccg ccgaggtggt cgtggccggg gatgagtggg gtgatttccc caccgaaccg    140640
     ggtgcgggga aactgcgcgc acaggcgcgc caggtcgacc tcggtgtgac cgaatgcgtc    140700
     ttcaccggtg tcgagggcac cggtgatcca ggcgtgcgcg agcgccgacg gcccggcgtg    140760
     gccgcctccg tgcacgaccc gcacgtcggt tccgggcatg cgccggtagg ggcccaacgc    140820
     ggcgagtacg gcattgaccg gtgggcacac gccccagtgc ccggccgggg ccggtttgac    140880
     gtggccgggc tgcaacggcg tggacaaggt gacgttgtca cgcagataca gctgtgccag    140940
     gcacaggtag tccagggcgc ggcgcgcggt gtcgacctcg gcggcggtca ccgatgccgc    141000
     ggccgccgcg acctgggttg tccagtcggt ggtcatcgcc gggccttccg atccgcgccg    141060
     gcctgggcga tcgccgccac ggcgacggtg atgcggtcgg cacgcagctg atcgttcccg    141120
     gcttcgacga tcatctcgag gatctgaatc agctcgggct cggtgatgtg gtccaggccg    141180
     agatcggctg cggtcagggc ctgttgcagg tccgcaggga tgcgatggtg gcggcgatcc    141240
     ggcagcgggc gcaaccgcag cgccaccgct ccgctggtct gctgggcggc ccagggcggt    141300
     ggacgcaagg cggcgcggcc gtcgatgttg aacaccactc gtgaacagcc gccggtccca    141360
     tggtggtgct cgacgcggta gcggcgcccg cggtggggtc ctcggggtgc ggcgaagtcg    141420
     agcaccagca cggtgcggcc gtgcaaccgc cgaagggtgc cttcggtgga gactgggatc    141480
     gcgggcagtt caggcagcat cggccatcac ccgggcgaga tcgacggtga ccagcgcccc    141540
     ggcggggccg ccggtgttgc gccgcgccgc tttggccgcg aacaacgcgc gatccactgc    141600
     ggcgaggagg aacttcgcgc gcactgccgg gtcggtgctc ggccacacca ggccgggccc    141660
     aacgactgtc gtggcgaagg acacgctgca cggcagcgcg gcgcggcagc ggtcacgcag    141720
     atcggtgacc gaggcggtga acccggcgtc ggtgacgccg gtggcggcca cgatgacctc    141780
     gtcaccaccg aacgtcgaca cgcaccctgc cggaaatgcg gtgtcggcga accaggttcg    141840
     gcacaccgat cccagctggg tcatcagcgc gtttccggcc aggtggccaa agctgtcggg    141900
     atcggtggcg ttgctgtgct cgacgtggct tttgaggtcg tcgacgtcac cgatggccag    141960
     gccgagcagg gtgcgctcgg caacgacgcg ggccagggca tcggtgatgg cgtgcgggta    142020
     gaggtcgggg aaggccacca agccagtgat cgggtcgcag cgggcgccgg tcagccactc    142080
     ggctcgacac ggcagctcat cgagaatatt ggtcacggac agggcctttc agcagaggtg    142140
     ctagatcggt cagggccccg atgcgggcga cgtcggggtg cgccggggtg gcgctgttgc    142200
     ggacgaggtg gatggcagac cagcccgcgg ccagtgcgcc atcgatgtcg aagcgggcgc    142260
     tgtcgccgac gttgagcagc tgctgcggcg ccaggtccat cgcggcctcg atcgcgcgga    142320
     atgcggccgg ctgcggtttg cacgcgccga tctgccagct gtgcagcacc acttcggcgt    142380
     gcgcgaagta cggcggccgc gcgggctgtg tgtcggggtc gggcccgatc gcgttcgaca    142440
     gcaggcagat acggaagccg agcccggcca gctgttccag ggtggggatc gcatcgggat    142500
     acaggggcgg atcggccatg tcggctacgc gcaggcgcag ccggtcagcc accgcgtcgg    142560
     ctgtgtgcgg gcggccgcat gcggtggcga ggatggcagc cagttcaccg ggcggtgtgc    142620
     ggcgggtctt ggcgtgttcg atcagcatgt cgcggacatg ctcgacatcg gcgtcgagca    142680
     cttcggccag ttcggccgcc aggactccac ggggcatctg caccaggacc ccgccgatgt    142740
     cgaagcagat cgcccggatc tcacgctgcg gcaccggcgt ctccttcgcc gaagcggtaa    142800
     ccgctggtca atcccgcggc cgtgcgggcg tccaggtgcc ctgcggcggg caccagagga    142860
     tcgagctgat ggtcttggcg caacggttcc agcgtcaggt ggtactcgat cgcgggaacc    142920
     gccgcggcgg gtgcgctggc ggccagggcg agcgcggccg ccaggccgga gccgtgcggc    142980
     aggctgcgga tgttcaggcg cgcggccagt tccaccatcg acagggtgtg ggcgagcccg    143040
     ccgcaccagg tcgggtccgg ttgccagatc tggatatcgc cgccgagggt gcgcagttgg    143100
     tcggtgggct cgtagtcgtg ctccccggcg gcgcgcgcaa gcccgtgccg ggccaggtcg    143160
     gcatccgaga tcggaccggg ctcctccacc cagcacacgc ccgcctcggc caacaccggc    143220
     agcatctggc gggcatagtc ggcaggccac cggccgccga catcgacacc gatgcgggcc    143280
     cgctcgccgg ctgcctcgcg caggcgtcgc aaccgggccg cgtccgcccg tggtgtctca    143340
     ccacgggcag cgccgggcag tccccatttc tgagcccaga aaccctcgtc gacgagccag    143400
     gcagcgatgt cgggtgccag cgggtggtcg atgtcgatgc ccagcgccgt ggcatacaca    143460
     gggatgcgct cacgtcgctc accagcgagc agcgcaccga ccgggacacc ggtggcgtgg    143520
     ctacgcagat cccacgccgc gagttcgacc gccgacaccg ccaggcgcag gtgcgcgccc    143580
     tggcggtgtc gaccgtgcgg ggcgagtgag gccatcgccc tccaggccgc gagttcccgg    143640
     cctatcacgg cgggagcgac ttgatcgaac accatccggg ccacggtggc cgataccggc    143700
     ccgaaccagc ctgtcgcgcc ggtgctgtcg acgactccca ccgccatccg ggtgaggttc    143760
     tccggccacg gctgggccgc cgggtggcgc cgcgcgggct gtgcccagtc cggcagtacc    143820
     tccgccgagg ccgcggcggt gaggggcagc gggggcaacg ggcgggtgat gacgtcggtg    143880
     atcgtgcgag ccgtcatcgt cagatcctgg tcccggtcag tggctcgtcg gcgaagctga    143940
     agtaccacag cggccggtag ttctcccacg gctgcgggcg aagcccggtc ggcccgaaca    144000
     gctcctcgat ctcacggcga gcggcgaggt agaactcgat gtcacgggcc ccgtcggcga    144060
     ggaacacatc catcatcggg gtgtgggact gatagacctg gaaccgcggg aaggtcgtgg    144120
     tcacctcgac gaagtcggcc aggtgacgcg cggcgacgtc gagcgggtcc aggccgatga    144180
     tgtaggtgaa gtcggtgcgg atgcccgcgg cgacggcgtc gccgagtacg cgcaccatct    144240
     cggtcggggt gagcgcggcc ttggattcct tgagaatcag gtcgcgtttg gtgaaggctt    144300
     cggcggtcag ggtcaggtgg aacggtccga tcgcggcggc ctcggccagc cccgcaggcg    144360
     tggtgagcac gctggacagg aagtggatct ccccgccgca ctggtgggtg gtcatcgctt    144420
     cgcgaacctg ccgcagatgg gtcagcgcga gctgttcgaa ccggaagcac ccggtgcaca    144480
     cggtcacctt ctccacgctc gacagccctg tgccgaggcg gtcgtcgacc agagtggaaa    144540
     agtaggcgtt gaggtcgtcg agggccaggc ggggatcgtt ggcttcctcg agggtgttcg    144600
     ggcagaacac gcagccggta catgcgctgc gcgcgttgga gttcaatgtc aggacccggc    144660
     cctcgttgcg ccaatacccg agcaccgcgt cgtcggcctc ggcgacgtcg atgaccgcga    144720
     cctgctcacc acccagcagg accttggtat cgaccagctt gaacggtgag cggcgcctgc    144780
     ccagcgacaa gatcatgtac agctgatcgt ccgggcggga attcagccgc agccgaaacc    144840
     gcaaccgcga caccccgata tcggcgtcca gaccgcacgc attgagcgcg atcaacatga    144900
     tgtcgtcggc gtcgatgccc caccggatgg cgagtcgttc ggcgtcggcc ctggtctcga    144960
     gcatgtgtac ctaccttttg tgaccggtgt cagtggacgg gtgtggcggg cataagttgt    145020
     cgacgtagaa caggtccgag accaggtcgc tgtactcgag ctcgagctca gcgagctgtg    145080
     tccatgcctg gtgcatccgc tccgagcgcg ctccggacgc cgccagctgg tgcatcgctt    145140
     gttcggccgc cacggccatc cgatcgatca gtacgccgat cgtctgcgga taggtgatcg    145200
     ccagcagcgg ttcgacagtg ttggtcaggt cgttgatccg ggcggtaagt tcggttcggc    145260
     ggcagtcgca ttccgctgcg cgcgccgacg actcccggcg cgcgccatgc aactggacca    145320
     gctcgcgcgc ccacgagcag atcgggtccg tgtcatccag gccgcggcac agcgcgatca    145380
     gcaggcggtc ccgggcgggc aagcggtagc ggtgttcctg cgtgatcggc ggtgtgcgca    145440
     caggctctcc tcccacccag cgactgccct ggggaccgct cggaaagcga tgcacgggct    145500
     gactggttct cacacggtac ctatccgcct gggggttgtc caccaggtgg ataggggcgg    145560
     ggggagcacg gatatccgct accgctccgg tagcgtctgg gctatgccca aacagcccga    145620
     atacctctcg atcgcagcca ccctgcgggc cgaagtgctc gctgggagct acgacgccga    145680
     gccacttccc ggcaacgccg acctggcaga acgcttcgac gtcaacatga agaccgcggg    145740
     gcgggctgtc caacaactgg tcgcggaagg actcgtcatc gccaggcccg gaatgcgggc    145800
     catagccacc ccgccggaac tgcgcggcac ccgatggccg atgaacggcc gctacgcgcg    145860
     cgcccgcgct gctcgcggac tgatcttcgc tggcgacgtc aacggcaacg tccgcaagga    145920
     caccgtcagc cgcgaatggg tctccgcgcc cctgccgatc gcgcacctgc tcggcgtcaa    145980
     ggaaggggca cgcgtcttcc gccgccacag ccgcaccttc atcgacgacg tcgcgaccga    146040
     gaacacgatg atgttcttcc ccgaagagat cgtggccgcc gcccccgacc tcgaaaccgc    146100
     cgaacgcatc caggttgtcg cgctcatcga agatgccgga cacaccgtga cccgaaccgc    146160
     caacgagatc cgcgcccgac acaccaaccc cgccgaacaa gaactgttcg ggatcgacgc    146220
     gaacagcatc gtcatcgagc acatccacgg aacctatggc gccacagacg aaccgctcga    146280
     agccgtcatc aacgtccggc ccgcacacgg tggcgccatc accttcgaca cctacgaagc    146340
     accactcgac aacgaataga aggagccccc gatgcccacc accacgaccg tcagaggccg    146400
     gctggctatc gcgctcgaca ccagcgatct ggacaccgcg gtgtcgatcg cgaaggccgt    146460
     gcagcccgac atcggcgtcg ccaaagtcgg ccttcaactg ttcagcgcgg cggggcgcga    146520
     cgccgtgcgc gctatgcagg atctcggcat ggacgtcttc ctcgacgtca agctgcacga    146580
     catccccaac accgtctacg gggccagcac cgtcctcgga gccctgggcg tccaatacct    146640
     gaccgtccac gcaggcggtg gaacggccat gctcgaagct gcggtgaggg gactcggcga    146700
     gggcgcgagc agcgccgggt tcgcagcccc gaccgtgctg gcggtcaccg tgctgaccag    146760
     cgcgccggac gcatcgccgg aacttctcaa cgaacgcctg gcggcggctg tcgccgccga    146820
     ttgtggcggc gttgtctgcg cggccagcga cctgcccgtc attcgcgccg ctgcgcccga    146880
     catcctgacc gtggttcccg gcatccgtcc ggccggcggc gaggtgcacg accagcagcg    146940
     tgtggcgacc cctgccgatg ccattcgcag tggtgcaagc attctcgtcc tcggtcgagc    147000
     gatcaccgct gctccggacc ccgccgaagc cgcgcgggcc atcaccgagg aagtcgcgca    147060
     agcactttga tcgaacccgg ccgatcgttg aagcagctcg agatggtcgg ccggtttcgt    147120
     cccatggcga cgccaatagc gacgacgttc gggtcgcgcc cgaccagggc ggtccgcaca    147180
     tgcgctacct cttgatcggt gttgctcgga cgacgcccgc gtcgtccacc tccagttgaa    147240
     gcctcagagg ccgccgttgc caggtgatgg ccagccacat cggcgcccac agccctgccg    147300
     tggcgacgct gagcgccgcg tgcagaccgt gcgccggccg aggcccccac agcaccacca    147360
     ccgctcgcaa gtccccacgc aggtgcacag tgcagttcgt gcggtccctc aaccaggcaa    147420
     tccgctcgtc cagccgctct cgccgctgtt cgatgctcag tgctgacggc accagcggcc    147480
     cgttggccgc cgcgagatgg cgttcgctcg acacacgttc gggcggttcg ttcatcgatg    147540
     cctccgcatc atcagtcgga gaccggagta cgtgtctcgg ggcaggtgcg tgttcggcag    147600
     gcagcaggtt cccgccgata cttggtcgat caactcgacg tagtccgcac ggacaccccc    147660
     gagctgcgct cgggcatcat cgatctcggc ggaggtgacg cgcgctctcg gggcacggaa    147720
     tgcgatcgca cacaagcttg cgaaccgatc gacaattgcc cccaccgact cgggatggag    147780
     tcgggcatct acgttcggca ccggcgcgat ggctaccacc aggacgtcaa cacgccgggc    147840
     cagacgcagc ctgtgcgcct cgattccgtg gggtctcctc gccgcgaaac gagccgcgtg    147900
     caactcaccg agttctgcgg cggcctcgac aatcgggttc gagccataga ccagcagccc    147960
     acgacaggca tgctcgagga ggatatcgtc gggcagggct cgttgcagcg cactcattcg    148020
     aagtcgtcct cgacgctgtc ggccggcgcg gccagcacct cggcaactcg ccccttcaca    148080
     cggcactggg acgaacaact ctcgtgcatg cgccgcgcgc gaacggcaac tcccctgggg    148140
     atgggccctg gatcggtaag gcaatcggcg atgttagaaa ccgtgtgctt caacgacctg    148200
     gggtcgaggt acccaggccg caagctcggt ggcgcctcag cccactccat cgcttctcct    148260
     cccggctccg gaagcgggac cgaggcagac gagaccggtc atcgagagac ctccagatga    148320
     cggtccgggc gcgtgaggga gtggggacgg ccaccatcct tcggccagca cagtggcggg    148380
     tccaccgtcc agaccgctgc gattcgccgc actgtgtcca tccacccccg taggtgctgc    148440
     tcggacggca ccacaaccac gtccgcctgt gtggagttca cgtgcgccag caggacggtc    148500
     agatcggtgg tgacgtgggt gtcgcgggca ggcaaatcca gccgcatccg cctggccagc    148560
     gcccggacgc tctcgacacc gccctgccca tcgcgcgccg caacatcctg ccggacaatc    148620
     gcaatcgccc tcatgagacc gcgctccgca gcgagctgta cgagaccgac ggtgttgccg    148680
     ccagcggaat cctcgcccat gtgagcgtcc cgcccgtctc gggctgcacc cgcccgtgct    148740
     cggcgaaggc ggtgatcgga tcgctcatga gctcgtcggc acgggaggcg gtctcatgaa    148800
     cttgcacctc gagcgtcgat tcacgccgga gcagccacac ggtgatttgg ttgctcggcg    148860
     cgagatcagg gaagccggcc gcgagccgcg catagatgcc cggctcggcc gccgtcatgg    148920
     cctcggccag caccgcaagg acgatctgct cgacaggctc ggagaggtgc cgtagtccgg    148980
     cacgggtgag cagttcgtgc gtctggatct gggccagccc gcgagtggcc aagttcagtc    149040
     gaagctcgaa ttgcccgatc ggagttcgcg gcggggtggg ggcggatgca cgtggcgacg    149100
     ggatatcgcg attgcggcgg acggttcgca ccagggcggc ggcgtcgtcc ggatcgaggt    149160
     accacacccg cagcggacgg agccgctgca actgtcccag cagcgtcagc cggtcgtcat    149220
     tctctccacc tttgaggtgg gtcggggtcg gcgtgatgat gtgccgcgac cacgcttgcg    149280
     agacatcccg caggagcatc cacaaggcgc cggtggcggc gccgcactcc cggtgcacca    149340
     cggccaggtc gaagccttct cgagctgcga actcgcgcat cgcgtcctct acctcctgga    149400
     cgcgctcgcc gaccagctct tgacgcagat agccgtacat caacgacggt tttcggtcca    149460
     tcgtcttacc cctgtctgaa cttcggcagc ccgtcgtgct ggccgaactg cgatgtggaa    149520
     cccgacgtgg ttcggtgcgc ggcgaaatgg accgtgttgc cgagcgactc ggacccggcc    149580
     gcggcggcgc gcacagcggg atcggtggtg gtggcgcggg cccggccggg acgggccggt    149640
     actcccgcgc gcaaggtcgc gaggacccat tcgagaaagc ccaggtagtc gactcccgag    149700
     gagagccgcg cgattcggcc gggccccagg tgcatccgcg catccggctc gagccggaac    149760
     tcgcgatggt cgaaggacac gaaagcgcct tgcagcgcgg cgagggtcag cggatcatgc    149820
     agcatgctcg cggggtggaa tctcgcgaac cactggtcaa ggtggtgggc gatcacttgg    149880
     gcccacggaa tcgacgatgt cgcgagcagg cggtagaccg ggctgtccgg gtcgaccgcc    149940
     atcaccggag taaaggtgtg atcggacagc accaacgtca gattctccgc tcggcctacg    150000
     accgtgtgga ccgctttcgg atcgagccga aagttgtgct cagcgcggtc tggctggcgg    150060
     tattcgagag cgccccccat ctgccagatc cgcaggcgcc gcgccagacc gagcggggtc    150120
     cgacgaccgg aatcggtctc cagtaggcgc gcgagatcgg tgagcggccc gattcccaac    150180
     cagcgcaatg gcgctgacga atccgggtcg gtgagcgagg ctaccgcggt gtgcaggtcc    150240
     agcggccagg ggtgcgctcc ggcggggaca agcccatcgg cggcccagta cttcctctcg    150300
     cccgctgtgg ccccggctgc taccacgaca tcctcgcggc cgagcaagtc gagcagatgg    150360
     cgggcgagca ttgaccgccg gccgtcgggg aactcatcag cggtgacaac cagtgccagc    150420
     cgcggttcgg tcattgcggc caaggccagt gcgatcgcgt cgtccggatc gccgccgatg    150480
     tcggtggaaa cgatgagggg actgtccctc agcgccaccg ggtcgtggga agcagcggca    150540
     gccatgatca gctcgcctgc gacaggttct tcgcggcatc gagaacgatg ctgaccacgg    150600
     tgtcgaagtc gggacgttct tcgccgatgg gttcctccac ccagtgccgc cgctcgtcgt    150660
     ccgggccggg gagcgtcacc agcgaaccct gcacagtccg gatcgcttgg tacttgaaca    150720
     gctgggacag gatgcggacc gggcgtgggt ctcccatccg cgcgggctgg gtgacgaagg    150780
     tcaggaaccc ggttgcgcga ttctcgatcg tcggagttgc cagaccccga cgaagcagct    150840
     cggcccgaac tcgctcaccg agggggcggg gcatctggat tgtgtccacg ggcccggcgc    150900
     gcaggatgat ctgctggtgc tcgtccacct cggcgccgat gaagcggttc tccgtgatgt    150960
     acctcgcgca gcgcgccgcc gcggtctcgg tcagggtagt agccatagct cctcacaggg    151020
     catccgatga tcgggaagga agccgtcgaa cagctcgacg gcggtgatcg cggggttgtg    151080
     gccctgcgac cacttccgca agaagttctt gaccgctgaa cggcacccgc ggtagtcgaa    151140
     aacccggtca gcccagacga accggagatg aacatcgggt tctgccgggc gcggcgagcc    151200
     cttgttgctc aaccgcgaat caaccgcgcg agccacgaga tcggaacgaa ctaccgcact    151260
     agccatcgcg gaaacctccg tcggtgggtt agctgctgac cacgccgttc gggcagcggg    151320
     gcgaggtggc acgggactcc gaggacgccg gccaccgtga ggggggcgtg acccagcccg    151380
     agctcgtcaa gccagtcggt tacgtccgcc cacagcggat cgtcgtcgct cgccgggcgg    151440
     ggctggggga gcacctcggc cagcctgatc gcggccagtg cctgccccag tgtgagtgtg    151500
     cgcccacgca actgctcaac cacccactgg tcgttcccga ccgagatcgc ggaaatggtg    151560
     gtgatgtcgc tcgacatcct ccggcctgca accagctgaa cagccatgat caggccctcc    151620
     ctcgggggtc gaccgcgctg agtggcgggt tgcagggaag gggtgccaag cccggcggca    151680
     gagtcgcgcc accgtgttgt ccgaagccgc actgatatgt cgtcatcagt cccacctgca    151740
     ctggccttgt ctcggagtga ccaatcccca cggtcacttt gctctgccat gtgtcagaat    151800
     gtcacagtga caagcaacgt gcaatgcaaa cggcaaacat agaggttgcg gatcgttgct    151860
     gcccagtact ccgccaccgt caggggccgg aacatgtgac agaatgttgg atgtgacaaa    151920
     aagtcactgt gcgctagagg aggtgtgacc ggtgactcag ggcccgatct cggccaatgg    151980
     ctaccgaatg tcgccctaca gtcggcggtt gcatctcggc gaccgcctcc gcaacctgcg    152040
     ccaggagcaa gaacgctcga tccagcaggt ggccaaggaa gctgacatcg accggacgct    152100
     gctgacccgc atcgaaaccg gacaacgtcg agtcgcggcc gacgtcagca tgaaggttgc    152160
     cgagcacctc ggcgtcgagc agcattcgcc cctctggcag gagttctacg cgctcgctcg    152220
     agacgccgcg cagtccgggt ggtgggaggg ccgcgccttc cgtggactgt ccgaccgcca    152280
     ggctttaccg gccgatctcg aggcaggcgc cagccgaatc cggtggtacg acttcgcgct    152340
     ggttcccggc cttctccaat ccccggcata cgttcgtgcg cgccacgatg cgacggtcac    152400
     caacgatcat tcttcggaca atcctgtgga gatccgcgcc cgcgaacgcc gtcagcagga    152460
     agcgctcacc gagggtggtc cccggatcga ggtaatcgtc gaagagacag tcgttcggcg    152520
     gcgcgtcgtg cccgctccgg caatgctcga acagctggag cacctgctga aactcatcga    152580
     cgcgaacgag cagatcgatt tccgcatcct gcccgtcggc ggtgaactac tcggcctgcg    152640
     agcgccgcgg tcaccggttt cgatctacga gttcgctgcg ggcgacccgc ccctggtgtt    152700
     cgtcgagtcg ttaaccgacg atgtgctgtt gcgcgatcac gccgaggtcg ccaaccatga    152760
     gcggctctgg aagcggctgc acgagatagc cctacccccg gacgaaagcc gcgtactcat    152820
     cgcccggagt gccgaaattc tcgcaaagga gcagtgaagc aagtgaggaa cacgatcatg    152880
     accgggcacc ggccgcttga cgggtacgtc aaggcgtccg ccagtgacgg cggcggtaac    152940
     tgtgtcctcg tccgccggaa gtcgggcgag gagttgatct tcattcgaga cagcaaatac    153000
     ggacgcgacc ctcgcaatcg tccggaggat gagcccgtcg tcgagatgcc cgcctcggct    153060
     tgggaagggc ttcgggccgc tgccttgggc gatgccacgt cgcctgcggt tcccggccag    153120
     cccgtgctcg aagagacggt tgacggcgga atggcgctcc agggagcgga cgggacaagg    153180
     ttgaccttca ccgcggcaga atggagtgcc ttcaaggccg gactcgtcgc aggggagttc    153240
     gagccccggc aggtcgccgc ctaggccccc cgcccgccgg ctgacgacct ccccggctcg    153300
     ctacacgacc ccaccagaat ccaacgtccg tcgaccgagc caggtcgacg gacgttcgca    153360
     tctccgaacc cgtgctacag cagatgaccc ggttcgaagc cgaactccac gaccagggtt    153420
     tgcaggcgcc gaacatcatc ggcggcgatc ggctgccatg tggacggggg gaggagcatg    153480
     ttctcggctg tgcgctggtc gccgagcagc ggagcgaacc gaacccttcc caggagatcg    153540
     cccaccgagg tgacgacgag ctcctccagc cgcccaggga cgtcgtcctc cacccggaga    153600
     cccattgcct tctgccagag aggggtggcg cctccccagc ggagtcgtgc gggcggccag    153660
     atgtctgcca cccgcacggt tacgtcgata ggggggtcca cccaccggca cggctggtat    153720
     cgggcctcat cgaacatatg agcgacacta gttcaccagg cgggcgcggg cctatccggc    153780
     tgctcgtatc atcaactcgg cgagctgcat gttcaccaac cgcagtgagg cgtgagtatc    153840
     gtccagggaa tcggagagcc gttcggagta ctcctccgct cggcggctca actgctggaa    153900
     gcggttgtgc aagttggtga gggcagcgtc gccagcccca ttcgccttcg ccgcggcgat    153960
     gtcttcggcc agcttctcga ggtcttcccg agcctggttg gtgaaggcgt tgacgatcat    154020
     ctcgcgcatc tcgtcttcat cgggcagggg gacacggacg aaatggctgc cggacccgaa    154080
     ccgcgcgacg acctcacgca gccccgccag ggtcgattcg tgctcggcgg tgacgaagta    154140
     gaccccgccg gtaggtcgaa ccttcagtcc cccaagggct tctacgtagc ggcggacgac    154200
     ggcccgaagg cggtcggggc ccatgtaggt cgagtgccag gtgtgcaggt cggtgacttc    154260
     cgcgagtagc tgctcgacgc gatcctgttc accctgcggg aggtccgcga tggcggcggc    154320
     gtccggctcc acccggagct tccccgcgcc ggcggcgtcg ggatcatcgg agcggatgaa    154380
     cgcgatgacg cccaggcggg tgtcgtagga cagctcggtg cgttcctcgt cgcggacctc    154440
     ccgcacgagg tggcgaacca actgaccgct gtcccggcgt acatggcgaa ccatcagtgt    154500
     ggccacccga tcaccggcgt cgtcgcctga cttgcgccgc ggacgggttt tccggtccgc    154560
     cgtgggatcg tcgagggagt agaccgcctt cactccctgc ggcccggtga cccgctcgaa    154620
     ggcgtcgtcg gcgcgcaggg gagggggcag atgcactgtg tccaagtcga attcgtcgaa    154680
     ccactttgcc agttcgtccg gagtgacctc cccccggaag atcgaataca gcaccagcca    154740
     gcccagcacg ggactcgctt ctgccttgtc ggtgtactgg tcgaagacgg acatggggcc    154800
     tcctcatcag ccgcaattca aaacgttcgt tttcatctcc accgccccag agaagtcggc    154860
     ccggtggaga gcgcgctcgg tcagatgact cggaacaggt ccgctgccgg gtgcgggtcg    154920
     gccaggtcgt cgagggttcg caggttgtca cacagcgctt ccaacacggc gctacggccg    154980
     gccgggcggc gggggtcggt gatggcgacc ccgaacagcc ggaagtccag ctcgctcttg    155040
     gccgacttcc aggtccgcat ccactcttct gtcacctcgg catccccgtc ggtgatgagc    155100
     acgatgtctc cgccctgcac cgcctggtcg ccgtggtgtt cggcgaggat gtcgacggcg    155160
     atgccgaggg gtgtctggaa atcggttccg ccggagaaga agctctcggc gaagtcgagc    155220
     actcggtcga gaggggcctc cccggccggg aatctgtgta cgctgacctg ctcagctgag    155280
     gagaacagga tgccgacgaa atcgcggccc tcggcacggg cctggtcgag cagcgcgagc    155340
     ccgcaggctt tcgcccatgc ctccgcgctg gcgatccgcc catccggccc ggtatgcggg    155400
     gcgcacatcg agtacgagca atccaggcac gcgatgatcg caccgcggcc gctgtggtct    155460
     tcgcccatgg tctcgtagag catcagctgc ttctcggcga agcgggcggc gaacaccgcg    155520
     cggagtgcgg ggtgcgcgag attggctgtc tcggaaggga tcaggcgagt caggtcgtcg    155580
     cccagagtga tgccgacgag ctccccggcc acgtgttcga gcttgcgggt gcgttcggcg    155640
     gtggccaggc gccggaaccg gccgaccagg tcggtgaact tacccagccg gccaccgcgc    155700
     aggcgctcag ccagccgggc gcgctcgtcg aacgacatcc gttgcagctg ccccgggccg    155760
     aggccccagg ccgccatcag cgccgcttcc tcacgcgcct gttcggcggc ggaggccatc    155820
     gcctggcgag cgtccgcccg cagcgtggcg ccgagcgcgc ctgctgccgc ttctgcttgt    155880
     gcgcgggcct gctgagccgc atcatcggcg gcttgcgctg cggcgaccgc gttgtcgacc    155940
     gcggcggcgg cttggccggg caccgcgccg tcctcgtcta cctgctcggc ggcggcatcg    156000
     agcgcggatt caacggctgt ggcgtgctcg gcggcctcct gctcggccgc agcggactgc    156060
     tcggcggttt gctgagcgtc ttgggactgc tcgagcatct gggccagggt cgagcgctgg    156120
     gcgatcaccg ccatagcggc ggcgtactcg tcaccaacgg tctcgcggtg gagatcggcg    156180
     tactccgggg tgccgatcag ggcggtgacg atggcgtggt tcggcagccg ggtgggctcc    156240
     atctcggcct gttcgcgcaa ggtgggttcg gccttgtaga cggtgaggaa gacatcgcgc    156300
     agcagatccg gcacgtagtc gaaacgccgg gacagctcct cttcgacctc ggccagcgca    156360
     gtggcctgct cacgcacctc ggtccaggtc atcgcatcga accggtcccc ctccacgacg    156420
     gtggcgtgcc gctcgggcgc ggtcgagccg aggccgaccc atcggcctgc cttgcgggcc    156480
     agatcggcga acttgcgcag ggtcttgccg gacatcgaat ccatccccct tcggtcagtt    156540
     gctgccggtc agggtgctga cgtccacgcc gagcgcttcg gtcatcaccc gggcatagac    156600
     cgccttgtgc cgggccagcg ccgcgtccac tgtggcagta gaccggcctg cggaacgcgc    156660
     gttgtggcgc agctcttcga gccgcttgcc cgccttaccg agcttgtggt tggcctcttt    156720
     gatcgcccac tgcgacaacg tttctcgtga ttgaccggcc ttggcgtcga gctgggcggc    156780
     catctcggca atggcgtcgg acaggtccat cgcctcccgc gcgtcagggt tgaccagcgc    156840
     gagtacctcc cgttcgacgg tgggccgctc agcgaccgag tcccacagca cgtgggcgag    156900
     catcggcagg tcgttgtcgt cgacctcggc gcggccgtcg aggaacgccg atgcctgaag    156960
     aaggcgaatg gcctgcttcc agcgtcgatc cgacgccacg agcgactgtc gcctcagcga    157020
     ggttcgcagc tggcagacgg tatcgaccac cccgtcgggc accgccacgg ccgggacgtc    157080
     gatcgtgacc gcctgctgca acgccgcgag ggtgaccgtg gtcggcgcgg tggcggccgc    157140
     agggctctgg acggcggagc gaatgagggc ggcgaagttc gacggatcgg ccagatagcc    157200
     gacctcgagc cggacgagca ggcgatcgta aatcgcggcg ctttcctccc cactgggcag    157260
     ctcgttggag gcggtgatag ccgagatcag cgggcagctg atcggggcgc cgccggattc    157320
     ggggtggtag agccgttcgt tgaggaaggc cagtgtctcg ttgagagccc ccaccgagca    157380
     cttgaagatc tcgtccatga acgcgatatg gcaggtcgtg gcccgcccct cgaacagctg    157440
     ggtgtaccgg ccctgggtca gggctgccac gtcgaccggt ccgaacatct tcttcgggtc    157500
     ggtgaatttg ctcagcagaa tctcccacag ctgggcatcg acgatccggc cggtcagttc    157560
     ccgcgccagc tcggatttcg ccgtacccgg cgggcccagg atcagcgagt gcttccccgc    157620
     aaggatcgct gcgaccaccg cgcgtacgac ctcggaacgt tcgtagaaca agtccgacaa    157680
     ctcatcggtc accgcccgca gcttgcgcgc cgtgtcggac gagtcgtgct ccacctgctg    157740
     tttcccgctc atgacctctc cccgttttaa tgggtaccca tttaatgcgg acgacactag    157800
     cacagaggtt ggacaaatgg gtacccacta agtgaggatg gggcgatgac gcccagcgac    157860
     ccgcacaagg ccccccagcg aacctggcgt cctgagaacg acgagtacga cgacgcgaag    157920
     aaactcctcc acgcccgcgg gcggggattg acggaatacc tgcgtgcctg cgtgcgctgg    157980
     ctgcgcgccg accccgacac agcactcgcg atactcggcg agcactggcc cgagccgcgt    158040
     acccgcggac gtcctcgcac ggaggagtct tcgcacgaag cgcctcgctg aacgcggggg    158100
     agagcggcgt cgtagaacga gacggaggga agccgcgggt gacatccggt ctggggaggg    158160
     gtccggatgc cgcgcgcctt ccctccgtga ggaggccgtc gccggcgcgg tggaaggccg    158220
     aggggagtgg tgcctcccac cgtgctcgat ggcgacggcg tggcttggac ggcaagggat    158280
     tacggtctga aacttgccgg aacgaccggg acgaacttcg cctccgggtc gtgtctgtcg    158340
     ggcgtgcagg cgtagaacgg ccccgccggg tcggtcagat tgcgcagcag agggtagaag    158400
     aagtcgcgga agtacacggc catggcggtt cctggctgca cgaccgcctc cagccaggag    158460
     cggcgcagcg accacagcac cgtcaccgcc tcggggtgct cgtaccactc cgagcaccag    158520
     cagatcgcgc cgttcgcgga gctggtggtg gagcgaggca gcttacgctg ggcccactca    158580
     ccgatattgg cgatcaccca ttccagcagc acatccatgt cgatctggtc cagatcggcc    158640
     ccggcggaga tcgcggcagg cgcggcaccg ccgtctccag cgccgctcgg ggcagccgcg    158700
     gcgggagcct caccaggggc ggcggaagcg agccggtcgg ccagaacgcc gagcgcagtc    158760
     tcgaactcgt cgagcccttg ggacgatcgg gcagcggtgg cgtcgacccg ctccaccttc    158820
     gtggacaaca gccggtgctg gttgcgcatc tcgacgagag cttcgctcag ggacgcgacc    158880
     tgattgcgca gttcttcgag ccgctcatcc ggcgattcgg tgctcacgcc gcgctcgctt    158940
     tcgcctgctc gtcgagtcgc cgccgcagcg ccttggcgac cgggttggcc gggcccaggt    159000
     gttcgatcgc ggcgttctgc acctccttgg tggcctcgtc gcggactcgt tcgacatcgc    159060
     ccttgtccgg ttcggtgtac caggggatga ggtcgatcag cactgggcgc gattcctgcc    159120
     tgatcagcag cgcgttgcgc ttcttcatcg cggcgatctc ttcaacgggc atgatcggct    159180
     ccagcgatcc acgatcgttg gaggtggtga cacctccggg accatgggag cggcgccgct    159240
     cacgaggttt gtactgtccg accagtccgg agatcttgcg caggaacggt tcatcctgca    159300
     atccggcgcc gaggatgcgc acggtggatg caccccagag ggcggccgcg tcgtccgcac    159360
     cccaggtcga gatcacctgg gcttcggact ggaaaatggc ggtgacgcac attgatttcg    159420
     acccgaggtg cgacgccaga tttggcagcc gtttgatctt gcagatgttg gcgcactcgt    159480
     cgagaacgag agtcaagggt ggatcgaccc ggccgccatg agccgaggcg gcgaggtcgc    159540
     cgagttcgaa tatcttggcg accatcgccg cgatcaccgc tccggcggag ccggaaccct    159600
     cctgggtcat caggtacagc gtcggggcct tgccgtcttc gtaggcgaac aggctccaca    159660
     agtcgagctc ggtgatcttc tccgtggtcg gctgctccca cgtgttcggc ggggtgatcc    159720
     agcgcaacgt ttcttcgtcc tggatgctgg ccagcgcggt ctgggcctca ccgaacacac    159780
     cgccacgggt ctcggcgggc aggtcgagca ccgcggcgaa ggcgttggcc gcacggcggt    159840
     ttccgtgctg gtgcaggatg tcgatcggtt tgtccgagta tgtgtcgatc caatccagca    159900
     cgtcacgcat ggtgcggccg ctcagggatg cggccagcaa cgcccaggac agcaggttct    159960
     tgccggtcgg ggcgaagaac gggtcctcgt tctgtccgga cccgccgccg cggttctcct    160020
     cgatgaagtg ctcggcgacc ttcttggcgt ctcgcagcgt ggtgatgccg gaaaggatgt    160080
     tccaccacca cgtctgggcg gcgtaggcga tctggctggg gtcgaagacg tagaccggtc    160140
     cgacgtcctt ccgcagggca ccggtcagaa tccacaggtc cggcttgttc gacgtggcga    160200
     tcactgcccc gggtgcggac agaatgcggg ggaccgcgac cgcggaggtc ttgttgctgc    160260
     gcggtcccat catcacgatg gtgaagtcct cgtaggaggc atacaccgac ttgcccttca    160320
     ggcggccgat cagcggcgcc agctcccgca tggacacgcc cttggccgac tcgatcgagg    160380
     cgcgcaggcc cacacctcgc tcagcagcct tcttcccgag catgtccggg atctgcttcc    160440
     tgtcgcgcag caacgtctcc ggcgtctcgg tcggccatgc cttccacacc acccacgcca    160500
     gcgccgcgag caaaaggcac agcagcgccc ccaccagccc gataaccagc cacgacgtac    160560
     cctgctcgtg aatgcggtag acgccgtagc agattccccc gacgaccaga accgagatcc    160620
     aaacccacgc cagcgcagag tcacccatca cgcacccctt cgcagaggac cgacactcac    160680
     cactcgcacc accagacccg cctcttgggc cgcgagcagc agctccgccc gcaacgcggc    160740
     ggccgcaccg gcactccggg tgcccggcac ctcgacgacg aagacctccc ggcgcgcggt    160800
     gagcgccgcc gcctcgagca ccggcagcgg cccgacgccg ggaagcgcac cggtctgcgc    160860
     gctcagcgcg gcgaggatca tgctgtggtc cagcggcagc atcgcttggc ggaccaccgc    160920
     ccagatcgca gcctgttccc cggccggcgt ctcgccgaag gtatccagat cagcggtcgg    160980
     accggattcc tcgttcgcgt gcagtagctg atacggctca ctgagatcac cggagtgaat    161040
     ccagtcgagc acatccgtga ggctgcggcg gccgcgcacg gccgccagca acaggttcgc    161100
     ggtcagcagc gtggcttccg ggacgaagta cagagccgcc tcatcgcgga ccacggagaa    161160
     gaggttttcg gcgatccggt cggcgtcggc ggcatcggtg atcctggcca gcagatccca    161220
     actgaaagta gttgccgggc ccggcaactc cgggttccac accaacgcct tgccccacca    161280
     ccgtcgcggc aaagccgcaa cgtggtcggt cacggtgatg accatggccg aggtagcgcc    161340
     gaccggatcg tggtcccagt cctgtgcgga gatgacgtcg cgcatcacga tcctctcccg    161400
     agtcggtcgt tcatgctgca tggctcctcc gtccgtcggg gttgagtccg gcgaaagcgc    161460
     cgtcggtgtt atagagctcg agttcttcgg gcgtcaggtc gacatgaacc ggcaggccca    161520
     tgcgggagcc agacttgatc agatacttgc cgcgacctgg gtgacgttgc ccgggaaccc    161580
     aggtcggcgg agcggaccag cgggtcacca actccttctc gccagaggtg aacgggctga    161640
     tcgcgtgcag gcgctccatt tcggcgttgt ccagcccgcc gatgactttg atcgcgttgc    161700
     gcgcgaccat gcccttggcc ttggcccggt cggcttcggt gggcagcgct tcgaggtcgg    161760
     tgatcgagtg cgtgctctgt gccgaaacca cacctcgtgc cctgttcaga cgggtcatgc    161820
     ggtcggattt ctccaccaga cccggcgccg cgcgcaatgc gcgccacagc tcgtcctggg    161880
     gctggaacac attccggcgc tccccggcgg cctgcttgcc ctcgatcagg ccggccgacc    161940
     acgcccacgc gcacatcatc gcggcggcca ccacgtcgtc accgtcatcc tcaaccgcct    162000
     tgagagacag cgagaccgcg ggcaaatcgg cgtcgatcga gaagctcgac gaacggtcga    162060
     acatgccctt gatcgggcct tcacacaaca acaccagggt gttgcgcagc tcccggatct    162120
     cgcggcggta ctcgtactcg tcgcgcgcgg cgaccacgcg ctgcaacggc gggcccgcct    162180
     catcgagaat gtgcacgagt tccgggatcg tgggatcggg gagatgatgc cgtgcgctgg    162240
     cgtcgtcggc ctggtcgaca gccatcgcca gcagcagccg ctcggtggca gtcagatcct    162300
     gcccgccgac gatggtgatc agcgactcca gcaggtccag tcgccggccg cgagcctggg    162360
     agaccagctg ttcgcggtgg ctgccgacag cggcgcgaat cgcgccgcgc agcgggccga    162420
     ggtcgagggg gttgaggctg tgcaggccgc gcccgatccg gaacaccttg ccttccagcg    162480
     cctccacgat cgggctgtac tcgtctttga tgtcgccggg gatcaccgcg gcgaagccgt    162540
     acgcgacgag gccgaccatc agccgtttgc agcaggtgga cttgcctatg ccgggctggc    162600
     cctgcaccca gaggcccgtg ttggtgacca gaccgtcgac gagccactgc gacgggtcga    162660
     gcccgatcgg ttcagcggtg tgcaggtggc ggccgaaggg gacgccccgg acgcgggcac    162720
     cggatgcggc cgggaacggg tagaggccct gaacctgggt ggtggtgccc gcatacaacc    162780
     gacccgcgtc gacgttgtgg gcgtacccgc cgaacggccg gttttcgccc cgcgcgttgg    162840
     gaatcggggg caaggactcg aagggcagga acgggttgaa cggggcctgt cccggctcgt    162900
     tctcgtcggt ctgttcctgc ttgcggtagg ccggagtgac gcccaacttc gccaaccatc    162960
     gctcggccag acctgcttgg gcccccgcac gctgccgcgc ggcggattcg gcttcggtga    163020
     tcagttcggt ggtcatgcca gccacctctg cgcggcgcta cgggagagcc cggcggtcgg    163080
     ctcgatgccg tagccgaggc ttgtcgcaaa cgcggcggcc tgtgcgccgc gtgcccgccg    163140
     gaactgcaac ttggaggcgc tgactcgatc ctcgatgtcg gcgcaggccg cggccaaggt    163200
     ttcctcgttt cgtaccgtcg tggtgatgta catcgtgaac tggcccaacc cggcgcccat    163260
     ggactcttcc tgagcggcct tgcgggcgcg gacccggtcg tcgtactcgc gctgggtctc    163320
     gtccttcttc gtcttcgcat tccagatccg gcgcagggtg ccggcctgga tctcgcgctc    163380
     gacgatctcg gcggcctggg cggcggtgta gggccggtac accagcgaga agcgccggta    163440
     gtacttacct ggactgacca gcttgagcaa gatgtggtgt cgcaccaccc cgctcggcgg    163500
     agccttgaac acccaggtca ccgagtatcc gctgtcgtgg tagtagacgt ccttggtcga    163560
     ctcggttcgc agcggccccg cgtcggacca ggacagcagc tcgtcggctt cctcgtcggg    163620
     agcgtcggag aggaacaccc ggatggcggg gtcgaacgca gcgcggatgt tgcggatgac    163680
     gctcgcggtg ctggcccgct cggtcaccgt cgccccagcc gcagccagcg cggactcgat    163740
     gcgcggcaac cagcgcacca cttcggccgc cccctccgag agggtcttcg gctgaggaga    163800
     cgccttggac aggtcgaaat tgaccgtcac ccgcatctgc acgtctgcgg tggtcgtccg    163860
     cgactggttc acgaccttct tcatgatcgt cttggccagt ttcggggcgt tccggccgtc    163920
     tcgctccatc cgcgccaggg tgtaggcacg ctggtcgacg ccgccggtgg gggaggactc    163980
     gcacgtgaac accactgagg aaatgatggg cgtgaagccc agatcggcga gccagctgcc    164040
     gtagttgcga acccaggctt cggtgtcggc cgtgtcggcc agcgttgtgc cgacagggga    164100
     caccttcagc accgcggaca ggatgccggt gcggcggttc cacagcaggc attggctgcc    164160
     gcctcggccg tcctccaccg tcaacggctt gagcggcgcc agcacaccgg ggaggttctc    164220
     gcctcggctg acctcttcga gaacgtcggc ggcgtgggcg tcgctggcgc ggcgattagc    164280
     ccaggcgttg cggacgttcc acgccacgtg ctggacgacc gtgcgccgag aatcgcccac    164340
     cgggacgatc gtcagagcca gcaccgggat ggcgatgagc aatcccatga acgcgaggac    164400
     caggctgacg aaagtggtga atgccaggcc aaccacggtg gcaaggatga tggccgttcc    164460
     gctggtcccg agtcgaccca gcccgaaccc ggtgacttcg cggtaaccgc cgtaacctcg    164520
     agtctcgctc atcgtgtgct cctaacctgt gtcgcctgcc ctgctggtgt tgtctttcgt    164580
     gttgcgtgtc gccggaaacc ggtgtcgttc atcgcatctc cggcccgagg tcgtcgccgg    164640
     tcatctccga gccgacgtca tcggcggcct ccaccgccga attggctgcc gacatccccg    164700
     cttggatcgc cagggttgcc ccgccggtgg cagcggcacc cgccgctccg gcagctgccg    164760
     atccgccacc cgccgctccg gcggctgccg ctccgcctcc tgccgcgggc ccggccgccc    164820
     caccgccggc ggcaccggcg atatcgacgc cactgcctcc ggcatcgctc ggtgtggccg    164880
     gtgtcccggc ggcgtccgga tgttcgggct gcgggccgcc ggatccggct tcgagttcga    164940
     caccggacga gccggagccg atcgccttct gcgaggcccc ggactccagc tggctctgcg    165000
     cgctcccgga tgtcagtgcc tgcgaccccc cgttgcccgg ggacggatca ggttctcccg    165060
     agccacccgg cccggtggcc gacatgaaat tggcgaaccc atcacccccg gcggacgtcc    165120
     cggcggacgt cccgcccccg cctccaccac cgccgctgag cgcagcggcg ccgagcatgc    165180
     cgcccgccaa cccgccgacc gcgaccccga gtgcgccgga gccgccggag acgtgcatgc    165240
     ccatgaagtc gaagaacttc agcatcgcgg ggagggcgat caccgccaag gcgaccacca    165300
     tcaggcccgt gaccaaggtg gtcagtgact gttcttcacc gatgagttgg aagccgagcg    165360
     agtagatgaa cgcagccatc ggtttgtaga gcaccagcgc aacgcaggtg gcggcaatgc    165420
     gggggaacca ctggcgtccc caggtggtga gctgtccggc ggcggcgaac aagatcatgt    165480
     tgtagagcac gatgattccg gcctggcgga tgaagcccat cacccactgg atgaacccga    165540
     ggatggcgcc gaccaggccg aggatcagga caccgccggg gttgccgatg gtggcggttc    165600
     ccagcattgc ctgcacgcgc tggccgaact ggttggcgtc ggtgtcgatc atctgccggg    165660
     cgaagtcgtc gccggcgtgg atcgccccgg aaaggacgat caacgccatc gacgagatga    165720
     cgacgtactt gacgccgccc agcaggactt gcgcaccggg ctcggtgcgg cgggagatca    165780
     tcatcaccat ggcgctggtg aggattccgg ccatcatgat gaagaagacg accttctgca    165840
     ccggctgttt gtcggccatc actcccgcgt aggacaggct gattgaatcg gtgccgatcc    165900
     accaggtcat cgactcgact agcagatcgc cagcgaaccg tccgatggac tccgcggcct    165960
     tgccgaatgc cgaatccacg gccttgccga cgatgttctc ggcgacggtt ccggggctca    166020
     ggtcgaaggt cctttcccgg gccccgttgt tgatctgagc ccggtacagg gtgtcgtcgt    166080
     tggggtagag gtatccggtg tccgggttgc cctcgcaccc agggaactcg gggtgttccg    166140
     agcaccagat cacaccgtcg gcgtcgcgcc agctcttttg ttcggcggtc agttcagaca    166200
     gcttctgcgg catgttcgcc gacggttgcg ccgcgacgat tcccggtccg gcgaccagtg    166260
     ccgccagcag cacgccgaga aacaccatcg gccgcagcac cgctcgcgca cctgcgcgcg    166320
     cacccggaac cgtcatggtg gactcctctc ctagaaggtc gtgaaccctt tcaggcccgt    166380
     ggaattcgga agttcaggaa ggccggaatc gacctggtac acccagtcgt tgccatccca    166440
     gagcacagcg cggcgctgga agtcgtagcc gcccttgttc gaggggacgg cgaagtagat    166500
     acgcgcgaaa gtcggtgtgt aagtggcgaa ctggaaagcg acgggctgac ggaacgccgc    166560
     gtcgaactcc tccggagaca ggttgcgggt ctgggtcact gcgttgcgaa cctgctgctg    166620
     ctggccgagg tcggcgcgca cctgggtgcc gagcagttgt tcgtatcggg tgtcggtcag    166680
     cactcgcgtg gagatctgcc aggcggcgat gagcgcgccc tgtggcgtgt ggctgtagcc    166740
     gtgggcccgg gggccatcga cttcggcggg cccgtcggga ccgaacggca gtcgtactcc    166800
     gttgatcagc ttccactcca gatcgcgtgg cggtgtcgcc gtggcgacgg caccgggctc    166860
     ggccggagtc gcggagttgt ccgagcggtc gcgaacgacg gctaccagga cgattccgac    166920
     agccacgacc aacacggcgg ccgcggccac gagcagccag cgtcgcgacg gtcgggggcc    166980
     ctggcttgcg gggcgttcgg cgaattcccg ggtggtgaac attgacgttt ctccttcgct    167040
     acagcggggt gaatccggtc aggtctgccg tttccggcag cgccggggcg atcagatcac    167100
     tgctgtagcg ccaatcgcca tcgcgccaca ccaccgcttg cctggcgatc cggtaggaac    167160
     cggagggccg ggggtaggcg taatagacgg tggcggcatc gccggtgtag gcaccgatct    167220
     tgaatccggc gggttgcacg gtgcttgcct gcaccgcgac cgggtccagc cggggctggg    167280
     tggaccgggc agtgaggatt tgctgtcgat ctccatccga gatcgcggcc tgggcgtcga    167340
     gtatgcgcgc gtagtccggc gagtacagga ttcgcatgct gatctggagc gctgcgatgg    167400
     ccgcgccctg gggggtgtgg ctatagccgg ccgcgaccgc cccgtcgatg cggctcggtc    167460
     cgtcggaggc gctgaacggc aggggaacac cctccacccg ctgccaggac accccttgcg    167520
     gtgcggcggt cagccagtcc gggtcggcgg ggctgcggct gaccggcacc tgggggacca    167580
     gtgatccctt cgcaggggtc gtcggggcgg cggctgcgct gctactggtt ccggggccgg    167640
     tggcgaggtc ctgtccgccg gagccggagt cggggccgat cagcgcgatc ccggtgacga    167700
     gtaccagcgc cgctgcggcg gcagcgccga tcagatacgg acggcgaaca cccgccaggg    167760
     gagtcttctc tcgaaactcg cgcgtagtca gtggcattgt ggctcaacct ctttcacagg    167820
     aagacgtgga tgacggtgta tgccgacccg gacagcacgg tggcgccgag cacgacgggt    167880
     agcgaatgca gcgccttctt cgcctgttcg gaccgccccc ggatgccgat catcagcacc    167940
     ccggcggtga tcagcactcc gccgacggcg caagcgagtg cgagcgtgcg cagccagccg    168000
     agcgcgtcgg cgatgaagga gtccagattt tcgggggcgt tcgcgggatc tccaccgaat    168060
     ttgtcccatt gcacgccacc ggttttgggg tcctggatgg gtatttgctc cccgctgccg    168120
     ccaccgccgg gactctgggg gctgagctgc tggctggggg tgggggccgg ggtggtcgtc    168180
     ggcggctgtg cgtgcacggc tccggccccc gccacggtca ataccgtggc gagcacgaac    168240
     gcccaggctg cctgtttcat tggaacgcct ggataattcc gcccgcgccg ccggtgatga    168300
     cgacgcccaa gatgaccatc ggcaggtgcc cgagggcgtt cttggcggtg tcgctccgcc    168360
     cgcgcaaccc gacgaacagc atccccgcta cggcgagaag cccgccgaac gccagggcgt    168420
     agcagatggt cttggcgtag ccgaggacat cgttgacgcg attacccagc tcgcccggca    168480
     gttccttggc gggcgggttg gggacttggg ccagccagtc ggcggccagt agcagtgtgg    168540
     acattggctt ttccttcctc gtgatctggt taggacaccc gcatgacggg gcgctcgtcg    168600
     ttgggccgca gctcggagct gctgtcggcg gtcgggggtt cgcgctcgat gagggcgagt    168660
     acggcgggga ccagttcctc tcggaacttg cgggccggtt cggcccagcg gtaggtcttg    168720
     cggtcggcgt cgaacacgcc ggtggccagc aggtcccatg ggttgtcgct cgcggcgagc    168780
     ggcgagaacc acggcagtcg aagcaccggg gtcgacaagt tggccgccgc catcttcagc    168840
     cgtcgctcca ccaccgatgg ccaccgtgct tcgctgcccg cgaccacgac cagaacggga    168900
     cgcacaggca tccgctgggc ggtagcgatc gcccagctca ctgcggccgc ggtcgcgcgt    168960
     gtcaccagta cgtcgacgca ctggcttccg ttggcctcga tgacacccat atcgatgccg    169020
     tcgagcagat gcgcgactgt cgtcgtgccg acgccaccgg cgatcccgcc caccaccgga    169080
     cgccgtgggg ccgcgctcat cgcgaaccca cctgagacac gcgccattca gcgcctacct    169140
     tgaccagtgc gatgccgacc accaagtgcc ggtccggcat cggccctgtc ggggtgttca    169200
     ccttctgggt gacctcgagg agccgcaccg ctgaagttgc cgtgtccgcg ggggctccgg    169260
     cctctacgcc cggacgaacc ccgtcggcgg ggacggtcag gacggcggag cgggccgtca    169320
     aatccagcca gtcggcgccg gggcctgcga tcggcggata gtcgcgaagc agttgggcga    169380
     gtcggggctc caatagcggc accgcgcgga gcttcgcgtc gtgttgagtc aggtcccgag    169440
     tggtgtccca cccgtaccag attcgcgcca ccgcggccgc gacagcgtcg acactggcct    169500
     ggtcgaccgg gccgatctcc gccggaaggg ccgccggggc ggtcagcggc gtcgacggcg    169560
     gtgtggcggg aacgcgcgag gtcgtctcgg tgggcgttac gaaggaggtt gtcgacgcgg    169620
     gcggcgtggt ggtctgttca tggtcggagc caccggacga gcacccggcg acaaccagcg    169680
     cagcgccggc cagcacggca gccgatgcag tccaactgaa ctttggcgtc attgtttctg    169740
     gattcctact catccgaacc gcctaatttc gattcccgat cccaaattcg acaagggcga    169800
     gatcttcacg acgtcgcccg attggggggc ctcaaccatt tttccgtcac caattgcaat    169860
     tccgacgtgc tgcgggtctc cgccgcctgg aaaaacgatg tcccccggct gtatatcgcc    169920
     gagtgccacc tctcggcccc gagggtcatt gaggatgctt gtggtgtagt gggggagctg    169980
     gattgttttt ccgctggctt gcccgaccgc gtacaccacc agtccggagc agtcgaaccc    170040
     gactttccca tagtcgccgt gggagtcggc aacgccaccg tctcgaattc ccagcgacgg    170100
     gccgtcgata ttgccgccgc cccaggcgta gggagttccc tgccagcaca acgccgcagc    170160
     ggcgacattc gcaccgaaac cacccccggg gcggaactgg ctgcaattgg ccacccgccc    170220
     gccgccggtg ccgatctggg tgtacttggc catcttggcc ttgactcccg gggcgtaacc    170280
     ctccgtttca ccgttgacga tctgagggcc gccattggcc aaaacgcagc cgtagccaca    170340
     gttgtaggca ttgaggacga tgtcgatcag atcacccttg atgcgcccgc tggccaggtc    170400
     cttcttcgcc tgctcgacgg tggtgcagtc gaacttcgcc tgcgccatga tggcgtccgg    170460
     ggggtcgaag ggggagatca caccattgcc gttggcgtcg acgccgtaac tcggccaggt    170520
     atagggcatg aactgactga gcccttgcgc accggccgga gagacggcat tgggattcca    170580
     gttcgattcc tgctcgatct gcgcagcgat gagtggggcc gagatctcct cgcacatggt    170640
     gccggcccgg atgacccacg cctcgtactc gggcggaaca gttccggtcg ccagctttcc    170700
     ctgcgcgaaa ctggggttgt ctttgtctcc atcgacgaag accgcgacga tcaacaccgg    170760
     aattaagagc aacgccaagg cgagcgctgc ccatttcaat ggtgatttca tcgcggtcac    170820
     acctccccag atgtgtgtat ttaatgctca tatccaccgt ggttcggtgg cactgtgttt    170880
     atccggcggt gagttctgag agaactctgt cgagtggcga ctgtccgctg gtgcccggcg    170940
     ctcccatacc gggcgccagc ggaaaggtca ccggatcaca aaccggcctg aattttggag    171000
     gtcagccatt tcacgatcca ttgagtggcc gtgtcgccac ttgcgttgac cttgtagtta    171060
     ccggcgtagg atcggtgcgc gtccagcaac aggtacgaga ccgcctgcga agcctgctga    171120
     atgagctcgt cgggcttggt caagctgacc agcgcgtcga actccggcat gttgatgacc    171180
     ttggagacgt catcgagcat cgtggatgag aacaccatct cggccagcgc gatcggcagg    171240
     gtctgcggcg aggtagccgc tgccacaccg agtttcgtga actcggtgat taccgacttc    171300
     gcggcctgcg cgatcacctg cgggtcggcc tcggcgacgt tcttcaccag ctcgaggccc    171360
     cggccgatca agtagtcggg cagatcctcg ggcgtgaggt tcagaagcgg gacaaccgcc    171420
     gcgacgacct tggacttgcc cgacagcgag cacaccgtgt cgttgggcgc acacattgtg    171480
     gtcactcgct cggcgagcac acccattccg ccctcgcgct cgccgagaac gccttcaccg    171540
     ccggggttgg agccgatcaa ggtctccgag accgaggaga gcttcgtact cgacgagccg    171600
     cttgaggtgc cggtgctgcc ggcgaagtcc gactccgcgg tggccgagcg cttcgggtcc    171660
     gacagcaggg caccggccag gatacgcgac ggatcgaccg ctcccttgcg gttgcccaca    171720
     gccgacagga aatctccggc gatcagcgcg ccctgcgagt agcccaggat gacgaacttc    171780
     gacaacgggc acgcggcggc cagttccttg gctcgggtgt tcagcgccga cgccccgttc    171840
     tcgcgggact ggctcagcgt gagcgggttt ccggtgaaca tgcccgcgat cggcccgccg    171900
     acctgagcaa cgtaaggaac ctgctcagcg cgcaccgacg ccgtcgcggg cttctgcgcg    171960
     gtggcagagg ggcgcggtgt tgcggacttc gccgccgacg tcgccgccga cgtcgtcgcc    172020
     ggggtcgatc ccgacagcgt cggcggagcc gaattcaatg ctgcgagaag cgggcccgta    172080
     acctggccga gcattcccgg cacgacgtta cgatccgctc ccgcactggt ctcccacgtc    172140
     ccagggacgg cgagggtgat cacatcggcg cagtccgtta cagcgggact ggcgccgggg    172200
     tcggccgatg cgaccgacgg ggcgatgcag gtcagcgacg ccgctatcac cagcgagccg    172260
     gctacccgcc ctccgatcat cgcggcggac atcaccgcac cagcccttgc actgccgcca    172320
     acgcaccatt ggccgcatcg gtcaggggtc cgagctggtc aggcgtgaac gcaggctgct    172380
     cggtgaccgc ctccacgacc gcatcggcca ccgcagccgt ctccggtgcg gcctgtgcgg    172440
     cagccacgac atcctgtgcg acctgctcga caacgccgac ggcctgagtg acggtgggct    172500
     cgctctgagc ccactggtcg acctgatcga cgaccgcggc ggcctgctcg agcacctgct    172560
     caccgccggg ctgctcctga acccaatcga cagcctgctc accggcatct accgcaacgg    172620
     cggcctgctc actgaactgg tcggccaagg tcgggccggg cgggggcacc tcgcgctcct    172680
     ccatgggaat ctcgccgtcg ggggccggac cggtgtattc ggagccgtca tcggcgagca    172740
     gcacgaaccc gaccaggccg ccgatcgctc cgcccgcgac accaccagcg atcgcagccg    172800
     ggatgccgac gatcgcggca ccggcggccg cgccagcggc ggcgccgatc gcggttccgg    172860
     cgacaccgct ggtgacagtg ccgatcacgg gcacggggat gagcgtgccc atcgcggcac    172920
     cggcgatgcc gccgatcgtg ccgccgatca gaccaccggc gatgccgcca aagaccgcag    172980
     cgggaacgcc gatgactgtg gcaccgatgc acgttccggc cgctgccccg atcaccgtgc    173040
     ctccggcgag tgcatcggcg cgcgaggggg cgattccgac cgactgcaac gccgtgttgg    173100
     tggcctgctg ggcttcgctg atgtaggcgt tggccttcca cgccacatcg atcggcaccc    173160
     agtcaggcgt agggatggac gctcgcttcg agccgattct ttccggcccg accggcaccc    173220
     agtacttcgg cttctcgggc accggggccg gggcgtgcag ggtcagcagt tcctcgccca    173280
     ggctcggctc gggcgcgggg gcacggtact gcggggtcgg ctcgacgtag tagtaggtct    173340
     gcggagccgg ggtactcggg gccggagtgt cgtagtacgg accgacctgg acaccaccac    173400
     tgggcggcgc cgtctcgtac tcgctgggag cgtgcgaggg tgggtcgggc aggattacgc    173460
     ccaacggact ctgggactgt ggcttgggcg ggagcacggg agcggtcgac accccgggct    173520
     gttcctgcgg ttcggccggg ccggtgattc ccggctgccc cgacggggcc gcctgtgcca    173580
     caccgcaagc ggtcatcagg accgcggtgg cgacagccgg ggcgaccgcc acgcggatga    173640
     ggtcggttcg gattccggtg gagcggcggt gagcggccga tcgaggtgtc ccgacacggc    173700
     gggagccgct gtaagggatc ggcgtttccg ccttatcgct gcacgcgctt gcggcagcag    173760
     gacctagtgt tgtcattgca gagccttcct tgagtttctg cacctgctcc ggggcggttg    173820
     cacccgaatc ccggagttct ctgggccttc cccccgttgc accgggggga aggttccttc    173880
     acttcgtgac actgagggcc tcggctgtgg ttgcacccac accctcgggg ctcagcgcca    173940
     cacgctcaga cgctccctat cgcgccacct tcctgggatg atacgttatt cccatacgat    174000
     acttgcatac gttgcgagac ttctctaggg ggtgcggcaa ggtgttccct gatggaccac    174060
     cgaccccggc gcgcgcaatg acgcgacgca tcacgcgcgg attcgacccc gcggcgctca    174120
     agcgcgcccg cgaggagcat ccgaacgagg atctccgccg ccgggccgag gttgcgcggc    174180
     tggccggtgt gggcgtcgcc acaatccagc agtgggaggc tggaaagaaa tccccccagg    174240
     tcaatctgct gttccgggtc gccgccgtac tcggcgttcc gatggagcag ctcgtcccga    174300
     ttccgcgtga gcagcgctat ctgcgtgact ggcgcgtcct gcgcggcatg ctggaatcgg    174360
     acctggctgc ccgtaccgga atcagcggtt cgtcgatagg gcgcctggaa gaaggctcgg    174420
     ccgccctgac cgacgaaaac gccaaccgcc tcgccgaagc cttgggtatc accgccaccg    174480
     aggtgcgtgc cgcctacgac cgggcccgca accgtgctgt cggcgcgcct gcctgaattt    174540
     ctaccccgca ccaggctcgg cctgctcggc accgtgaacc cccttgcttc gggctctgcc    174600
     ggaacgctga gcggctccag caggcgggat cgtgcactcc actcctgttt cgtgagatca    174660
     cacacccccg gagcgtactt actctgcgtg ctgcctgcaa gcacttttca ctacgaaatc    174720
     actaacatat tgccctttcg ggctgaactg ccctggttgg gtgctgactt gtcgtgaaca    174780
     tttgactaca ctcttgctat gccctccgga catccagagt tcttcgggga agtcgtcaag    174840
     gctcgccgtg agtacctcag cctcaccatg gccgaggtgc gcgccgccgg cggtcctgcg    174900
     cagacgacaa tggtccggac ggagcgtgga gagctaggca aaccgcagaa aaagatcttc    174960
     gcgaagttcg acacggcgct gcgctgggtg cctgggtccg ccgcggccgc ctactggaat    175020
     cgggaaacgc cggtcccact cgaacttgag cagccagctg ccccgccctt gaacctggcg    175080
     ggctccgacg tcgaggttcc tctcgaccag gtcatcgcgc tgatggaatt acagcgtgat    175140
     ctcaacgccg ccgcggaagc gcggcgggaa ttgagtgccg actccgtcca ggatctcgcc    175200
     acacgcctca acagggaggt cagcctgatc gttggccgct gggccaccac tatgctggaa    175260
     cgtaaccgtg gcacggaagc ggtgcatccc gggctcgaag tgatcttcgc cgatgcactg    175320
     tccactccgg tcgaccccgg cactccggac gccgaagagc gtttgtatcg gcgctggttg    175380
     ctcggtggcc gctcggctgc tggcctcggg gaggagctac gccagaagtt cgagcggcgc    175440
     tatcggcagg gaggaggtga tctggatgca gaccaatgac gggtctttac cgccgctcag    175500
     cgcgcgcgtg acccgacttt tcgctacctt ccatgcccgc tccgcacccg aacagtccgt    175560
     cgacgacgtg gcacggtcgg tcagtgcgat gttgggcagg atcgtccccg gcgctgagat    175620
     caccgcgctg cgggcgggcg aatacgaccg cgactccgcc gatcctcaga tccttgccgc    175680
     tctcgcgaaa cacttcggtg tccctccggc ctacctggcc ggagcggacg ccaacgtcgt    175740
     gcgccaggtg gaaaaggaac tgctgatgct cgcagccacc cgcgatgccg gagtgcgaag    175800
     cctgcgcttg cgcggcaaga aagtcgacat cggcgaactc gccaaccacc tcaaacgact    175860
     ggccaaacgg cggtctgact cgccggacga ggcggcaact cgcgacgtac ccgatacgtc    175920
     tgacctgggg gaatagactc gagcgaaggt aggagatgac cgtagtgaga ggggagggcg    175980
     tggtgaacaa aatgaccacg cggttcgcag agctgagcaa actcgtgccg atcccatacc    176040
     cctgggatac tcgcgagtac attgcgcggg tagccgaata ccgcggccgg ccaatcgaat    176100
     tggtccctat cgcccccggt gccctctccg ggaccggctg cggaaccggc agcgcattgt    176160
     ggctggagct cgacgactcc gacgtgatca tgtacggcgc ggacaccgag tggcacgccg    176220
     accacatgat cgctcacgag atcggtcata tactcctcgg ccacggcagc accgggggag    176280
     aacccgctcc cgctgacgat cttccgctcc acgaactcat gccgtcgctg tcacctgatg    176340
     cgatccgcaa cgtcctgcgc cgacaggact acgacagcga cagggaacgc gacgcggaga    176400
     ccttcgccga tatggtgatg gtcgaagcga ctctgcccca acggaaaccg agccggttcc    176460
     ggtcaacctt cttccgagca cggcaccgat gacctccccg atccccggcg tcatcgcctg    176520
     gccggtgctg ctcctgctca ccgcggtcat ccttgggcgc tactggctgc tacgagacgg    176580
     cactgtggac aagctcatca accgcgcgct ggtcattgca ctcttcgggc tgctgctgcg    176640
     ggaagcatgg ttcgagcact tgctgatcgc gatcctgccg ttcgacgatg ccgacgtcgt    176700
     tcacttcgca cgccagattt ccttcggctg catcctgttc accgtctcgt acatctacgg    176760
     tatcgctcaa ctctgggcag gagccgaccc ggaatacacc tggcagcggc aacgtcgcta    176820
     cgacctcgtt gccctggtgt cgaccatcac catcctgatt gccggcactc cggcccgccg    176880
     cgccgatcaa ctgatcgacc agcatatggg cgcaggggcc gtcatcgcct gggttgcgtt    176940
     ctatctcccg atcgcggcca ccgccctgct cgttgccaga atcagcatcc gcgagttgcg    177000
     cggcgccgat gagaacacct cgtggcgaga gcgcagcgta tacctcggtg tcctggccat    177060
     cgcgatcgca atcggtgcgg actcggtctt cgtccctgtc gtaacggccc tcgaagtctc    177120
     agccgatcgc ccttcggcag accccgacat ggaggcgaag gcttggacct tcttcggcgc    177180
     caccgtcgca gcaggcgccg tcgtagcagt accgctgatc ggcacggttc tctccctttc    177240
     cgggtgggac cggacaagtc gctactgccg caggctgaaa ccgctgtggc gcgacctcac    177300
     cgcggccgtg ccggagatcg ttctcgctct gccacaggat cgattcggcc gagtcgaacc    177360
     ggccacccgg ctgcaccgaa tgacggtgga gatccgcgac agcttgctcc aactcaaacg    177420
     ctacggagcc gtcgacgaac ccgggcaagg cgccgacgta tacgcacgcc gcgtcgccgc    177480
     ggctatcgca gccaagaacg ctggcgtggc cccccagatc agcaaagcgc ctgccgggcg    177540
     ccctgcattc gtcggggcac gcgacctcac cgcagagctg caacagctgc tcgacctcgc    177600
     cgccgcctgg cccaccgcca agcggcaggc cggccgaacc gagtcgccgg acacggcact    177660
     gacccagtag gagttccaat ggcagtgaca acttccacca cctcgggtgg ccactccaat    177720
     ccgccgttgc cccacccgaa atggcggctg ccgatcatca acgacctact caccatcaac    177780
     cccatcaagc ccaccctcac ttcgctgcgg gacgccgagc aactcggcgg catcttcgaa    177840
     cggcgcctcg tcgactggcc catgatcgtc gtctccgact ccgaactcat caccgagatc    177900
     tgcgacgagc gcaactgggc caaacacctc ggcgtcccgc tccggaagat gcgccacatc    177960
     gctcgtgacg gcctgttcac cgcccgcaac gatgaaccga actgggccaa agcccacgct    178020
     gtcctcgcgc cagccttcac caaggaggcg atgcgctcct accaccagac catgctcacc    178080
     acgatcggcg aactcctcga ttactgggcg aagcgcgatg gccagtgggt cgacgtcggc    178140
     gaggacatga acaaactcac cctcgagatc atcgcccgaa ccggattcga ctacaccttc    178200
     gacagcttca cacgcagcga ggtacacccc tttgtcgccg ccatgctgcg cggactgacc    178260
     tacatctccc gcaacagcaa catgccgccc ttcttgcaga agaccatcgg cgcccgcgcg    178320
     gccgcacggc atagccgcga catcacctac gtccgaacgg tcgtcgacga cgtcatcaaa    178380
     gcccgccaag ccagcggcac cgtaggcgac caccacgacc tgctcgaccg gatgctcacc    178440
     gtgcccgacc cggcttccga cgagctcctc gacaccacga atgtccgcag ccagatcctc    178500
     accatgctcg tcgcgggcca cgaaaccagc gcgggagtcc tcgctttcgc gctctacgag    178560
     ctcagccgcc gccctgaact cgtcgctgcc gcccgcgccg agatcgagac acgcttcgcc    178620
     gacggcgacc tatccacaat cgcctacgac gacgtggcga aacttcgaac cctacgccga    178680
     atcgtcgacg aaacgttgcg cctctacccg gtcgcgcccg gcttcttccg tgaagcccgg    178740
     cacgagacca cgattggcgg cgggcgctac cggttcgggc ccggcgactg ggtactcgtg    178800
     ctcacactgc acgcccaccg cgaccccgcc acgtggggcc ccgacgccgg cgagttccag    178860
     cccgaccgct ggctgcccga acgaatgcgc tctctggacg gacgtcaggt attcaagccg    178920
     ttcggcaccg ggcttcgcgc ctgcatcggt cgccaattcg cctaccacga gatcgttctc    178980
     gcgctggcgc acatcctgca cacattcgag ttcacccccg atccagggta cgaactcgac    179040
     atcgctgagc agatcaccct caagccgcac cggttcaggc tgcgactcaa ccaccgctga    179100
     tcggcgggat cgcctggccg accgcgcggc gtagccgacg gctgccgacg cggaatgatg    179160
     attaatcggg agctcggccg cgcggccaac gatatcgggc aggatcggca gcgtgaccga    179220
     tatcgcggcc gccgacgagc gcgcaatctt ggaccagtta cgcagggcgc aggacgctca    179280
     ccacgggtgc gatcagccca ccgcgagcgc gttgatagac gcgctcgacg ccgattcgaa    179340
     tacgtagtga cgaacaccgc ggtcgcggtg cgcgcggccg cgcgccggtc cgcgaccgtc    179400
     agggcctcgc tctgcgcggc cagcgtcgcc gtgtcgccgc gttcggcgac ggtcagcgcc    179460
     aaccgccgaa tccgatcggc accgggctat caacgctgtc gagatcggcc aagtccaccg    179520
     gaagtcccgg gcgtgccggt gagccttcca cgccacgatc agcgtcgcgg tttcctcgcg    179580
     gtgaacaatg tgacatcccc tacctcgctg agactcacct cggtgaaggc gcttctcagc    179640
     gccttctcca gcccgccccg gtcgtccgct gcgttgttga acgccccgac ctgcgtgtag    179700
     atcgcggtca acacccggcc gaacagcgtg ctgggcttcc ggttgaggat ggtcgatccg    179760
     aacagcacgc cgtcgtcggc gagcacctgg gcgagatgag cgaacgccac gcctttctca    179820
     ccgaaatcgc ccggtaggca gtgaagaacg aagttgatcc cgatcgagtc gaacccaacc    179880
     ccagcgcttt cgggcacggg gtctagaacg cttgctgcga cggtacgcac ctcgcaggtc    179940
     ctaccctcca gccgacggcg agtatgcgcc agaggctccg ggttcaggtc catcagcgtg    180000
     acggcggact ccgggggcag ctcggcgttg gccaggtacc acccggaacc cgggcctacc    180060
     tcgaggtgct tccggccgat gaaccggttg tactggtcca gcatgacctc tgccgggcat    180120
     tgccaggcga accggtccga cagcttgatg acccacaagt cgtagaccgc caagaacgcg    180180
     ggcgtatacg gctctgcggc gatacgggcg gcatccttgc ttgccatcgg tcctcccagc    180240
     tcaaggaacg ggttcatcgt ctggaaccct cacacgccag ctgaccgtgc tggcgaagtc    180300
     cgggcccagg atctcacaca cccctggcac tcggcgcagg atcgcattgc cgcgcacccg    180360
     gaagaggtca ttgtgcgtta atgtatctaa agagtctata ggcatcagcg aggagggagg    180420
     ccgctatcga agtggaggct ctggcacacc aacgaccgtg gccagcagcg attcatcttg    180480
     gttaaccgaa atcagcgtgt cgcgcgcttc ggcgcaactc tccatgcaag gatgtcgcac    180540
     atggctggag taaagcgcct gtcgtactca cgaaagacgt acggcttcaa gctgcatgag    180600
     aacgtcgaca aactgatcga cgagttggcc gccgccgaaa ctggaggcga ccggagcagg    180660
     ttgctgacgt tgttggtgtg cgagaggcgt ggtgtcccag tcgacgagat cctcgttccc    180720
     gatgaggacg gccaggagtc actactcgaa ggcaccacga aacaggaggt cacaaggaag    180780
     cgccgacagt cggtcgcata gtccggggcc agctcacgcc ggcacgccct gacgaccagc    180840
     cgagaccaaa gaccacaaac cgaacaatcg accgggttaa ccacatggac gggagccctc    180900
     agccacgcct agccgagagc tcccggttcg tccatggggg atgagcattc gccttctcat    180960
     ctccacggtg taccccctca gcaacgaaag gccatccctt gctgaaggaa tccagggtcg    181020
     aggataccgc acgcccgaaa tccggttcaa ccgaaaccgc ggagtgtgtc gaaaactcac    181080
     cctcctcaaa cccaagcggc ggcccaccag ggcccccatc acagctcaaa ttgcgcgagt    181140
     tggaccgtgt cctctactcc ggtccctacg ttctcatcga cgtcgacaac cattcgccgc    181200
     gccggacccg gtctctcgac agggcgtatg ccgcgatcga caccggcgag gtcgccacgg    181260
     ctggtgggac tctccggccc ggtaacgtcg gcgcagacat cgaccccctc ccagagcatg    181320
     ctgtgctcgg tgacgccgtc gccgaggtac tcgtcgggtg gctccacgat cagggcatct    181380
     cctacatcgc acgtgagtcc ggccggcccg gaggtcggca cgttgtaggc gtcggcgcat    181440
     cgccggacca gatggaggaa tggaaccgcc tgtgcgccga taccgcgcag gcgttcggtg    181500
     ttccggtcga cgaccgctcc ggcggcgtgc tgagactgct cgccgccccg catcgcaagg    181560
     gttacgccgc acctgtcctc ggcggaacgc tgacgctgaa cgccctcgcc gtgaggacgc    181620
     ggcccagccg ggtccgcagc gctcgcccgg cgcgccggcg gccttcacct agctctcgcc    181680
     ccgcgcctac cagtcccgac acctcccgct ccgcgcggga gtacgggcaa gtctgcgcca    181740
     tgatccgccg tggatgcacc cctgctgagg cgtggcgggt ccagaaccgc cccgggagca    181800
     aggcttccga acgcggagag caccgctggc ggcgcttcgt ctggctcgat gcccacacca    181860
     ctgtgtgcgc cgaggaaggg cttacgccgg agcaagcgtg gcagcgtgtc agcgcggcca    181920
     gcccggccgt gtgccgcaag atcgggcggc gcgcgtggca gcgcctctgg gagcgtgcgg    181980
     tcgatcaggc gggcgtccag cggccgcgcc ggcgccgtct gccgcccgcg tccgaccctc    182040
     tgaacaagtc gacgggagag gacaacgcgc ggatcgccgc tgtcgcagcg ggcctcaaag    182100
     cagcactcga tgcgacagat ctgggcgtgc gccgccaacg acggaggaac tgcgagatcc    182160
     tgctgctgaa cctggctcca gtgctcgtcc ggcgcgaggg ctcgatctcg gtgcgggaca    182220
     tcgctcttcg tgcaggcatc gacgtgaaaa cgttccgcgc atgccgcgat ctactcatcg    182280
     ctcacggact tctcgtgacg gcgcatcact acgcaggcgg tgcgtcggat agccatgctt    182340
     acgcgatggg accagcggct cgtcctcacg ttgaagacgc agtttcgaaa atttccccca    182400
     cttgtccgaa ggacaccccc ctccccctac ctccctccgg ccgcgcggac cgcacactcc    182460
     tccgcacccg cttccgccgt gaacgccacc aatggcgaac tcgctgcgca gccctagacg    182520
     acctaccccc tggtgagtcc ttggctagca gctcgtcacc tgcgatgaag gcgtaccgct    182580
     cgttgcgcta ccagcagcga tggtggcgca acctgtcgtg cgacgagcag gaggcacgcc    182640
     ggactgcgag gcgcgcgacg ctcgagacgc tggcccccag cgctcgttcg gcctggttcg    182700
     cctggttgga tcggcggaat agcctgatgg ccgtagtgga ccgagccgcc gccggaccct    182760
     tcacctcgac cgaccgatcc gtcctggctg ctgcacctcg aactgtgcac atggggctgc    182820
     aagaccccag ctggcagccg ggcagccgtg ggagcgggca gctcgtcttg gctgcttagg    182880
     ccggatgccg atcgtgcggc gcgcgtaacg ccaggtggac gccccgagta gcttggaagt    182940
     ctggagccgg ggatgccttg agcgctggtg gcttgtgacg gagatggaca tggctaggac    183000
     ggcgacctga tcgtcgacgc ggtccagcgg gctggggcgt cccggtgtcg gctctgctag    183060
     ttggccgtgt cgaggtaatc accgcgtgag caaggaggca aggtgactgg attagtccga    183120
     gcagcgccgg ccgactcgcg cctcgacccg atgcggcagg acaaacggtt cgaggacagc    183180
     cacgagtgag aacttcccac acaacgccag agttgtctcg ggttgtggaa caggtcggtg    183240
     tctgcggaaa cttcccacac agcgaacacc gggtaaacca cggtttaccc gagaccggat    183300
     tgagtccgcc ggtggcgtca ccggaccgag gggccaccac cggtgaagcg gctttgtcag    183360
     gtgtggaaag ttcccacact gccgcaattc tgaaacgtcc gttttagcag tgcggccagg    183420
     ccgcgcggcg cacaggccgg tagccgagac gttcgccggg ctcttccggg tcgaccaccg    183480
     acgcctgaga gacgctcgcc agtccgtcac agtgacgaaa tgggttggag taagaccgac    183540
     ggcgggcaga cgcagtcttt cggtccaact tcaggtttgg ttcggggggg cttcaggcat    183600
     tcgtccgtgc tcgtcaggtc gcggcacgcc ggccgaatcg agccaggcgt tgacggcatc    183660
     gtctactgtc ttggagatga cgtagccgcg cttcttgatc cactcgagac gagcgatcgt    183720
     cgaagcatgg agctgcgtcc cgaactgctt tttgccgacg ccttttcgaa ccggcagctc    183780
     cacggccgcg gctactgggg aatctccgct ggtaggtgta ctgcgcgaag cgttcacggg    183840
     aactcctcca atgaagatgg accatcgggt tcttcggtgc ggtttcggcg aatcgccgcc    183900
     gtagccgttg acactagaaa actatcttat atcctctctt acagtcgcag ttaccaccgc    183960
     ggcgattctc aaacccaaat ccgaagtagc ccacaagatg tgggcgaagt acacggaggt    184020
     agaacc                                                               184026
//