Dbfetch

ID   AP005645; SV 1; linear; genomic DNA; STD; PRO; 94287 BP.
XX
AC   AP005645;
XX
PR   Project:PRJNA189;
XX
DT   08-APR-2003 (Rel. 75, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 10)
XX
DE   Streptomyces avermitilis MA-4680 = NBRC 14893 plasmid SAP1 DNA, complete
DE   sequence.
XX
KW   .
XX
OS   Streptomyces avermitilis MA-4680 = NBRC 14893
OC   Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
OC   Streptomyces.
OG   Plasmid SAP1
XX
RN   [1]
RP   1-94287
RA   Ikeda H., Ishikawa J.;
RT   ;
RL   Submitted (15-AUG-2002) to the INSDC.
RL   Contact:Haruo Ikeda Kitasato University, Kitasato Institute for Life
RL   Sciences; 1-15-1 Kitasato, Sagamihara, Kanagawa 228-8555, Japan
XX
RN   [2]
RX   DOI; 10.1038/nbt820.
RX   PUBMED; 12692562.
RA   Ikeda H., Ishikawa J., Hanamoto A., Shinose M., Kikuchi H., Shiba T.,
RA   Sakaki Y., Hattori M., Omura S.;
RT   "Complete genome sequence and comparative analysis of the industrial
RT   microorganism Streptomyces avermitilis";
RL   Nat. Biotechnol. 21(5):526-531(2003).
XX
DR   MD5; 92547c0099e7c122972a607f4efb24ea.
DR   BioSample; SAMD00061088.
DR   EuropePMC; PMC4807529; 26826232.
DR   StrainInfo; 181026; 1.
DR   PubMed; 11572948.
DR   PubMed; 12692562.
DR   PubMed; 23990133.
XX
CC   Our web site
CC   URL:http://avermitilis.ls.kitasato-u.ac.jp
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..94287
FT                   /organism="Streptomyces avermitilis MA-4680 = NBRC 14893"
FT                   /plasmid="SAP1"
FT                   /strain="MA-4680"
FT                   /mol_type="genomic DNA"
FT                   /note="linear plasmid"
FT                   /db_xref="taxon:227882"
FT   repeat_region   1..71
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="left terminal inverted repeat"
FT                   /note="perfect repeat"
FT   CDS             complement(478..756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p97"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p97"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146FBW5"
FT                   /protein_id="BAU68544.1"
FT                   /translation="MWGRPLWLSSLRVRHRARVRVVDSSSGSESRVVPAVTLTSEEARP
FT                   VPVGGSATRPRGPFGSGTSAPRNSSFPISEVPFCGSGPQLPNSLFLG"
FT   CDS             1197..1904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p01"
FT                   /old_locus_tag="SAP1_1"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p01"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75285"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH9"
FT                   /protein_id="BAC75285.1"
FT                   /translation="MLPLPGPTDLEERTPAMTAQPQQQPRRRPASPGAPPPPPPSAFRA
FT                   PGALRRTNVVNLPDGYRASVEPPVTSDGFLGEDFVMDSQEFLCWLSDYYRDDIVTLRLI
FT                   IRMMGIQKPGGTVEATQSKLAGLLKVKQSQISRSLKDTGNLGVTAKVKAGLYQLHPRLS
FT                   LRGGRVPVEPRPGMRTQGTLKVDQLSLLDAIEDNPDLPEVFRELRQLPKPAEKPLREDK
FT                   ARAQARAEEDGTS"
FT   CDS             1901..2377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p02"
FT                   /old_locus_tag="SAP1_2"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p02"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75286"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH8"
FT                   /protein_id="BAC75286.1"
FT                   /translation="MTIAVEPAAPEYVWTANNALVFAPRGMPPASYPVLLHLLGRQEPG
FT                   GRCLVTHGTLAAELGITRPKVTRALQHLGFARMVWKEGNGAYRLSPLIAGFRTPAEQLQ
FT                   AIGAMDDDDRFDHPDFQERYEQQIEAYEEEKQAKAAERQRRLEPPIDLAARRRT"
FT   CDS             2490..2975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p03"
FT                   /old_locus_tag="SAP1_3"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p03"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75287"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH7"
FT                   /protein_id="BAC75287.1"
FT                   /translation="MVPRATRPSAGRRGTSGGVTYNFGLHFTQELGNSFGPPTDSWPAS
FT                   AEQVTPFFAIVVNVLGTDDAARWFEAARKAHQRVVVAERDRTHHFGFAHHLDVETEAHQ
FT                   EPTLPVVAAFEATKALYEITRRDSGVDVDVFFGCALRACSRGSGRTDSTPVAAGANA"
FT   CDS             complement(4104..4619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p04"
FT                   /old_locus_tag="SAP1_4"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p04"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75288"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH6"
FT                   /protein_id="BAC75288.1"
FT                   /translation="MPSDINQLTAGRQLTGLRQVLDCPATPTTLRQGPAAAPGEPPDWL
FT                   ALLCPAHSGALPGWPGTAADTDGLRLSCGSVLDYRSAEQLLQSHADLWLTPLTGVDPKT
FT                   YAGVWPDVLDQADRVLRARLGEDTGDGDETLHSLAMMLEMASRNAAEGNLYQATVPLAY
FT                   CETLAQRL"
FT   CDS             complement(4639..4911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p05"
FT                   /old_locus_tag="SAP1_5"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p05"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75289"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH5"
FT                   /protein_id="BAC75289.1"
FT                   /translation="MPSVHGPRRARIAFSDSAAKQLENITSEAEIHALDRALVVISVDP
FT                   DVGEPIPGDTAGPQLRQYADEVESVRVLYFVTALRTVVVVAYIEV"
FT   CDS             complement(4911..5144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p06"
FT                   /old_locus_tag="SAP1_6"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p06"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75290"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH4"
FT                   /protein_id="BAC75290.1"
FT                   /translation="MSEQPATADHARQQLEPAAADAVRAYAARTRENADQFAAVLEDIA
FT                   ANGLPSVEDCTPWEELREAHLARLAAQRPAVA"
FT   CDS             complement(6495..7088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p07"
FT                   /old_locus_tag="SAP1_7"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p07"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75291"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH3"
FT                   /protein_id="BAC75291.1"
FT                   /translation="MDRPLLERYLAHVMSQPGGHGMKKTRIGALNLFFQNIRQYGREDT
FT                   LSGTAAFYVGDVPPVPEQVDRQRKSRTGSTASNGVLHPWPKDCRRRRPCSRKSSSKADN
FT                   AASPYARAGAPTLPPALSVRHHWQERSGCPTSLAIGPCSASEDTPKGVTLTERERDTAR
FT                   HAPPEKCHAASNMPLYVRSPGSVSPSRAGFEGGA"
FT   CDS             7111..7851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p08"
FT                   /old_locus_tag="SAP1_8"
FT                   /product="putative transposase B homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p08"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75292"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH2"
FT                   /protein_id="BAC75292.1"
FT                   /translation="MNARNPPKQMSASTPARAAPMLSPDVSYGIATQTLPNGYCGLPVQ
FT                   KTCPHANACLTCPVFLTGPEFLPELREQRTRTLTLIDNAKSCGHSRMTEMNQQVADNLD
FT                   RMIGEMEDDQETETCTKDALRTRWQRKAAPPAPVVRACRACEAPILSGPAHKPCCSKEC
FT                   SYWAYMNRRRDRGLPRSVAVAPPRQQPADCLVCGILLPERRSQSRLTCSASCRMKRYRA
FT                   RRKERLGISPDQCIKLPSFAEHRR"
FT   CDS             complement(7817..8179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p98"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p98"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146FBX6"
FT                   /protein_id="BAU68545.1"
FT                   /translation="MTLLYRAQDDEVQSAVSKAVEHAVKNHGVGNWGVHVAGAFRHGAR
FT                   EWVIREGEQGEESKEVSVSVIMTDGEAAFWEIRGIWRRPGQAAEIKVLNEGEDDVVRSP
FT                   DRFDPIIVDALRKMEA"
FT   CDS             complement(8729..9040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p09"
FT                   /old_locus_tag="SAP1_9"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p09"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75293"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH1"
FT                   /protein_id="BAC75293.1"
FT                   /translation="MQKDVDAWLAHVLAAHRGHYADPAARAAAADLLPTHLLATHLLAH
FT                   AALLTELTHLALGAGVDQLAFDVTSPVRAEARNARFTLFTCEPMRPFPQADAFPGGDL"
FT   CDS             9260..9592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p10"
FT                   /old_locus_tag="SAP1_10"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p10"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75294"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YH0"
FT                   /protein_id="BAC75294.1"
FT                   /translation="MFGAASASSWSMRSHSASSARPRSSSARCSCRASNRASSRACATA
FT                   PASIPFARRRTTRRPMWAGSTGSRGAASGASGRRKVRRGVVIFGLAFVVRIRSGPPPER
FT                   CATARE"
FT   CDS             complement(9623..10216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p11"
FT                   /old_locus_tag="SAP1_11"
FT                   /product="putative terminal protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p11"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75295"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG9"
FT                   /protein_id="BAC75295.1"
FT                   /translation="MIDSNDTQPLAPRRNRVLDALKRAERKVFTRPAPKSAKAQIEFLY
FT                   TRAKKSTKALAEQLGVSSRTVQRYRAGQQTKPQKKLHAALVEETESQWQPQVRAQARER
FT                   AATSSGMMVEVTAYFGFTCTGSSDDGRERTITTPISPTYAAQILQLQEAGATEEDLHPI
FT                   VAEAITESYFTEWGTRADGLRADFTHVRSIDFEF"
FT   CDS             10346..10654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p12"
FT                   /old_locus_tag="SAP1_12"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p12"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75296"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG8"
FT                   /protein_id="BAC75296.1"
FT                   /translation="MELLRFSDRLPQCSRCRGDLIMSGVAPQNDKHGRPIHLELCPVCD
FT                   TGDVDRPAAGLLVQWFADRGGHDESRVQEGSHLLMEWTRECMAVHGWYLQDTPPDQP"
FT   CDS             10741..11103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p13"
FT                   /old_locus_tag="SAP1_13"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p13"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75297"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG7"
FT                   /protein_id="BAC75297.1"
FT                   /translation="MATTYDYPGDLIAAQQALTQVRADLTALYERLPYSVEPMEAWQRP
FT                   EGYWLATSRAYPDSPGWSEQERREVAALRERERDLTAAIVTHAFWNDVAGPERLDARSQ
FT                   LKHALAREDGEGQEAA"
FT   CDS             11106..11633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p14"
FT                   /old_locus_tag="SAP1_14"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p14"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75298"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG6"
FT                   /protein_id="BAC75298.1"
FT                   /translation="MADTPPEPEPPPIIVVLPDGQEVTGRLQERQQVQGAWLYKVAVPA
FT                   WQNTPSGQVEPAWYVVWVQAPGHVKPVPGVSYNNVPTTRLPPPTTEQQILGERRPSGWV
FT                   LQKLNGGRGPGRGIIHAVDCEEASAGAPLLTLDKALDAAEQPGTRLCSLCSAAAELDPV
FT                   LKGFDHGFDGEE"
FT   CDS             complement(11657..12223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p15"
FT                   /old_locus_tag="SAP1_15"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p15"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75299"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG5"
FT                   /protein_id="BAC75299.1"
FT                   /translation="MVVRNTKAFKEAVAQTLAELAHQGVTLAPATVEDTIEKNVRTAAD
FT                   RLGIQVRSAWRYFDAAALAARLADSSRSFEESSTRKGAGQAPMPPVDNPELALILAGVP
FT                   NALAQTGGDLYGVIVNVAVNAWIAGHIHGEDGCDGCEESRGPSGHDWEDRMRVITEMQP
FT                   DISKWFDRNVWTRAVNDTGFTVTRS"
FT   CDS             12286..13566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p16"
FT                   /old_locus_tag="SAP1_16"
FT                   /product="putative endonuclease VII"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p16"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75300"
FT                   /db_xref="GOA:Q82YG4"
FT                   /db_xref="InterPro:IPR004211"
FT                   /db_xref="InterPro:IPR038563"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG4"
FT                   /protein_id="BAC75300.1"
FT                   /translation="MAAVTIRFMPISREYARSLFADLTQSATVPLDPDELLHMPGLAQH
FT                   GHVFFGDIAVRCYKHKARWMYDERDIRRAGQAFAELRLDLDDVVDVQLPAYRDFGQSDP
FT                   EEWQRVDWRRRLVSWMFGLARHKAHDGIPYDEWNDAWQRVGANGLPGDLTWEEFVAASS
FT                   RYRHSQNMAGTRPLELLTWSGKRWLLPRAYIELLDRWAQREEELVNRARVCSSCGAQGP
FT                   YWDGWRTSTSKGYVTRCPPCSGAAFRPYTGQLRGVQYESPRRRSTRADDYLCRLCKKRQ
FT                   ASAWDHCHEHGHVRGPLCGSCNTREGKATPYYFLQLEGGTLHLLECRGCLEQRTLPRRF
FT                   HLDVVRAHLEQTERHGRCRRQPYARELEHTHGVHRFQLECSGWHAVSNWTKDVTASEVT
FT                   ALVRAYVDAALTAQESQPPPGTATDAG"
FT   misc_feature    12392..12400
FT                   /note="DnaA box-like sequence [TC][TC][AGC]TCCACA;
FT                   TCCTCCACA"
FT   CDS             complement(13703..15061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p17"
FT                   /old_locus_tag="SAP1_17"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p17"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75301"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG3"
FT                   /protein_id="BAC75301.1"
FT                   /translation="MTVRVESNSYLTEEQHQVYQLRDSLERNGGTPIGFLELLAAVMAE
FT                   GTWKKVPSGVNQEKPFNSFSEFIEANPPFGLGASVENVRILLQLRHPHEGVPRIREQMD
FT                   AMRAEVTRLLGPDPERDPVARDARVFGAYDRSGGWVFGLLVARNVQPGAVGRRPSETWG
FT                   VDDGDAEKVSASRFAEMAGTSAARVMRFYRAWERAAADSKVPSFDQLTPGQEIDLPDAN
FT                   LWGDYFTVYEQSTDRRERIAEEAKAAGTSYTEAMKVAKNPAAMRTAILGDPKTAEAARD
FT                   ALMGRTELRATVVAQAMSDPAIRKEAAAQTRKAERIEFVRQVATDGKAKTPAGQIIELT
FT                   SQARQKVSACLAAVEDSEATPESVTDAYETVREAIEETVESDRDLQTIEQRTQYLKALK
FT                   STAKGIESIDPQQLATVIDDDVRESIKQLQQRINALASSIADPNAEASAPVVG"
FT   CDS             complement(15071..17104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p18"
FT                   /old_locus_tag="SAP1_18"
FT                   /product="putative HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p18"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75302"
FT                   /db_xref="GOA:Q82YG2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG2"
FT                   /protein_id="BAC75302.1"
FT                   /translation="MADRDPQRFFTQNQRNILYDLAEGRCETCSAPLLDGWEADHMVPW
FT                   VQGGRTVIENGQALCAQCNKGKGRGVQYTDEFSPRPFQREVIDQVFDRIHAGERLTAVL
FT                   ASPGSGKTLTYQATATRLFRAGLIDHVAVFAPRVTLAEQCETDWMQRDSQGSVTKGDCL
FT                   LFDSTKRIGMIRHKIKEKPLTPVTEPGSGFISTYSALVTNESVFLEWAAKHQGRFLLVA
FT                   DEAQFCGDTTDPDAGEGGTRAGALIKQMHEYARHTLLLTGTPNRADNQRLVLADYEPHP
FT                   TDPKREVLVHHAEAKYSNGIAEGYLRKFEMRLTNARVSKRTLADDAGRGDSVLEYNLSD
FT                   DGSELVPVLRDEKTWQPLVDDVVRAIRDKQKFHASYRGLISCMQQQDAKKVYKYLQQRY
FT                   PDLRVALAVSSDTGASKILQDFKVKPMDLLVTVRMAFIGYDCKTITVVGILTHYRDGGH
FT                   LMQLIGRGLRVWDGTPAREQTCLIVAPDDPKMQGFLDLLREENDRGLKVLEEREQEERE
FT                   EPGDAVQEEFSYIDSAVATTTRASSNELDMDADETLMVETLKRAVDAAEDVTKLKQIIE
FT                   MAGMMLKQPTPVPQPRTEPEPEPPTEAPKTERQKIADFNSKTSDTIRQYLYRGGVKPGD
FT                   AGYRDAAMKATARVNEAAGCTAANANTVEKASRRFRAALALK"
FT   CDS             complement(17560..18426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p19"
FT                   /old_locus_tag="SAP1_19"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p19"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75303"
FT                   /db_xref="GOA:Q82YG1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG1"
FT                   /protein_id="BAC75303.1"
FT                   /translation="MGRVKARKGETSGVRPARVGEGDAVRTLLAEVARDEQDRMQLAAS
FT                   CHLLDSGVDTARYAEPFRFLVFERRRTLLGAVLVQGGNLGSKPGDDLADLKAHQNLYAQ
FT                   QVGMQRKMFDRVNAVSAHLAFMAVAPASRGQGIGRQLVRAAADIERRRGRRLLTGYVWD
FT                   DDLAHMYERWGFIVSPAEMAAFFLREKVGNLYAPSAAALNLTEGSRLIVLPLVPEVRAY
FT                   DIGTADQPFPAVVGVEEPFDPTHLDTPEELTKVKERIEALVQQQMTLYGPERTRAMFDA
FT                   FLGQSGN"
FT   CDS             18796..19674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p20"
FT                   /old_locus_tag="SAP1_20"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p20"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75304"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YG0"
FT                   /protein_id="BAC75304.1"
FT                   /translation="MQSGNELPNDRRAEYFGQCAVMMLNALRQENDADPFSEVTSVDLS
FT                   AETEPGHEGIYDQALSNALAAIVAAEWPGEEANDKGRVHFARTLLKVIAEKITPDPTTG
FT                   LCVIPDRDADVRSPWEKQNRAPEGFWDTRIDVDLLTDALDVSGQARHGSGTGRLQRRHV
FT                   QALLALDHHPTLRTLLEAQSDRDDERAQDEDARSADQARALLELIGDEEAKRRAESAEN
FT                   PNEYHPKHNPDGHDFEECPVCGYETFCIQGLDMSGRVGFGQCIVCSYRRSPRVADQEGF
FT                   GEHLAWLMGKD"
FT   CDS             complement(19768..20325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpgA2"
FT                   /locus_tag="SAVERM_1p21"
FT                   /old_locus_tag="SAP1_21"
FT                   /product="putative terminal protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p21"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75305"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF9"
FT                   /protein_id="BAC75305.1"
FT                   /translation="MSLFGDGLDAAVQKAFTRPAPKSAGAQMRYLVKQLKGTKAVAQML
FT                   RISQRTVERYVKDQIKKPRPDLAARLEREVKARWQPQIRAKAREKAATTGGIVVDTRAR
FT                   LGYTAPIGSTDQDRIRHLTVALPPVYAARLFDAQEAGASDARLQEIAAEALKEVYFQDG
FT                   GRRAGSLEEVRFTDIEHLEFEL"
FT   CDS             complement(20338..22596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tapA2"
FT                   /locus_tag="SAVERM_1p22"
FT                   /old_locus_tag="SAP1_22"
FT                   /product="putative telomere-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p22"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75306"
FT                   /db_xref="GOA:Q82YF8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF8"
FT                   /protein_id="BAC75306.2"
FT                   /translation="MPTEEELMARAAELLARGPLLPPPTERKRLREAAGLTQEDVAIAL
FT                   QTKRETVNGWETGRTMPRPPRLAAYKHLLDGWAAMYPAPTDNADAPSGVTAKVPETFTS
FT                   VPVAPEARTLSTAPASEAATMTVSENIQPRPTDNAAAPAAASRPARTARPSSTSRRPAA
FT                   RKAAPANTPAGTDPRFANGPIAVVDVDADGQVLAYCVGGLVLDVPAKSIPALVDWTLKD
FT                   AKLGQPQLSGPGKDADPLLVLTQSALERYGLPTTLTDEERLAGRIPEGHKVIKQLARAE
FT                   WKLTKRGFGPWARIYRPAQGSERACVQLCIPSWNALDTRHWGQAGQLPPAELARVLGVY
FT                   ASRVMTPRGSTAVTGLELMTALHPPTRASEADATGKRHSEHNPGSLGKDPVDCAPCEAP
FT                   DGHPLLKDLPRFHVRGPGEKLFEEAYDWARPMTDAECTLRHLVGIDVNMAFAAGANGLV
FT                   VGLGAPTHVKAPVFDPKLPGSWLVDLSHVDLSRVKLGKDKWADLDGSLLPSPFTPKGER
FT                   PEGPAWYATPTVAYAVELGYDVTPLEAYVRYENGRYLDGWYNRLRDAYLATMADLGVDA
FT                   DLSPADFLTAMDGYRGRDPELAIVVSAVKATVKGGLGKLRERPRGEGWRPGGPWRALSR
FT                   PTWRPDIRAAVISRTRINLHRKIVKHAAFTGQYPIAVLSDCVVYAADGTSPLDFLPYRD
FT                   GKPLPGGFKLGINPGLVKHEGTQSVLWGEEVRERFNAPELNLARYIKDGTVTDVDNGE"
FT   CDS             22760..24598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ztx"
FT                   /locus_tag="SAVERM_1p23"
FT                   /old_locus_tag="SAP1_23"
FT                   /product="putative Zeta toxin"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p23"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75307"
FT                   /db_xref="GOA:Q82YF7"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF7"
FT                   /protein_id="BAC75307.1"
FT                   /translation="MEQGTASGPAVLSEQESSEVLHRLILPAATRSAVRQPRPVVGVVA
FT                   GQPGAGKTEIADLVQAVLDRRGGSVRVGRDLYQPFHRHYADALAADVRTAGAVVRPDTA
FT                   RWQAAVEAHVREMGFDAVVESALADSDDFRTSSAAYRAAGHRIEVVALATAEALSQLGI
FT                   ADRFLTEDAAGGGRYVSWENHDGCATNMLATLAVIETEQLADRVTVVRRDGTVLYANEL
FT                   TAEGGWRRRTAADRVVRRERSRPWTAPETASFRRELARTDRRVHAELVSEDRRLAVQRD
FT                   TERAAAWSEPVRRIAQPRRRAPGVDYHRLSPDEHRWIFEELIAPSYLNCVVPRDDPRAV
FT                   YVLGQPGAGKLLAARMVRRAMRPGTTRLVGDDFKASHPDYYQLLRDDPRSAGAAIRADY
FT                   KAWFAQAEEYVRLRRGDVLIEAAPGNAEEFIDSALPFATIGYPVELVVLAVREADSRLA
FT                   TALRYARALQRGGTGRFTTRAGHDTCFRALADVVAVAERHPQIAAVTVIRRDGHALVRH
FT                   EAGGAGRASWALTAERLRPYTEQEAAAFLRLHQALRRALPQHRAELDEISALARPLMPP
FT                   RVQPARIDRPRPTVWPLPIPRRAPGYDSLSSLSRAA"
FT   CDS             complement(24562..24840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p24"
FT                   /old_locus_tag="SAP1_24"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p24"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75308"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF6"
FT                   /protein_id="BAC75308.1"
FT                   /translation="MPGTPDEPDFSGLGGGEEQAAEDAVQEVVNWYNTQIITERRAPVP
FT                   DEERIEELKAGRQAALADQAQLATADPEEAERIAAVYAARLRELSES"
FT   CDS             complement(24871..25902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p25"
FT                   /old_locus_tag="SAP1_25"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p25"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75309"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF5"
FT                   /protein_id="BAC75309.1"
FT                   /translation="MPAALLLGSPPRSRAADCCGAWGVRHPSAMKPDPEPWYSTTLNLW
FT                   QAAGVLVASWTLTKTLTEGWRRTVGRRRYVTTRLRKITPGVRHDYVESLLDKPRWQSTL
FT                   HATRLAPDEQPEGADDGERKVELTVRTWLLSRLCYLVTWCEDDVVVMYGITTTSWWFRP
FT                   WIRVNETRIRLGKSTFATLSDDSTVIHRAWLGNRRYGYFEEHYFGNVGGYRSWYVGVND
FT                   FGSNAFAVSDDWFDPSDIRHTLLLPEPRAAYRGSVPINTVVVSGVALFKEVQEGTFFGL
FT                   SLGVDQDLVRLADPEYHVLDSRIGRIHRRIRAWRWALKHRRWERRQQGQRPWWARALRQ
FT                   RGQ"
FT   CDS             25942..28617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p26"
FT                   /old_locus_tag="SAP1_26"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p26"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF4"
FT                   /protein_id="BAC75310.1"
FT                   /translation="MAGRDLRALFSTNDRSVQADEAFTNRASQWETVAAALTEHIQRIS
FT                   APGFDAEDLEAPRNHVLVFHGVGGIGKTTLSRMLEAALTDAGRRPSQWGEPGWPADRIL
FT                   PVRIDLARSAGTDFEQIVLTIRAALTRIGRPLPAFDLALRRYWEANHPGEPLEEYLRRG
FT                   GLGSRFGQALPQQMQSALSDVAQALMLPGTIGSVVGQVTGALVGALRERRQTVRALAGC
FT                   ARLADLLEAEPDLDALSFYPHLLAWELARLPEGKRVVPVVLLDTFEDIGDRTRRDLERL
FT                   VQRTVWLLPNALWVITGRSRLQWADPALQGQLDYTGPAAWPGLVHSAVPAARTPTPAGT
FT                   ARQVLIGDFSPEDCDDYLARRLTRGGQPLISEPVRQVITARSHGLPLHLDLSVARFLEL
FT                   SRSGRTPHPRDFDHDFPALVARTLTDLTLDERHVLRSVSLLDAFDVPLATRAAGLAHEG
FT                   PALRLTERPFVHDSPFGLWPFHLHGLIRSAVRNADDTTDDRWTERDWKQAAQRAFTALG
FT                   EQHQAAPGPDRLLLIAFLRQGLRLARDHRLNLGWLTPAAWTYVSDSVWEPLAPPDTDTD
FT                   TTGLDTAADALVELLSALGRRQHQHRSHTVARLTTVITSRLLPDDLQHMALYYRAKAHR
FT                   DLGDSPASRAGMQAVADGRGRLAPAARRGLAHLARMAGDFPTALATARTLGWEGRHHRV
FT                   EGDIWWPHGDMDRAAAAYAAARDEAEHHGVTGERGNSQAHRAFALAFADPIVADDELAL
FT                   AEQLLADVDLRATTLNTHIAALARDAGRTDADVDDRAQVLRADIRTAGVTYAGLTLELA
FT                   LSFHYAVREAHDEVDAAISRLHAATGGGDYAYYSDIAHFMAGLPLEAASRARWFDGQQP
FT                   TRQRWRTLVTTRRDQLHVPR"
FT   CDS             complement(28671..29051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p27"
FT                   /old_locus_tag="SAP1_27"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p27"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75311"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF3"
FT                   /protein_id="BAC75311.1"
FT                   /translation="MSDAVHIVLDDTAMAAAGQGNVLASRLIHRAHAESGWFLYAPACA
FT                   LVEADRARPGTAEHLASLPGITVLDLDLAAALAVARQETWAAAHSQCAAQPTPDRPDGA
FT                   IIATTAPHRWAGEPVRVLDLTP"
FT   CDS             complement(29048..29407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p28"
FT                   /old_locus_tag="SAP1_28"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p28"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75312"
FT                   /db_xref="GOA:Q82YF2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF2"
FT                   /protein_id="BAC75312.1"
FT                   /translation="MHWVRPHNRVVTGISPMTGTGTYPYPLGMGRSTTMSDANVRIPEE
FT                   AKDRLAAIAAAEGLSLRAYLARLAETLLTPAERAERAEKALAALKEWNGYAPTAAEEQD
FT                   LDSELDRRLAQVTSQ"
FT   CDS             complement(29549..29821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p99"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p99"
FT                   /db_xref="GOA:A0A146FBY8"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146FBY8"
FT                   /protein_id="BAU68546.1"
FT                   /translation="MELRYPPLRRRANVALCRFQTVHTDEKGAQACTTCKGEGRIVREQ
FT                   HTYKVRIPAGIEDGQEFRIRELGGPGTPRRCARRPVRHRAHHRLM"
FT   CDS             complement(29812..31962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p29"
FT                   /old_locus_tag="SAP1_29"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p29"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75313"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF1"
FT                   /protein_id="BAC75313.1"
FT                   /translation="MNSAGDRMCWLERTGEFVRTDRRRIQTAVLGGADSDEPLMLPMEA
FT                   IELDAFRRSHEDDTFWCGTLLGGCGGQLTTKLYTDRACHFAHHPDPDGLPHVCGRRSHG
FT                   VDSADHLYVRSAAAAWLAGRGEQATFEYTRTEGAPIGSVVDVRWRHGALRVHLDQAVAP
FT                   VWDDDVEPVLGTMVPVDRDTLIRRWYVHRIRLDSVGTARHVQIGTEAFARPIEWFALDK
FT                   CEMTERGLSTPAVEKIVQARNAPRPSLWSPGKARKVPEPEARAQALLRRLVYARRIESV
FT                   SLVKQVCGEIEDLTGVEGELQEQLEAAVRHARIWLVEQNEERGKLFDKLKRAVAEQKPG
FT                   RVRRLLIRVNATAAEDRTDAESAVYERAITYFESLDDLTRDAVEAEADTEKEAQKAAAS
FT                   VRSALHRLRGYDAYTFNLRPQVEDLLRSAASAGELLTRGEARRVEVWKKRAALGPQEQL
FT                   GVARRYWIQRSCPRCNAEQGKDCVLVEGPSSGKPRKDGHNERLQLIVDERKAAQKMARQ
FT                   QKKARQDVEASAEPMQPAPEAHEREVSPPRPLQERRPEADREGQAQEAGKKTAARLHHQ
FT                   VPRGDWYRMMCPRCHAGPGKLCDNDDRVGPSEKRQLPHDERLRRVLQSDDRLGPGEKQK
FT                   GARDERQHQAPPPARAKVRPPRPRRREREPQETAGSAARTWDAKEVTCPKCQAGPNSPC
FT                   MPHGPHHERVEWAKEFTRKLWS"
FT   misc_feature    31067..31075
FT                   /note="DnaA box-like sequence [TC][TC][AGC]TCCACA;
FT                   CCCTCCACA"
FT   CDS             32033..32203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p30"
FT                   /old_locus_tag="SAP1_30"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p30"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75314"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YF0"
FT                   /protein_id="BAC75314.1"
FT                   /translation="MKTVPKNEPPNSPGFVDRYKRAVDQLAEKRRQKEDAKRRQAVDDD
FT                   QAAPSSQAPAA"
FT   CDS             complement(32340..33533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn"
FT                   /locus_tag="SAVERM_1p31"
FT                   /old_locus_tag="SAP1_31"
FT                   /product="putative serine/threonine/tyrosine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p31"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75315"
FT                   /db_xref="GOA:Q820A7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q820A7"
FT                   /protein_id="BAC75315.1"
FT                   /translation="MRRGACREGGVVLAGTVLDGRYRLIEPIGAGGFGQVWKAHDPKVD
FT                   RLVAVKVLTGDGSADSSRQAARFAREAAVAGGLSHPHIVTVHDFGSAMDDGRLHAYLVV
FT                   ELLRGRPLSVVLKDGRLPLPDAVRTAVCIADALGTAHGAGLTHRDIKPSNIIVRSNGQA
FT                   TVVDFGITKSSDERHDITTSGVLIGTPAYMAPECFNGTFDHRSDLYSLGCVLYEMLTGH
FT                   QPFTGTSWHLINQHPNEQPAPLIKRRLSTPPALVNLVERLLAKNPDDRPADAFQVMLAL
FT                   REIDRRYFDEGLPNRGLDRYVRSAVSPRIAAFGAVTHILLADRAPCPACASEPGAGGAE
FT                   GCESCQGTGEASAETTHRIRIPPGVKAGQRLRLKGLGWPGRNGGEAGDLFVVVRIEG"
FT   CDS             complement(33610..33942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p32"
FT                   /old_locus_tag="SAP1_32"
FT                   /product="putative Tra3 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p32"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75316"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE9"
FT                   /protein_id="BAC75316.1"
FT                   /translation="MRTRETASDDYRRALAAHQEVAPPRRVDPAIAEAVERQTAAMREL
FT                   SRRAFPEPDVVSDDGPAPIEQARAQRRRQAAATEAAALRRARQERAAREAGTPTVGPPA
FT                   ALRTTA"
FT   CDS             complement(34022..34219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p100"
FT                   /db_xref="GOA:A0A146FC00"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146FC00"
FT                   /protein_id="BAU68547.1"
FT                   /translation="MAVAVVILTTALVIVVALLAAAGAGKLARMDGATYPAALTRAATT
FT                   FATVITLAATVTATLTALLS"
FT   CDS             34247..37012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p33"
FT                   /old_locus_tag="SAP1_33"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p33"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75317"
FT                   /db_xref="GOA:Q82YE8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE8"
FT                   /protein_id="BAC75317.2"
FT                   /translation="MTWSKVAESVRAGVRRDEDGHRRTHQGLGGEHVHGKQSGGSLALT
FT                   ELRERLADGLARARLNQTQLAKQAELGRTTVSEALSPTKPVPSAETVAALARVLRLPVG
FT                   ELLELRWTAVEEAGTVPAGGPGRRIGQWDPHDLEVHPAGAGRAPSDPDTPVLRALPGYV
FT                   PREHDGLLGEAVRDAAAGRSRIVVLVGSSSTGKTRACWEAVQPLAKKGWRLWHPFDPTR
FT                   AEAAVEDLHRVGPRTVVWLNEAQHYLGNPVSGERIAAAVHHLLVSPERGPVLVLGTLWP
FT                   EYEKQYTALPRPGTEDPYSRARELLAGRTLAVPEAFDARALAAAAVLAESGDRLMADAL
FT                   TRARTDGRMTQDLAGAPELLNRYQNASPAAKAVLEAAMDARRLGVGLHLSQAFLTDAAT
FT                   DYLDQNDYDQLTDDWAEQAYAELALLVHGKQAPLRRTTPRAPRRPPPAAATEAPAPPPA
FT                   GPQFRLADYLEQHSRTTRRHLCPPASFWHAAHTHLVRPDDLGNLTEAAEGRHRLQWAHH
FT                   LRHRAATHGSTTALFRLAMMRERAGDREGAEALLRQAADRGSTTALSGLADMRERAGDR
FT                   EGAEALARQAADRGNTDALYRLADMRERAGDREGAEALARQAADRGNTDVLCRLADMRE
FT                   RDGDREGAEAVLRQAADRGNTDVLYRLADMRERDGDREGAEALFRQAADRGSTTALFRL
FT                   AMMWEGAGDREGAEAVLRQAADRGNTHVLYRLADMREEAGDREGAEALARQAADRGNTD
FT                   VLCRLAQVREGAGDREGAEALFRQAADRGNTDVLCRLAQVREGAGDREGAEALFRQAAD
FT                   RGNTDVLYRLAEMREEAGDREGAEALARQAADRGNTDVLCRLAQVREEAGDREGAEALF
FT                   RQAADRGSTHVLYRLAEMREVLRRQWPYGLDPDGTPTPPWQPPSAPTVLG"
FT   CDS             complement(37072..37557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p34"
FT                   /old_locus_tag="SAP1_34"
FT                   /product="putative Tra3 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p34"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75318"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE7"
FT                   /protein_id="BAC75318.1"
FT                   /translation="MMTETPQLSGVDLARVALRAAKVAAQKNGGGRTAQPKPRTTRVVR
FT                   RDGREPMGLGAAISALVTERAWELPAAGASLRARWEAIAPDFGHVVAVGCDADSGRLTV
FT                   CPESAAWATKLRLEQARVVEAANESAGRTVVRGLRILAPGSVPVSEPADVTPESGCP"
FT   CDS             complement(37554..39374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p35"
FT                   /old_locus_tag="SAP1_35"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p35"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75319"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE6"
FT                   /protein_id="BAC75319.1"
FT                   /translation="MSAGAASAATLDHPLWESIDNSVDGAPAGRVRRQRVRVPMRLVSS
FT                   PHYQDVALSVYVKVKALGLRPEGCQAKSTTIASYLGLSTASVERGMTQLRRPGPDGVVE
FT                   LFSDRRTLPGGTGTSAVRTVRAMTRTEAFVWLPVAAAEDLTPRELRAFALIAYAQARGI
FT                   TLTEAELAAGLRHHSGQKAGQPLSVTAASAVVDEVEAARWVTVQRRAGAQGRHRYIAHD
FT                   IAPEARPEGGCAAVAGAVEAGVTSGSQESVSSLVGEGSGSPVGEGSLANEESPRTDSPD
FT                   DEGAFLSPAVGEVPVVEGAGAVENSAAASARAEGGGGLALRAGGNSRPSPSKPETEKRS
FT                   SRDGGSRRSSYDGPQLAMNPQIYAVLEPVHLLLERVNSDFVVRQIARAVGRQLREGTDA
FT                   ERLHHRLTARFSKVMLSEIRDPGRWLLGVALPRWGCGFQDCEAGVLWSTGKDCEVCAEI
FT                   VQDKTAARRHAQRIEQGLCPEHGTRPGPGGHCVDCVLDDAIRNPASAPAPAQREPEGPP
FT                   RGSCGDCGARIVVVGRALEDGLCKLCREEAAALAAASAPAAAPRQAGPVTAEQQTCSGR
FT                   DGTVPCGRKPLPFRNVCGVHRVQELAGEVA"
FT   CDS             complement(40645..41325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p36"
FT                   /old_locus_tag="SAP1_36"
FT                   /product="putative riboflavin-specific deaminase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p36"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75320"
FT                   /db_xref="GOA:Q82YE5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE5"
FT                   /protein_id="BAC75320.1"
FT                   /translation="MTARPYVLLSAAMSVDGYLDDTSPERLRLSNAEDFDRVDQVRAES
FT                   DAILIGANTMRRDNPRLLVNSDERRAQRVADGKPEYPLKVTVTQSGDLSADLNFWHHGG
FT                   DKLVVTVDSAVEKVRATLGDLADVVGVGPELDWGLVLDELGRRGVGRLMVEGGGTIHTQ
FT                   LMAANLADEVHLAIAPLLVGQPEAAQFLGAADYPGGSTARMKVLEVRAIDDVVFVRYAP
FT                   KERG"
FT   CDS             complement(41330..42763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p37"
FT                   /old_locus_tag="SAP1_37"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p37"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75321"
FT                   /db_xref="GOA:Q82YE4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE4"
FT                   /protein_id="BAC75321.1"
FT                   /translation="MAQRPRELTPWVSPLHNWGYELRQLRKLRGWSLRDLSQRAVLDHS
FT                   HLGRFERAERKADRSQAALLDQVLGANGMLFRLWERIDDGRGHVANSPVHVAKSSVDLA
FT                   LGLPDQAASDGEGLSVPCRLRDGSVVWVALDRRALLRTGVGLGAAAAVGVGSPATADSS
FT                   AVPGLVRKARAASAYGSTPVEHLRRTRRLLIDSDNLLGPRQVVGAVRDHIQVIQELRRD
FT                   AKGIDRRDLMELQTQYGEFLSWIYQDLGNPEAASYWLDRAMQWSHTVGDTDLSTYVMAR
FT                   KAQLAGDTADLVDVVDLAEAAQRMARPRSRLAAVARTYEAYGHALRGDADESERAIDDV
FT                   RNALDGAAADPTPWGVWLSASYVEIHRAQGLEALGKHDQAADGFAAAIRMMPDGYHRDR
FT                   GVYMARQAVALAGARVPEQAAAVGMNALMVAGDTGSGRITNELTRLDKALTPWQRVPEV
FT                   EEFRAAFDSTLVHETETEA"
FT   CDS             complement(42887..43690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aorA"
FT                   /locus_tag="SAVERM_1p38"
FT                   /old_locus_tag="SAP1_38"
FT                   /product="putative GntR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p38"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75322"
FT                   /db_xref="GOA:Q82YE3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE3"
FT                   /protein_id="BAC75322.1"
FT                   /translation="MAPMPVSYRDIAADLRQQISHGRYVPGDKLPMLTELQTQYGAGYQ
FT                   TVRSAIALLEQEGLVIAVRRRGTIVRERPEKRRITRSRQVFRDEIGYYFDPTAQSWAAL
FT                   ETPTLRWGIVPVDLAALMGLATGAEVFIRDRVMGDPETRKPKQLATSYLPAELARGTLL
FT                   AEADTGPGGIYDRLEEMGHRPLRWSESVSARMPSPEEAEALNLPADVGVPLLRVVRVTT
FT                   SPTGEVVELNDTRMSAEEFEIGYSIRRHASARLSDADEDGDEEDH"
FT   CDS             43843..44643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p39"
FT                   /old_locus_tag="SAP1_39"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p39"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75323"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE2"
FT                   /protein_id="BAC75323.1"
FT                   /translation="MNRATHPAPPQDRRKSSAPHGVAGVDAPLNPPGSRLTCMHVAALM
FT                   RCPSPRTPGLPCAWRAERAPRRSPSPPYTRRSRMTITSAMPTARKRPTRTRTKQVSSLP
FT                   AITVSKLPPIDIDLLPGTESLVCPNCSRWCPITGHDGRNPKLVPHHTGRAGTAEPRRCD
FT                   GSNRRVKLDLTIAEWRELLADAITEASSRQATAVLPKAFSPQTDRTLRARAERTLAGRV
FT                   ADWDAVLPRVADADKNRRAVPAGDAPTEGPAVPLTTLHPKRPER"
FT   CDS             44778..45344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p40"
FT                   /old_locus_tag="SAP1_40"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p40"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75324"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE1"
FT                   /protein_id="BAC75324.1"
FT                   /translation="MRGKTLSPIMTSPAPPGARADSSPDMDDMLRRTRMDDQRRSQRPA
FT                   LPACVPGLYVQHRDRGFVAHITASEVAFSTVRGLTVSVPMAYGAGQATADTAEWLVSEL
FT                   LGNAVRACGDHVPLVVEVYVTGRSVQVNVHDPAADLLPHRSAVAMDSETAESGRGLGLL
FT                   DMLAPGWDVVSSPVGKQIRCHIDAK"
FT   CDS             45428..45745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="whiB"
FT                   /locus_tag="SAVERM_1p41"
FT                   /old_locus_tag="SAP1_41"
FT                   /product="putative WhiB-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p41"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75325"
FT                   /db_xref="GOA:Q82YE0"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YE0"
FT                   /protein_id="BAC75325.1"
FT                   /translation="MKRVSVAVVRSHAYAPVSTDAIERSRAACVDEDPELFFPIGDTGP
FT                   ALFQIEEAKAVCRRCPLMESCLQGALERGEDAGVWGGLSEKERRSLKRREARERAAAAS
FT                   A"
FT   CDS             45889..46146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p42"
FT                   /old_locus_tag="SAP1_42"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p42"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75326"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD9"
FT                   /protein_id="BAC75326.1"
FT                   /translation="MRSSTQLDTATTATGSTRLSDSLCTHTPTCPSATSSDREAAHVVA
FT                   AHPEQGWSLLCNGVLLFEDTGELLPDGQVVAPHRHLAVVA"
FT   CDS             46230..46616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p43"
FT                   /old_locus_tag="SAP1_43"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p43"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75327"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD8"
FT                   /protein_id="BAC75327.1"
FT                   /translation="MTRQGVAVRDSAKSTTPAIKFKQGQFVLYRDPEMFWTGQAGHTFV
FT                   CRVQRTWLEGTYDLVAVATGRFVHYANADYMRLLPAVDAMRDIDTAPLNTDGAADDMTA
FT                   AAIAWLTQQHATANQRPELPAQRD"
FT   CDS             46672..48876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p44"
FT                   /old_locus_tag="SAP1_44"
FT                   /product="putative large alanine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p44"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75328"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD7"
FT                   /protein_id="BAC75328.1"
FT                   /translation="MAATRTRNKRPTARKKLAATRPAPQPTASPTPDAPETPAGTTEAE
FT                   VDFEASAPVADARDRAADVIDTAREQAAALQAEAESAAARTVADTHAKVTALMTEAQTR
FT                   AAGITADAGQEVTAQRTAAKSDLEAARGEADRLLTEARDRAETLVKEARAQVADLTELA
FT                   ATDREATGKAVAELRRMAEADLTEISALVDQRRLEAGQILARAQEQADELVAAAQREVD
FT                   QARERFAQLAATAAEHYDGRRAEAEALYADAVKAADDRRREADSYVAAAHTEAEQVRTE
FT                   LREKLRELTDQFDTEAAAKRKALADELAGLKQACDKQRERLREEAKTVAVQLREAAQKE
FT                   ADRITTEAERKAKGITDRAQADEARARRLLEEARAAKRANSRFRGWQQNLSRKAWKTAP
FT                   WIALAAGVGLAASGEYELARMVGINQYVAPLLPVSIDVYCVTAFRAKKDIPYALLLMAS
FT                   ANVTYHLSEQAHIVKEGQSAPWQLTTFVVLIFVAVIWRVHTLMHDDGTNGHGSTAAAGG
FT                   RTGTDSGNGTPARTGTHRRTDGTDGTSSSRTGAASPDLYTARSTVRPQGMGTGRDGTDP
FT                   VRPASHPPHDDGSEAAVTRPYSDRTDGVHTTPDGARRTGTAAAGRTGTASAAVQARTGS
FT                   VSVRTQSGGDGVPEARTGTGAASSPATGTSGAAGADRPGTPVRTDAELLPLVQNLPRDE
FT                   DGFVTLYQARTKLSVNQSRAVRLLKEAGLLRPEDADKHLR"
FT   CDS             48992..49468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p45"
FT                   /old_locus_tag="SAP1_45"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p45"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75329"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD6"
FT                   /protein_id="BAC75329.1"
FT                   /translation="MNSNSDPNYAPLRDVAQSPEATARYLADVQRVLLDIGKNLETLAI
FT                   ETRVHLRKTHVEGDRWYHARMRAMPVEKALGNVLKNLNNLTEGLEKSAYKRRAHDENVV
FT                   NTVKGRKEKELEKQRKKNPPTLQAAPNPPQQGAQSENSGYGGPTSIYDLGRESA"
FT   CDS             49465..49773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p46"
FT                   /old_locus_tag="SAP1_46"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p46"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75330"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD5"
FT                   /protein_id="BAC75330.1"
FT                   /translation="MNRPLSSAERSAERRQNWLKEEAKKARESRGEAGLMEFWLRLARS
FT                   RMSKDVKAGRGDVYSGFALICRLFITALDQRVEGNGRIWNDLLQYAEQVVAKHPPRN"
FT   CDS             49901..52117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p47"
FT                   /old_locus_tag="SAP1_47"
FT                   /product="putative ATP/GTP-binding Ala/Gly-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p47"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75331"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD4"
FT                   /protein_id="BAC75331.1"
FT                   /translation="MSDEDGTGTLVQGPWSGDSTYVPPPIPDYGDTIPPPEDIPPAPPE
FT                   SPEEMTMELPTIPAAPDPSAALRSEGITAPEISEDDGECEEGEYEQPRSLADRLGDWLE
FT                   FRLEMARANHESETPFREAEIARKAALLEGRTAQEVAMMEQNGKLHAAMMKAKGDKAAA
FT                   RGKADADRTKASGSGLGADKGRSKAGGGGGSSRGGGGSGPSHNNSGPGSNRSGGSRGPN
FT                   SGGPGGRSGSGSAGGSGGGKGGTKGSQAGSGGRASGPGRSGSSGGSKGSQAGSGSSGRN
FT                   GNSRGDGASQASGARAERARGRQERAGVRQAGRQERRSAGHAAGVADRSKDRDQARAQR
FT                   QQAWEGRRAKKAERAEARKAKREAAASADSGRTTLGQAVGEEAQRRFDKRRADAKAAAD
FT                   AKDAKAGTEKVSLTKDKDSKGKGTDDGKSTDGKDGKSAKDGPDGASSAAKDGKAGDAPG
FT                   ADSTAGDGASDGAKKRRRFRRRRTGGTGRAGRRGRTRRTGRTSRTGRGRTGRSRTGRRG
FT                   RPAASPFGEEDSTPTVDFPGRPTRPPRTDSKGEDDIVDADIVPDKPAAVTTGVRGLPPT
FT                   PEKHTARPGTSRPTSTEGSSVSSSEVSSPSGAGGLGVQHRTDITFDEFLMEMANIAIQA
FT                   GMDQERAEALAEALAKVADALRDMATDLIGDHNISTQVTNLITDLADSAARMKQQAERC
FT                   AEQCGIAKEAATLAAAMVARIYGQDMAAKEDAGLKFASAAAHHD"
FT   CDS             52137..52553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="SAVERM_1p48"
FT                   /old_locus_tag="SAP1_48"
FT                   /product="putative plasmid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p48"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75332"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD3"
FT                   /protein_id="BAC75332.1"
FT                   /translation="MSDLAPHNTSAAPAPADGDNRYKAVQAKLDKLGRAMDDAVLELES
FT                   LRRSMQANASRTEDVARDIANAGLDVKFVELTNNVAVALGGAAVQVRKLADTAEETADL
FT                   THQTRRTHSTLYGALDDIRSNRREKTPRPGFFNR"
FT   CDS             52635..54779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="SAVERM_1p49"
FT                   /old_locus_tag="SAP1_49"
FT                   /product="putative plasmid transfer protein
FT                   ATG/GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p49"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75333"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD2"
FT                   /protein_id="BAC75333.1"
FT                   /translation="MTTPRSVALERLAYTLAAPLLAVAPNLYSDSPVNQVVQLAGAAGI
FT                   GGWFLAAKSDEPGAGRKILRWFPLVLAAAVDVAAGHTTGFGPYWMDGLLAAGWAAAGYL
FT                   VMPFSRHTRRRHRPALAAPAPQPAPAEVLEESVAQPDDGADLLTRDARLLWEQAGMPGR
FT                   THIVKATRHDGQRHDMTILLRASETGRPITGLSEAAVAAPFGVHSSDVVLAEVAIQPGR
FT                   QGGPGWMEARITPDANARRRTKPTAQERWTDRVGGPKGGAPGSELVHKTRDDERGVTFY
FT                   RAKMADSTETPRIDLAKVCRALNLPEDDSCVFVLIDGSEFLISAFDTPPLSAIFPATRE
FT                   LLTPNAKGMYVCGFTITGQPVKSMVYQHDKNAAAHGLILGVSRSGKTQYFAINMAAQSL
FT                   DGQVVWLSTVRKDEKTTVLGRYIDRQGSNALWMARQLRAAKALCEIRAEMPWPHDGQPH
FT                   DYKPGDTRCPYRQLNVYADEFMTAAQDGDFGEFIQTDGDDLTVTGLKYGIGFNPAGQSP
FT                   FAHNGFSTEMKDNLRQNSRPVIFNMGSPGATRKAAEGTMENAYDVPTIPARYSRNEGSA
FT                   IERAIKGEADPENGVSTGGVAVIVLDNGRAVLMRSLYADFDTDLSELFPDEVNRLTDYE
FT                   ISELDRRGLWFDWNEPVRPGEFWPEPDEDDEGEGRSRRRGGGGGGKGGGGRGSKSGNRR
FT                   SEQVASPRQALEAIKNLTDA"
FT   CDS             54860..55048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p50"
FT                   /old_locus_tag="SAP1_50"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p50"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75334"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD1"
FT                   /protein_id="BAC75334.1"
FT                   /translation="MALSISAAVLLGIIVVVLVKGGYVRIGSALACTLFGFTLAATGLA
FT                   PTINSGLASLAGLISSL"
FT   CDS             complement(55049..55303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p51"
FT                   /old_locus_tag="SAP1_51"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p51"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75335"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YD0"
FT                   /protein_id="BAC75335.1"
FT                   /translation="MQQVSWGWRVGSHRTCAPGILEADRRGEGDRVEFVFECGWCGGDN
FT                   FFVGKQVGFWVDKWEVPSEWDCRFCDGLNYTHDPPWTEA"
FT   CDS             55435..55929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p52"
FT                   /old_locus_tag="SAP1_52"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p52"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75336"
FT                   /db_xref="GOA:Q82YC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC9"
FT                   /protein_id="BAC75336.1"
FT                   /translation="MDPLHNTQSDMPESEAAAEARRLIDDWASKPVRHHPTSFRDDTEP
FT                   PAFGTTPPVRQEDHRIVPAWAAGIAVASIGVGAGVTGIGCGAWLVLQGLSSVTLNGVLM
FT                   VTLPFAGIAMVATAIGGAISKARAAVTKNVFEGPVTHHTEIHNNSTTRGAFFARTRNEI
FT                   R"
FT   CDS             55992..56792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p53"
FT                   /old_locus_tag="SAP1_53"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p53"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75337"
FT                   /db_xref="GOA:Q82YC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC8"
FT                   /protein_id="BAC75337.1"
FT                   /translation="MPNNDKPVNGQENPSFFDLIDQMPPPPVLELDGKPGTRRLARLRA
FT                   AWKESWEEGGFLYQRWEEVFQARHGSWHEVANWIKAAALFGGLSLIVMMLDAAGDIASV
FT                   TLKGLSAVPATDGGDGSGLWGTVDHPIRLFLADQAAHLSVAPAALYAFWQLTGLLGLVG
FT                   GFFGNAGARIAWLLFGIGSLAMIWSTAPAGGRAAATGLAALMWALASIFALRGLTLRPI
FT                   VHNHPPQFMPQFNPTLHLHATLPAPAPAGDDFDDEDDNVHPLQR"
FT   misc_feature    56656..56664
FT                   /note="DnaA box-like sequence [TC][TC][AGC]TCCACA;
FT                   TCGTCCACA"
FT   CDS             56873..57118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p54"
FT                   /old_locus_tag="SAP1_54"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p54"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75338"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC7"
FT                   /protein_id="BAC75338.1"
FT                   /translation="MTLQTNEFWVGTYHGRHDGRLVKVTATRDDTRLEPYAWTCTCGAS
FT                   QTFPTEDGVDRTAWRHTHPTLWDRLRQKAALLLRTR"
FT   CDS             57364..57831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p55"
FT                   /old_locus_tag="SAP1_55"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p55"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75339"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC6"
FT                   /protein_id="BAC75339.1"
FT                   /translation="MMTRARKKRRPREVKRVPRSDALLPEHDRGAVPEGLVTRRQLRDM
FT                   GLSPGGNDGPVAILRCKWCSYRPQWSCIHPTRGFLLRVDLAVPKRVPTLAQEWALDRAM
FT                   AARQTCSECRRRFYICLSKKLGCCLECFDGTPADPSSLMTAPASAAHRLAA"
FT   CDS             57828..58457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p56"
FT                   /old_locus_tag="SAP1_56"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p56"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75340"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC5"
FT                   /protein_id="BAC75340.1"
FT                   /translation="MSRTPSRPHRPGRGPYNPGGRSTGKGRPPAPSPLRDQEKPSMTHR
FT                   SAPFAAVLGLGRAGSNIGDHFVQSDYCARVKGATDAKPVHFAATPDDEPTVHGTADGIK
FT                   ACAWHCLTYTATQALAVGVGARVLGIRLHPGAAAAALALSFATHYAADRRVPGGLLETL
FT                   ATKTGKGNFWRLADHGINGAYCLDSAWHHGWETIAALIAATKATTR"
FT   CDS             58454..58804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p57"
FT                   /old_locus_tag="SAP1_57"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p57"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75341"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC4"
FT                   /protein_id="BAC75341.1"
FT                   /translation="MTARSRTRLERVRGSLGIAQLALQQIEDDLKADDVDARELAAILR
FT                   EIQEDIDMPGGLFPALAQLVSTAARRAEQIEPDRDGDASCYLHEAAALITDNAGQRLNW
FT                   AARSLHPQGDDA"
FT   CDS             58801..59757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p58"
FT                   /old_locus_tag="SAP1_58"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p58"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75342"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC3"
FT                   /protein_id="BAC75342.1"
FT                   /translation="MTVLYPDLPENGLIVLIGASGAGKSTLARTRPASQVLSLDRLRGV
FT                   VGDDPGRQDATGDAADVLKLILERRMARGLNTVIDATNCEQPIRVELVTAAKRHGMPTV
FT                   AVIVPTPLSVCLERQHPRPANRRVPQDVVRAQHKAMTYSHQQLAAEGFNTIVFADNLYR
FT                   LEPLLKRLSERREADLGRDGGKGLGDLLLVRRFFGPAILPLWRWRPGSDLVTGRDRVAE
FT                   IRLGQQYLTLAYRADVDSEGDFGFDVLLPCPVDPECAGQAWAPVYSVTDLHKALTGAMD
FT                   SDPDLVCTVHGDGADDDQDDDPEGRADLQAQFADAVA"
FT   CDS             60014..60370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p59"
FT                   /old_locus_tag="SAP1_59"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p59"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75343"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC2"
FT                   /protein_id="BAC75343.1"
FT                   /translation="MVPQHRGTNTEQRKELDVMHLRTYEVDVPIHDTTDPDRRGLHVFT
FT                   GVADSPAAALRRAHEVYDAALAAHTAGLEVPGKQPDNWGARGLRPGWQMEWPAAKAGLW
FT                   HNPVSWTTRSDFAL"
FT   CDS             60537..60980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p60"
FT                   /old_locus_tag="SAP1_60"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p60"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75344"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC1"
FT                   /protein_id="BAC75344.1"
FT                   /translation="MSLATLPEGDWIRGITIRQPWATCILAGKSPENRPANWPWRGWVM
FT                   IHAGKKKPEPAVLRDPLVATAIRGRELHLGAVIGVARLTDCHVDLGPERCTSPWAERDA
FT                   HHLVLADVQELALPVPATGALPAWKPQLDLVEQVFQQLPDFRL"
FT   CDS             60977..61258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p61"
FT                   /old_locus_tag="SAP1_61"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p61"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75345"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YC0"
FT                   /protein_id="BAC75345.1"
FT                   /translation="MTGRRSKKPLFEPGLIPVPGALLDWRDNQHFDRWQDRPCALCDKP
FT                   TPMRSHYGEPVHKACAEDWIAANPTEARLGRFASDVQPKKRQRDDDHA"
FT   CDS             61281..61454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p62"
FT                   /old_locus_tag="SAP1_62"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p62"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75346"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB9"
FT                   /protein_id="BAC75346.1"
FT                   /translation="MSSTQREVDHALAYPEPPASPLWHRHGAKARPLTDAQKQRNRELL
FT                   DLAQRKPRTTAA"
FT   CDS             61468..62430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p63"
FT                   /old_locus_tag="SAP1_63"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p63"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75347"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB8"
FT                   /protein_id="BAC75347.1"
FT                   /translation="MFTDMKEALEAEALELTPLGSDQSNAASLVVAHQARDKDDLADLL
FT                   GALGLPCAEDDLVRLLPHLTNPNDDIPTGDPMTANAFTATAASMLTNGDSPEHVRSTLG
FT                   LSESELAEAVKHAELPVPTATPVPETDDSASAPAEAVKHAEPTAAPDTDASASASAPEA
FT                   VPAPVSDDTVDTDGIEALLSWAESHPAASIRNRAARVRSDLTELTERRATDAAQREAEE
FT                   RVANAKAELEAAQAQLRAVKAGGHTATAVQDATPLAPAPAPAPAATATGQRSKEELAAI
FT                   RTWARANGHQVADKGNPAKKVLDAYDAAHRTANLAEASQ"
FT   CDS             complement(62451..62912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p64"
FT                   /old_locus_tag="SAP1_64"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p64"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75348"
FT                   /db_xref="GOA:Q82YB7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB7"
FT                   /protein_id="BAC75348.1"
FT                   /translation="MDVLIRSARATEADVLTDLALRSKAHWGYDADFLEACRDELTVAA
FT                   HEVARRRTTVADRDGHILGFTTLEGEPPTGVLGMMFVEPQAIGQGIGRLLFERTIAAGR
FT                   DLGFTQLTIDADPNAEPFYRAMGAVRIGNVPSGSIVGRVLPQMVVTIQR"
FT   mobile_element  62973..64282
FT                   /mobile_element_type="insertion sequence:ISSAP1-1"
FT                   /rpt_family="IS110 family IS900 group"
FT   repeat_region   62973..62990
FT                   /rpt_type=INVERTED
FT                   /note="18 nt imperfect inverted repeat (15/18 nt)"
FT   CDS             complement(63009..64202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p65"
FT                   /old_locus_tag="SAP1_65"
FT                   /product="putative IS110 family IS900-family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p65"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75349"
FT                   /db_xref="GOA:Q82YB6"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB6"
FT                   /protein_id="BAC75349.1"
FT                   /translation="MSRIWAGIDCGKTHHHCVAMDADGKTLLSRRVANDEPELLQLLGD
FT                   VLDTADGREVTWALDMTGGEPGLLIAVLINHMQELLYIPGRMVNRASDAYRGEGKTDAR
FT                   DARIIADQARMRRDLRPIRPGDEDTIELALLTSRRIDLVAERTRTINRLRSVLTSMFPA
FT                   LERAVELTNAGPLVLLTGYQTPTALRRIGLNRLTTWLRNRKVRGAENLAKAAVEAAERQ
FT                   HTAVAGEKVIAQMVHTLAKEVMALNEKITGTEKLIEGRFREHELADIVLSMPGMGPKLG
FT                   AEFLVAVGGSLDGFPTADRLAAFGGVAPAPHDSGKTSGNLRRPQRYHRRLQHVFYTSAL
FT                   VSSWSDPNSKRFYDRKRAEGKSHIQAVLALARRRVNVLWALIRDRRCYQVEPPATAC"
FT   repeat_region   64265..64282
FT                   /rpt_type=INVERTED
FT                   /note="18 nt imperfect inverted repeat (15/18 nt)"
FT   CDS             64439..65188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p66"
FT                   /old_locus_tag="SAP1_66"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p66"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75350"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB5"
FT                   /protein_id="BAC75350.1"
FT                   /translation="MDAIPFALDGYLAADPEPGDGEDTASWRLNCSAGTDHLMEEAVIP
FT                   CTTTQPEIAHTLLTERQPGDLLRVSGHLTLPDTADGVIQLHADTLEVLWAAPVLDGDGD
FT                   DADTATTTDTDADRNSAIAALADALTSLGQAAPGSGQSIRIHISPTGTLGSGLEHCHHF
FT                   DLPPALAHRLADYIDAMNCSLDSQHPDGVVLDPETIADLTDLFEDIDLIGLTNTVLNAT
FT                   RPEYRPAVTQAMDDMFGDIPAPEDTDP"
FT   CDS             65221..65397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p67"
FT                   /old_locus_tag="SAP1_67"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p67"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75351"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB4"
FT                   /protein_id="BAC75351.1"
FT                   /translation="MPPQPQRSVLERFPAGGPRGSWPAEEYAAAQRAQGTDAQVVMDLR
FT                   SDQFLVVTGTVPQ"
FT   CDS             65485..65925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p68"
FT                   /old_locus_tag="SAP1_68"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p68"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75352"
FT                   /db_xref="GOA:Q82YB3"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB3"
FT                   /protein_id="BAC75352.1"
FT                   /translation="MRLIRLISFGYLHLPTGPDGSPVPPAADRIEDVRDRLRDPAAARD
FT                   ILDLDGLNPRVQDVVLNTPGARELIANLADYADLPAGPSRIAIGCAGGRHRASGLTEIL
FT                   ARTLRDRGREVEVEHLHVHLPRVLKTPAHGTAHPSSTQEATR"
FT   CDS             65922..66545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p69"
FT                   /old_locus_tag="SAP1_69"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p69"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75353"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB2"
FT                   /protein_id="BAC75353.1"
FT                   /translation="MKRPFPRCGHTPGALSPEDQAAVNQFRALLAALRDMEPWTPGLYR
FT                   DIAVRVGPFVERAHPRPGDDHDPDLIAVSLVHPDTPHAAAYLHGHQLYTGRGWLRCETD
FT                   KILGVWHPALTPLTHAAAGLDLPDDVGMSLAHYAVHVEARRKDNSGRIMLRMGPYTQTW
FT                   LASRDADRLNTLLEGKAATVVPGFTVTAKAAPFDVSDHESYDDP"
FT   misc_feature    66661..66669
FT                   /note="DnaA box-like sequence [TC][TC][AGC]TCCACA;
FT                   CCCTCCACA"
FT   CDS             complement(66759..67790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="SAVERM_1p70"
FT                   /old_locus_tag="SAP1_70"
FT                   /product="putative plasmid partitioning protein, ParB
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p70"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75354"
FT                   /db_xref="GOA:Q82YB1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB1"
FT                   /protein_id="BAC75354.1"
FT                   /translation="MSKKDQLGRGSSFGSTSNRSARRNAINETINGGVGTADLTDLPVP
FT                   AISDNPDNPRNHLRNLEYTVESVREVGVILPIVVGTVDAYVRSRPDRANDLDPGAQYVV
FT                   IDGHRRLEAARQVGLATIPVRVDDARLSSDEKLLESAFIANYHREDMTDLEEAHALKQL
FT                   VDYYGGSQTKACRRLSMSASTLSSKLSLLKLSPELQKDLMTGERKTEHVRNLSKLSPEA
FT                   QKAKADERAEASKRRARSRQQPAPEPADFHAVKNHSEVTAGVLEQLLPAADGQDPPKES
FT                   IPEPRGAEGRDGQQDQSAVKKFPYHDGFEAGTLILFKMPPEERDKVCDMLLRDREKRAA
FT                   NAD"
FT   CDS             complement(67787..69070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SAVERM_1p71"
FT                   /old_locus_tag="SAP1_71"
FT                   /product="putative plasmid partitioning protein, ParA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p71"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75355"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YB0"
FT                   /protein_id="BAC75355.1"
FT                   /translation="MASPYPDGDREKVASKLPPALQQELKIRCAEFGLDIQDAATTAIT
FT                   NWRASDWSGADVDTSGARSFSTWLPTGMYDDFKASCTERGLSYIQGLAQSIRSWLDDNP
FT                   SPKQAGLPAPPRRIIVCNQKGGVGKTTISAGIAEAHAEPQGIGVKCLQNFVQTLTDTEL
FT                   ERLNRTREQLLALIADYTAGGQRVLLVDYDPQLHLSNQLGIPPIAVGEDSLVTHMSGDA
FT                   QGDIKDLLVAIDDPRFGGRLYVLPGTREAFLLDSKLALTAAQSRGFQKEMALERALHSL
FT                   EADFDVIVVDSPPSLGLSMDAGLYYGRRRPNEKPGRSGVLVPVQSEDSSADAYEMLIEQ
FT                   IEDLETDLHLEIDRLGIVVNQFDSRRGYIATSSLEEWHNMENDRVIAVIDDLKEQRESV
FT                   RLKRPLLAYVPESKQANIMRLIVAGVGK"
FT   CDS             69221..70444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p72"
FT                   /old_locus_tag="SAP1_72"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p72"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75356"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA9"
FT                   /protein_id="BAC75356.1"
FT                   /translation="MTPGRSAQRVGYAAPQTAAARPCSLERHRPTGVHLRAAKELSFTP
FT                   QPRAPSTRLTARSPYRRADWYGESGPLMRSERISRLAARRQQYTNETYQQARNLLRPGR
FT                   PPIPDADCDKQRNFEADLFHQLIESNRDFTAYPFGIRRVSPKPDTIELVVESEQRARRL
FT                   LSWLLPCYEPGGEVHGVLGLRIRQRTVRGVELHLAGQRTSVWLTGPHRDVWKSAENESL
FT                   EHVADLGWKALWRGPEHWSAEEVAFEHEWNTGEWTRQFRAGAWSASGLLRRLGLFRTLT
FT                   AADAVTGYKGLGINGYDGSGPVRWCLDIIHRSGIRHRKQHLIEAITDPEFGLPVSRADH
FT                   LDAIYPPETMENWIRLDDEARTGLIELRFTTCDYEQLQLSTCGPEYQAIAEAVERRIST
FT                   ATQRLGPG"
FT   CDS             complement(70500..71348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p73"
FT                   /old_locus_tag="SAP1_73"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p73"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75357"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA8"
FT                   /protein_id="BAC75357.1"
FT                   /translation="MAHSGRRSASATRRAFSGEHRQAAARGVPRGCGHLGFDTSDLAQQ
FT                   RLRALLALGIFNGGPLQEWPGMWAMASVTHYDLILSPRPDDLVVITPTPSNVLTYLVPR
FT                   GKPVGLPGLRLEEARADAFQLRHLVTGARMTVTDRPPVPPFDGGFDEHRVWTVDQGLTG
FT                   EEHDALADVPPMTDDTLVLLSGLVTRIGLRDPQRQWALGNWFMDPLDRTSAWGGRVGRR
FT                   LWGRGDWWELTWGSFPFAEDVAMALTDPQAGIAGAHAVRVRRGWEVQVGTAVLALRVEE
FT                   G"
FT   CDS             71473..72894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p74"
FT                   /old_locus_tag="SAP1_74"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p74"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75358"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA7"
FT                   /protein_id="BAC75358.1"
FT                   /translation="MHAESSQPAGNPTIPINRHNQVSTGSIGSRPEPHRWADSTPHQPY
FT                   GSTPEAKQRATPTPPVRCGRLLRGLPGRPSFAGPPPDPVPQQPLRARRSKAPPREHQRL
FT                   PDPAPSICAPGSDGARIRMTMSHGNALTQKARYRSRCTGIGHQACTQQHTTAEGQHPVP
FT                   DSGPDQARLEAQVFEHLGGTIDYCAHPAGIAHVIPTGTHLTVALDPKLGPNHRLSQHCL
FT                   EALLPTIYTGTDEDPEGPGSAVGVRLRGIDADGLHLGLADTNARVTLAGPSQAEWTTAL
FT                   ANHRARCRESHLIPLWDTPGLSEPERRYLDGDPAWWKEQADTAWLASGLLRRIALFHTV
FT                   TKPYCVRYWRHGLGWRFELRYEHGLTVEHNTLIASLTHPKWGMPLQVKRDHCSCKPCAC
FT                   DGGAERNCWFTLEMPDGQGEVGMHFRRARADFDASGTYERLVTAGANARWLEQVLPAHH
FT                   SRLSLRTRLTTGELV"
FT   CDS             complement(72938..73228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146FC12"
FT                   /protein_id="BAU68548.1"
FT                   /translation="MCTLPPVEITRDAIACALCHTPTTELVYLVLSAQSPYPQREDVKD
FT                   RWCPAAATGSIPSDGRRRCRYCPATTPDDAVRMLRHDHTCPTHHGSVPIGI"
FT   CDS             73370..75196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trwC"
FT                   /locus_tag="SAVERM_1p75"
FT                   /old_locus_tag="SAP1_75"
FT                   /product="putative relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p75"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75359"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA6"
FT                   /protein_id="BAC75359.1"
FT                   /translation="MISMSEVRPGNGWRYLFRGVMVGDGHRPAGKSLRAAQDEAGVPPG
FT                   VWKGRGLAAVGLKAGDVVTERQAELLLGEGRHPDADRIERERLAEGKSPAQARRATVLG
FT                   RPIEHNQSPKTDKAKERTPWLGFDLVFRPPPTAHIAWALGDYETRLVLELCQDIARDKT
FT                   LAWLGEEVAEIRWKGGGKHRARVRDGLIVAVFRHYESRAAESKPLLHDHAVVSIRARRP
FT                   DDKGTWGNLSADSLMAHIVAADTLYTLYFMEEVSARLGWAWEPREVTPGRRPVMELAGI
FT                   DQRLIGWQSTRRQQIEDALSVLTANYEKKQGHPPGERAGYALGCQAADQTRSPKRTELL
FT                   SLTELRERWRDSAIRAYGVDVFDRLAERARAAAAAVWARVRPVVDIALAAVDVVAVVYV
FT                   MRGAFKRHHLLAEARRHLSYVLRGRPHRPGLDEQIVQAVVDDYTRPVGRGRMMTADLRA
FT                   LYPRDTEDQAVLRPLTRKRSAPPYERARLAAGALAARVNAARRAERLGSRPRPYAVAVP
FT                   AASRSHPRPFRTGPKAGRLLEPETGVDAVEQTRQTLEAAAAKVAATIQDSRRAREAAHG
FT                   LRSQPAPAAVPPPHTQQPGVQHTPGRSSGGVA"
FT   CDS             75193..75540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p76"
FT                   /old_locus_tag="SAP1_76"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p76"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75360"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA5"
FT                   /protein_id="BAC75360.1"
FT                   /translation="MSTPEEQPNAEEALARARAARAEIAAALDEDQEPEADEPVGWQPV
FT                   WKRPRTPKSKADKKKELRKQRRRLQDAAKRRLAAGNSRRPRSQQSRIGNAAARRDTRAL
FT                   SRVRHSNAWLW"
FT   CDS             complement(75821..76372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p77"
FT                   /old_locus_tag="SAP1_77"
FT                   /product="putative MarR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p77"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75361"
FT                   /db_xref="GOA:Q82YA4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA4"
FT                   /protein_id="BAC75361.1"
FT                   /translation="MDLVPFEYKAFVFKGIWKRSLMSTESDGPAVNEAVRTLLLLMPRL
FT                   VGRAKRLPIPRALQGLDLAPRHLALLAHLEYDGPTSINELAARLEVAPTTVSLMVSELS
FT                   RPGVLQRTADPADRRRRIIAIAPAYAAPIGEWLSGSASAWERVMHGLDPAERATVITAL
FT                   HAYEAALEQAGDPHGNAQLR"
FT   CDS             complement(76391..76693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p78"
FT                   /old_locus_tag="SAP1_78"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p78"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75362"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA3"
FT                   /protein_id="BAC75362.1"
FT                   /translation="MVPARRSSPTTRVIASVSAVPRRAVIWAASGRSKTPARTPKITEA
FT                   FVSTALPPCAKRPAGTPVRRTLTRSRTHSPYTSTTASVSAAASIGSFPVSLFSGR"
FT   CDS             complement(77122..77331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p79"
FT                   /old_locus_tag="SAP1_79"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p79"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75363"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA2"
FT                   /protein_id="BAC75363.1"
FT                   /translation="MRTTAGRRTAPRAPGAVTASVVRAPAHRIIHRGAHHRPHRTAPGA
FT                   RHGAAGSYITHPLVLDLIVSPDQR"
FT   CDS             complement(77375..77812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p80"
FT                   /old_locus_tag="SAP1_80"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p80"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75364"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA1"
FT                   /protein_id="BAC75364.1"
FT                   /translation="MPENTVTAPLAPMEPEDVADAFAYIRALQADDIDTACAVADGTGP
FT                   ELHRLLLDVAARVFIPVTAADDCDGEPCPHSFLAAALGRLLLELLCHGLANAPGIADTI
FT                   IRFTDNILTEDRGDVADVLRQLEAAGMKQAMEAHPAHHTTA"
FT   CDS             77865..78545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p81"
FT                   /old_locus_tag="SAP1_81"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p81"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75365"
FT                   /db_xref="UniProtKB/TrEMBL:Q82YA0"
FT                   /protein_id="BAC75365.1"
FT                   /translation="MLGSRPCGQSPRTDGERTRRATARVTPLSSSATCDIPSHSGRKKS
FT                   PSRHAARRPAEKPLPPGARRWETSGMTTQRLPFPVPDERAHLFVDSYADMHDLVEDLVV
FT                   PDGVPEAAATVLRTARELLRQSYYCYEFSTVAVMHSLIAVEIVLRDRIPDAGKKPLHGL
FT                   IKQGAADGILTARQAEYLDYGRQIRNGMAHGQTTHAVMPPAMAVPMVTTSFAIVSELCA
FT                   TPTG"
FT   CDS             78662..79711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p82"
FT                   /old_locus_tag="SAP1_82"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p82"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75366"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y99"
FT                   /protein_id="BAC75366.1"
FT                   /translation="MTYASSARQPDPEPRPAWSRGAERPPGGPESSAVNGAANDSNVVP
FT                   ITAAHTARQGASRHADTSPETSAKGKKSTPTAGKVRADALRMLGCVRIATVRQMASVIT
FT                   AEESDGRSYVRRAMKELAELGLAETNGKAGKHPIWNLTPAGQKALADGNELPPRPKAGT
FT                   GAKAVKAGFGPHGVAVTDTILAFGGRDHLTDWQVEVNHAIKETGLSFNTDAVLAWPTKT
FT                   SEVRLFELDNGSMSQARLAREVWDYERYAGHRVWEGARGTIGGTYPFWQRHRYTRSKTF
FT                   PRLHVVLAGKAEHLLDNRLQALAADVKGIAVAVWVNTLPRLQRGEPWYEIGVDAPDRRR
FT                   RRYPEPAGR"
FT   CDS             79927..80568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p83"
FT                   /old_locus_tag="SAP1_83"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p83"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75367"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y98"
FT                   /protein_id="BAC75367.1"
FT                   /translation="MASKRGTGDEMRGTIRVAAAAALTLVIVGCSSNADAKKDTGMNGG
FT                   GGTDPTASALKFAKSYQEAVNNRDWQHVCQMRTERYRHGTVKQCVADNKEPAAPTPSES
FT                   ETSAPPPLVRADGSTVPPKQKPTASGPDRAQLGPIKASGAKAVPAFGDHPAGTGVMVEW
FT                   TYTWPNESGVSKDVLRVVRHGDKWLVDQMEEVADSDEAHGDPVGDALMRS"
FT   CDS             complement(80518..81579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p84"
FT                   /old_locus_tag="SAP1_84"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p84"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75368"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y97"
FT                   /protein_id="BAC75368.1"
FT                   /translation="MIANSRNNDSHGTAPGRAHLTIPAQVAPSTGCRRVEVPGFPCNRA
FT                   AHPRQWKQDTPGVGLPSGRACSRAENNGERASGSRLAAVGGQARAETVRQDSRTVTRGT
FT                   DTPPDTGATTAKSGISTGPNVIGSSSVRCCPSRSHGGVRDAVWRGGGGTRGGGHGAVCR
FT                   TARPGGRCWRSWRSRGWIRGPGPMCVTRAPWRRSGRRSDGVAGSSTCRTPVRSRSVTSV
FT                   GRADHLPFRSAGNELRQQADPLPSTPAEFLGPVPELALEDQVVAAATVWRTRSARSEVE
FT                   PGRWVHNQTSKPRKHRGAGRPGSRVSTTATSLRKVTSEVPNIKVRCGCPRPQQGVLSTP
FT                   HQGVPDGIAVRFV"
FT   CDS             81600..81701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p85"
FT                   /old_locus_tag="SAP1_85"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p85"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75369"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y96"
FT                   /protein_id="BAC75369.1"
FT                   /translation="MAMLIDLPGGGLGTRLPGTPGGFRMGRPGIGRP"
FT   CDS             81711..81926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p86"
FT                   /old_locus_tag="SAP1_86"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p86"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75370"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y95"
FT                   /protein_id="BAC75370.1"
FT                   /translation="MTKQVLIITATVTVFAWSVVMVAIGQVAAIATLAPALGLTVHQIA
FT                   LAARQQTAPASGHRVAAVPDKEGSAP"
FT   CDS             81923..82828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig"
FT                   /locus_tag="SAVERM_1p87"
FT                   /old_locus_tag="SAP1_87"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p87"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75371"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y94"
FT                   /protein_id="BAC75371.1"
FT                   /translation="MTTPFEPPAPPPLRPAPARPGRKLGPIAEELSSAHRAWLGPMRET
FT                   YLTSGLTLSELSARVRLAKSKISELLRGIGLYPRWEIIFSLSRELNMPYWPLYRLWRQA
FT                   ALEAHKSREWVERCSEKTAVTMSHAAPPLDHRAFRELVESFYSLYAQVFLEDEERDTAV
FT                   SDTFDILWLCWNDALASPDTRKFAWNVLRATVMARTPHVDGRPELGWAAFDTVALQSVI
FT                   AASDRAEQIEETLDLFKAMSRLPDHQLDVMVLRRLCGITPEDASGLLGVPLATVRSDER
FT                   HAVHFLESVICPPETEGKTA"
FT   CDS             82825..83700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p88"
FT                   /old_locus_tag="SAP1_88"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p88"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75372"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y93"
FT                   /protein_id="BAC75372.1"
FT                   /translation="MTRRIEEILSRALLVRHRTVPRDIVPFSPRKDRGTQPAGEPSHKP
FT                   GQPNAAAEDLRALCETLVTHTPATAVTDFVTDQVPQPRSALVLACVLQLTDTDEGARFW
FT                   WQYAAGAGQAAAAYCLYLHHLALGESDTADWWHRQTDDVQPPPGPPAEDTPTPSPEAAP
FT                   SAWHPADHRITNTSTTTILRILRHLAKYSARPRSAAVTELMAYVPTAVAVGYLRQPEMD
FT                   LPTPGADFARRISTLLATAADRPDVTNTLPARPDSREHASRDAARPLAGPSPAETSKTA
FT                   HQQVGETAKR"
FT   CDS             complement(83768..84670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p89"
FT                   /old_locus_tag="SAP1_89"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p89"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75373"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y92"
FT                   /protein_id="BAC75373.1"
FT                   /translation="MIGVEVGSGDRLALGVLSQYRMATTEQMHRVIAPSVRIEQTRRRL
FT                   ARLRGEGLVDRITLPQAGRTRVWFPTAYGVQLVSEWPEMRGHRPSRTVSDPTAVRLKAG
FT                   HTLTVAETALAFLEDARRHGDLFRPLDWIPEVHHPIGSGEAVIPDALLYYRRGPAGGDN
FT                   GSMLRAFVEVDRATMGPERLAAKLPAYERLYRYVPAVSGRRPTLQEPTLEEWRRRYPLF
FT                   PRVLFVLDGTGPAGVENRINALRSGSRLLMPSGFLHDVPVLVAPLADLLQHGPSAPVWR
FT                   PVHDPDQRVHWTGSARPQT"
FT   CDS             complement(85072..86049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="SAVERM_1p90"
FT                   /old_locus_tag="SAP1_90"
FT                   /product="putative ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p90"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75374"
FT                   /db_xref="GOA:Q82Y91"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y91"
FT                   /protein_id="BAC75374.1"
FT                   /translation="MTWTLPEPMLSTPVPKPELRPGWAGEPKWDGFRAGVSVNAGRVVL
FT                   RSRRGTEMGPAFPEVVAGAVQLSEATALDGELVVWDAAGRLAFERLQNRLARRGAGAAR
FT                   AAEEWPAHFVAFDLLRLSGTDTTRWPYQRRRAALESVFASRRLSAPWALCPSTTEADVV
FT                   REWLTWASVGMEGVVFKRLDDAYRPSVRGWQKYKVRETSEAIVGAVTGSPASPRTLLLG
FT                   RYDDQGRLQYVGRTTTLARTAGAAVAGLLAPARRGHPWTGWSFSAGWGTRETLNVTLVE
FT                   PELVAEVGVDVARDTSGRWRHPARWHRARPDLSPADIPHLTSPL"
FT   CDS             complement(86243..86371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p91"
FT                   /old_locus_tag="SAP1_91"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p91"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75375"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y90"
FT                   /protein_id="BAC75375.1"
FT                   /translation="MRCLSRDHIPHGQRLIPRAVYSPLGRCQPRTMRPTSSISPTS"
FT   CDS             86514..87095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p92"
FT                   /old_locus_tag="SAP1_92"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p92"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75376"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y89"
FT                   /protein_id="BAC75376.1"
FT                   /translation="MQEPQHPMPTLPGFEPPIPGLIDGMDEEELAITVGLGLVAREAAA
FT                   VEYVLHGIYVHLAKVAKAYTAQATATGGALIKQCRSALEQLGDSAVPATRRASLVRDLD
FT                   LAEEGFRLRNRFLHGYWQFDHEVQSWLTLKGAHGMTRPEIAHTDSDAVWELAHRLQALH
FT                   DRLVHWDIAQFGELAETENGDRGWASVKHL"
FT   CDS             87433..89484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p93"
FT                   /old_locus_tag="SAP1_93"
FT                   /product="putative DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p93"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75377"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y88"
FT                   /protein_id="BAC75377.1"
FT                   /translation="MASVAVPSQAGPHEAEFQLSVGEGKILQFKKKPQIAAVAELVWNA
FT                   LDANATLVDVELRRDWDAITQIVVTDNGHGMTTDRARAAFAGYGETWKTGKTHTEGNTR
FT                   ILHGRNGEGRLYAFALGDRLTWESVAEVEGELVGVRINGDADHATIWRVVETEPARDKT
FT                   GTTVRIDVPQGKPLRGLERQDAAANLTAKLAFYLRAYPDVSVTFDGKRLDPSDIIVGEP
FT                   IDLRLDLPEEYTQEDPAPVVTFVEWNQRMSDRRMLICNADGIALYEQGREWTDSIVSFT
FT                   PYLRSSLFNDISVDDLHGLPMSHGGLLDVAAKAVQKHLALRGAQISAAVVRQLKDEGIY
FT                   PYSGPSASGTQAIERQTFDVVVTVARDALPVKGAARQLSVSLIQTALESSPGDLHTILA
FT                   KVLALSDEDRRHLKNLLDSTDLTHVIEAATTVTNRLNFIGALRKILADPQLRKDLREVD
FT                   QLHPMIAKNLWLFGEDWNMAMNEVGLTNVLQAHLEDQLGEDVVLENQLEPVTQPDGRSG
FT                   RVDVLLFRSRRDDSSTERLIIELKRPTVRVGKKELDQIKGYARAIVDDPQYSGVDCKWR
FT                   FYLITYDYSDKILRDIRQKDKPEGLADDHHDYEVWVKSWGEILDTAEKKLLFFQRQLNY
FT                   EATDDRVTQHLRESYSRFIPEALAEDGQNGAAASNSSTGSETPSTLHP"
FT   CDS             89669..90514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p94"
FT                   /old_locus_tag="SAP1_94"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p94"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75378"
FT                   /db_xref="GOA:Q82Y87"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y87"
FT                   /protein_id="BAC75378.1"
FT                   /translation="MLEWSGALCELDGVCRNPRRQGVIFERPRPAGGNQRGCGEQPGVA
FT                   ADTSRTATPMSRYSEYVGADQILDLGFVVSADAAGASAKADELHFKRIHMESELSLAQV
FT                   LTDMHCAVDFLKPQTDVQKARFHLDRTAGIIKGMEAKLNLLRPPYFTQERFEEFRDLLA
FT                   PASGAQSASFARVRHFLGLEGTESPIYKQFINAVAGHGTSIPVVLRSPASPLYEVAHAL
FT                   LGVATAYESWAWSHYQNMRLVVGEKKEGTAGTLGADFLKGRMVAPFPELWSAIGVKKGV
FT                   "
FT   CDS             complement(90591..93248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttrA"
FT                   /locus_tag="SAVERM_1p95"
FT                   /old_locus_tag="SAP1_95"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p95"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75379"
FT                   /db_xref="GOA:Q82Y86"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y86"
FT                   /protein_id="BAC75379.1"
FT                   /translation="MPGIQLREHQVDQKASFRKWVGFPARSSVPPQGARGTIVSATGSG
FT                   KTFTAAACALECFSGGRILVTVPTLDLLVQTAQAWRLVGHRSPMVAVCSLENDPVLNEL
FT                   GVRTTTNPIQLALWAGAGTVVVFATYASLVDREDFDDPMGQRKVRGPLEAALAGGERLY
FT                   GQQMAGFDLAIVDEAHGTTGDLGRPWAAIHDNARIPADFRLYLTATPRILASPRPQKGA
FT                   DGQELEIASMGQESETYGPWLAELGLSESIERGILAGFEIDVLEIRDPSPVLGESEEAQ
FT                   RGRRLALLQTALLEHAAAYNLRTVMTFHQKVEEAAAFAEQLPKTAAELYVNDASDEDLA
FT                   AAGRLPASSIDAEFYELETGRHVPPNRVWAAWLCGDHLVAERREVLRQFANGIDAAGRR
FT                   VHRAFLASCRVLGEGVDITGERGVEAVCFADTRGSQVEIVQNIGRALRLNRDGTTKIAR
FT                   IIVPVFLEPGEDPTDMVASASFRPLVAVLQGLRSHDERLVEQLASRALTSGQRKVHIRH
FT                   DEEGRIVGADGDGEDQEQDDTDAAAESALLHFSSPRDASTIAAFLRTRVYRPESLVWLE
FT                   GYQALLRWRAENEITGLCAVPYDVEVEVGVTKAFPLGRWVHQQRKALRAGELEERRKTL
FT                   LDAPEAGMVWEPGEEAWENKLAALRSYRQATGHLAPRQDAVWGEDDEMVPIGQHTANLR
FT                   RKGGLGKDPERAAERAQQLTAIDPDWNCPWPLDWQRHYRVLADLVEADGHLPEIAPGVL
FT                   MDGDDIGRWLERQSQPGAWAQLSTEQQERLSQLGVKPIQAPSPAPSATRATKSPSKAQQ
FT                   AFQRGLVALAQWVEREGAHRPVPRGHAEGITVDGETEPVAVKLGVWTSNTKSRRDKLTQ
FT                   EQLDALRKLGIEWA"
FT   CDS             complement(93292..93669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_1p96"
FT                   /old_locus_tag="SAP1_96"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_1p96"
FT                   /db_xref="EnsemblGenomes-Tr:BAC75380"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Y85"
FT                   /protein_id="BAC75380.1"
FT                   /translation="MDPERLADTWAAKHAEWRRVRDSMTEAGWGVYEPERDAQGSEWAR
FT                   DREDRRAGALAAGAAFEARRREGPDELQAELWLSAGPGRRIRAVADLSGLQPAQILAQL
FT                   AERVVVSEDGTVSVPPFMPSR"
FT   repeat_region   complement(94217..94287)
FT                   /rpt_type=LONG_TERMINAL_REPEAT
FT                   /note="perfect repeat"
FT                   /note="right terminal inverted repeat"
XX
SQ   Sequence 94287 BP; 14965 A; 33616 C; 31674 G; 14032 T; 0 other;
     cccgcggagc gggtaccaca tcgctgcgcg atgtgcaagg ggggcggtcg ctgcgctccc        60
     gctgcccacg cgatgcgtgg gcggatccct tcgctgcgct ccaggatccg gtggggccgg       120
     ccgcgatgcg gcgcggcggg ccgcgcggtg cgcgccctcg gctgaggggg tgtcaggtgc       180
     ggctagtggg gtctccagtg cgggagttgg gggagcgcgg ggcgctcccg gcgggtccgc       240
     tgcgctcccc cgcctgacgg tccttccggc tgcgcctcca gaaccttgag gcccgctggc       300
     gcgggccggg ctggctacaa gggggtgggg gtcgctcgtt cgtgtgggtt tcagtatagc       360
     gcgtgcctca ggttgatgca gcatgtaccg ttggcggaaa cacgggacac cccccaaccc       420
     acccggacgg gacgcacctt ttgatggatg gtcagcgacg gaattcggtt cacccactca       480
     cccgaggaat aacgaattgg gaagctgcgg acccgagcca cagaacggga cctcagatat       540
     cggaaagctt gaattccggg gtgcggaggt accggagccg aacggccccc ggggccgggt       600
     ggcggaaccg cccaccggca ccggccgcgc ttcctcgctt gtgagcgtca cggccggcac       660
     cacccgagac tcagagccgc tgctgctgtc cacgacccgc acccgggcgc ggtgccgcac       720
     gcgaagcgag ctcagccaca gaggccggcc ccacacggtc cgctggttgg ccacggcgac       780
     gcacccgccg ctgccagctg cttcctccaa agcgccgtgg tgtgtcggtg gttgatcaga       840
     gctgcaagat caggtatcac gcgcgcacac gctctagagg gggaacgaga ttccgcatcg       900
     ctccaggtca gggcgttttg gtgccgctgg gggtatcacc ccggggtgat aaatcgaggg       960
     gccagttatc gccccggggt tataaaacca cgtcggtttg tgcacctggg ggacattgtg      1020
     cggatgggtg gcgtggtgcc gggtcgggca gcttgtgcac tggggggaca ttcgaggtgg      1080
     ggcggtcgtc gcggtcgccc gcgggtcggc aggggggaga aatcaccccc gggtgataac      1140
     gacacgccga aagtgcagct gggggacacg aaagtgcacc agggggacaa tcgcgtatgc      1200
     tgccgttgcc tggccctact gatcttgagg agcggacccc cgcgatgact gcacagcccc      1260
     agcagcagcc gcgccggagg ccggcctcgc ccggagctcc gccgcctccg ccgcccagtg      1320
     cgttccgggc gccgggggcc cttcggcgca ccaatgtggt caacctgccg gacggctacc      1380
     gggccagcgt tgagccgccc gtcaccagcg atggcttcct gggcgaggac ttcgtcatgg      1440
     acagccagga gttcctgtgc tggctgtcgg actactaccg tgacgacatc gtgacgctgc      1500
     ggctgatcat ccggatgatg gggatccaga agcccggcgg gactgtcgag gcgacccaga      1560
     gcaagctggc cgggttgctg aaggtcaagc agtcgcagat ttcacggtcg ctgaaggaca      1620
     ccgggaacct cggagtcact gccaaggtca aggccgggct ctaccagttg cacccgcggc      1680
     tgtcgttgcg cggcggcagg gtgccggtgg agccgaggcc gggtatgcgg acgcaaggga      1740
     cactgaaggt ggatcagctg tcgctgctgg acgccatcga ggacaatccg gatctacccg      1800
     aggtgttcag ggaactgcgg cagctcccga agccggcgga gaagccgctc cgggaagaca      1860
     aggcgcgtgc ccaagcccgc gctgaggagg atgggacgtc atgacgatcg ctgtggagcc      1920
     cgcggccccc gagtacgtct ggacggccaa caacgccctc gtgttcgctc cgcgcggcat      1980
     gccgccggcc tcttacccgg tgctgctcca cctcctaggc cgccaggagc ccggcgggcg      2040
     ctgcctggtc acccatggca ccctcgccgc cgaactcggc atcacccgac ccaaggtgac      2100
     ccgcgcgctc cagcacctcg gcttcgcacg gatggtctgg aaggaaggca acggcgccta      2160
     ccgcctcagc ccgctgatcg ccggattccg tacgcccgcc gaacagctcc aggccatcgg      2220
     tgcgatggac gacgacgacc gcttcgacca cccggacttc caagagcgct acgagcagca      2280
     gatcgaggcg tacgaggagg agaagcaagc gaaggcagcc gagaggcaga ggcggctgga      2340
     gccgccgatc gacctcgctg cccgccggcg aacctgaccc tgtctcctgg aagcggcgtt      2400
     gcaccccgtg cggcgccgct tccgtgcgta caccgtcccc ctcctgggga aaccgcaggc      2460
     agggcagccc gcacgagcgt tcccggacgg tggtgccgcg cgccacccgc ccgagcgccg      2520
     gccgacgcgg tacgagtggg ggcgtgacgt acaacttcgg cctccacttc acccaggagc      2580
     tgggcaacag cttcgggccg cccaccgaca gctggcccgc gagcgcggag caggtgaccc      2640
     cgttctttgc gatcgttgtc aacgtgctgg gcacggacga cgcggcgcgg tggttcgagg      2700
     cggcccgcaa ggcgcaccag cgtgtggtgg ttgcggagcg ggaccggacc caccacttcg      2760
     gcttcgctca ccacctggac gtggagaccg aggcgcacca ggagcccact ctccccgtcg      2820
     tggccgcctt cgaagcgacg aaggcgctgt acgagatcac ccgccgggac tctggtgtcg      2880
     acgtcgacgt gttcttcggc tgcgcgctgc gggcgtgctc gcgcggcagc ggccggaccg      2940
     acagcacacc ggtggcagca ggcgcgaacg cgtagccgcc ccggacgcag ctggccggct      3000
     ccctgcagtc gagcgagagt tcggctccta ggctgcaggc gtgtggacgc ggggacagcg      3060
     cggccggtgt cggacggctg tcaacgggcg ggcggtagca ccaggtaaac cggcttgttc      3120
     tggagcagca gaacagccga cgacggctcg gggcgcacac gctgcgtgca gcagctgtgc      3180
     atagatctcg cgcggaacat cgcagatctg cgaacttatg cagctgccgg gacgggtccg      3240
     cagccctgct gctggccccg aagcagcggg ctcccgactg cctgcagcga ggccgtgcag      3300
     cgagcagctg ctgcgccggc tgggcgggcg tgctgcacgt gcagcacccg tgtgccgtcc      3360
     gggtcgtgcg attactgcgc cacagtgcca cagtccccga ccccgagcag caaccggcgt      3420
     tgcaccctcc accaccagga gcagcagccg gttgcgcaac ggacgctgca cagtgcaggc      3480
     cgggaagggt gcaacggact gcaacgtgca gtcggtgtgc atccgattgc agcaacggcg      3540
     gacttcacct ggagtgccgg cacccggcga cgacggggcc gatcgacacc ggcgttgcac      3600
     cccaatggtg gttagtacag atagcggttc tgtgcgggta ggtaatccct tctccctgag      3660
     agcagagctc ggtccgggga gagccgggag ccacgggaga cgacgacggt ggcgagacga      3720
     tcgtggagcc gctccaaggg gatcagcggc acctccgacc cctagaggcg ctgtacggct      3780
     ctgtgagcgc ctctggcggc cttgatcgcc gctcggggag cctggagggc ctcagaacgc      3840
     cgcaggcggc cgtagagggc cgggaaggat catgcgcgcc gggcaccggc ggttgtcgtc      3900
     acgggcgagg gcagatgatc ggttcccgcg ctgcgagctc tgctctcagg ggggaaggag      3960
     agacaacccg caggtaggta ctacaagtac ttacctacat tggggtgcaa cggccgtcct      4020
     cgggccgggc ccggcgggag ccagtggcgc agtaccagct gcgacccaga ggcggcagtc      4080
     ggctgatggt gcaagagcct cggctacagg cgctgggcga gggtctcgca gtaggccaag      4140
     ggaacggtcg cctggtacag gttgccctcg gctgcgttcc tggaggccat ctcaagcatc      4200
     atcgcgaggc tgtgcagcgt ctcgtctccg tcgccggtgt cttcgcccag gcgggcgcgc      4260
     agtacgcggt cggcctggtc caggacgtcg ggccagaccc cggcgtacgt cttcgggtcc      4320
     accccggtca ggggcgtcag ccacaggtcg gcgtgcgact ggagcagctg ctcggccgac      4380
     cggtagtcca ggacggatcc gcaggacagg cgcagtccgt cggtgtcggc ggcggtgccc      4440
     ggccacccgg gcagggcacc ggaatgggcg gggcacagga gtgcgagcca gtccggcggc      4500
     tcccccggcg cggcggcggg gccctgccgg agcgtggtcg gcgtggcggg gcagtccagc      4560
     acctggcgga gcccggtgag ctgtcggccg gcggtgagct ggttgatgtc ggacggcacc      4620
     tttgggctcc ttcggcggct agacctcgat gtacgcgacg accacgacgg tgcgcagtgc      4680
     ggtgacgaag tacaggacgc ggacggactc gacttcgtcg gcgtactggc gtagctgggg      4740
     gccggcggtg tcgccgggga tcggctcgcc gacgtccggg tcgacggaga tgacgaccag      4800
     ggcgcggtcc agggcgtgga tctccgcttc gctggtgatg ttctccagct gtttcgcggc      4860
     ggagtcggag aaggcgatac gggcgcggcg tggcccgtgt accgacggca tcaggcgacg      4920
     gccgggcgct gggcagcgag ccgggcgagg tgggcctcgc gcagctcctc ccatggcgtg      4980
     cagtcctcca ccgagggcag cccgttggcc gcgatgtcct cgaggacggc ggcgaactgg      5040
     tcggcgttct cgcgggtcct ggccgcgtat gcgcgcaccg cgtcggcggc cgcgggctcc      5100
     agctgctgcc gggcgtggtc ggcggtggcc ggctgttcgc tcatcgaggg ctccaggagg      5160
     gcggaactgg cgtctgctcc aacggtatcg gccgcccccg gtcctgggga ccactccgga      5220
     cgaacccggc cgtacgaagg tgcaggaccc acgtggaccc agcagccgtt gctgatcgtg      5280
     tccgccagcg aaaacgccgg tctggggacc cagggaccca ggttctgggg cggttgctgg      5340
     gtccagctgg gtccgcccgc gcgatgacac agatcagctg aacagtgaca cagatgagta      5400
     tgcccacctg gggaaacggg gggttgatga cacagatgac acaggtctgc cggactgttc      5460
     aggctgggac gccgggcacg gcctggccgt ccgtgacctg gagacgggcg gtcatcggcc      5520
     gtcgcacacc acgtaccggc cgtcgccgtc gttactgtcc cgtgccgctg gtccttgacc      5580
     ggttgccaac gaaggctgac ggacggcgct ttgtgccgct gaagactgac cgaccaggtc      5640
     agagcgggtg agccacctct gcgtaaaagc gcatccggcg tcgtcgtccg ccccctgata      5700
     cgcagcgggg gaagcccggg gaccctgtca ccggatcgcc gcgtggggct ggctgtatat      5760
     ggccggtacc ggcggtaacg gctcacggtc ctgcagagac gaggcgcgcc ttgttgcggc      5820
     cgggccggtg tccctagatt cctccgcttt gacgggccca gtgcgagggc acaccgacca      5880
     gcccgccacg ctcaaggggt tcttgccatg tcagtacgca cacgtcttct cgtcgtagcc      5940
     acagtggctg cgattgtcga agggttgatc ctcgcgggat gctcgccaac cgtcgccgtg      6000
     acggtggcct ccggcatcgt gctcgtctcc agggaggttt ggatgccggc aggcccggag      6060
     ggtcggcgtc gggccccccg caagcggacc gaagcgccgt cgcctgagtc ggagaacgag      6120
     tcgaaccact ctggataaca gcaagaagca gggatctgcc cgttccccgg ctagctgcag      6180
     gtctcgtttc ggtccgtgtg gaccaagacg gtccgtgcag gcccggtacg gtccttgtac      6240
     gacccccggg cgacccaggg gcgggggctg gggccccgcc gacgtcgtca acgacgatct      6300
     tcttcgccag gttcacggag atggcgccgt cacccagatc catggggtgc gcgagcatac      6360
     gcacgctctt ggtggcggac ccaggaaccg cgcttgatgg tggggtggcg gtcttcaggg      6420
     cgctgacctg cacggtcaat ctgcggtgcg ttctgtactg ctcatgagtg cgcgcgaggc      6480
     atgattcaaa agtgtcacgc tccgccctcg aatcccgccc tggaggggct cacggacccc      6540
     ggggagcgga cataaagggg catattcgag gcggcgtgac acttttccgg gggagcgtga      6600
     cgggcggtgt cacgctcacg ctctgtcagc gtgacacctt tcggagtgtc ctctgacgct      6660
     gaacatggac cgattgccag ggaagttgga caaccactac gttcctgcca gtgatgtcgg      6720
     accgagaggg ctgggggcag ggtgggggca ccggctcttg cgtacgggga cgccgcgtta      6780
     tcggcctttg agctggactt tcttgagcac gggcgtcgac gccgacagtc cttgggccag      6840
     gggtggagta cgccgttcga ggcggtggag cccgtccggg acttccgctg gcggtcgact      6900
     tgctcgggga ccggcgggac gtcgccgacg tagaaggctg cggtgccgga cagggtgtcc      6960
     tcccggccgt actgccggat gttctggaag aacaggttga gcgcaccgat cctcgtcttc      7020
     ttcatgccgt gcccgccggg ctgtgacatc acgtgggcga ggtagcgctc cagcagcggc      7080
     cggtccacct ccgcgagcgc atcaacgccg atgaacgcga ggaatccgcc gaagcagatg      7140
     agcgcgtcga ccccggcgcg ggctgcaccg atgctcagcc cggacgttag ctacggcatc      7200
     gccacccaga ccctgcccaa cggctactgc ggactgcccg ttcagaagac ctgcccgcac      7260
     gccaatgctt gcctgacctg cccagtcttc ctcaccgggc ccgagtttct gccggagctc      7320
     cgcgaacagc gcacccgcac cctgacgttg atcgacaacg ccaagagctg cggtcacagc      7380
     cgcatgaccg agatgaacca gcaggtcgcc gacaacctcg accgcatgat cggcgagatg      7440
     gaagacgacc aggagactga aacctgcacc aaggacgccc tgcgcacgcg atggcaacgc      7500
     aaggccgccc cacccgctcc tgtcgtccgg gcctgtcgcg catgtgaagc gccgatcctc      7560
     tcggggccgg cgcacaagcc ctgctgctcg aaagagtgca gctactgggc ctacatgaac      7620
     cgacgacgcg atcgtggcct gccgcggtca gtcgctgtcg ctcctccacg ccagcagccc      7680
     gccgactgcc tggtctgcgg aatcctgctt cccgaacgga ggtcccagag tcgcctgacg      7740
     tgctcggctt cctgccggat gaaacgctac cgagcacgga ggaaggaacg gctcggcata      7800
     tcgcctgacc aatgcatcaa gcttccatct ttcgcagagc atcgacgata atcgggtcga      7860
     agcgatccgg gctgcggaca acgtcatctt caccttcgtt gaggactttt atttccgctg      7920
     cttgtccagg tcggcgccaa attccccgaa tctcccagaa tgcggcttcg ccgtctgtca      7980
     ttatgacaga cacggacacc tctttcgatt cctcgccttg ctcgccttct ctaatcaccc      8040
     actccctagc tccatggcgg aacgctcctg ccacatgcac accccagttc cccacaccat      8100
     gattcttgac ggcgtgctcc acggccttgg agacggcgct ctgcacttca tcgtcctgtg      8160
     ctcgatagag gagagtcatt gcacctccca ctcgctttgg tgttgcacgg ctctagcggg      8220
     cacgccctcc gaaagaagga attcaatccc cccggcctca tggagccgcg gtccgcgaat      8280
     cacgggaacc tcttgcggat caatgagtgc cacgtacttg cgtagctttt tgggttgcgg      8340
     aagctgtagt aggcgagcgg catcctctgg gctgtagggg gtgattgtcg cataaacttc      8400
     accctccatc cccttccgaa agtccctctc ctcgcccggg aatagatagg tgacaagtag      8460
     gcgcccccgc agaatctcgg gatctagcgg tggaatcttc cgcaagtctt cctcgtgact      8520
     tatcgcgtct cgcaacatgt acttgtccag cctcgttgcg agatggccac acgaccccat      8580
     gacgttcaca tcctctcgcc acctcttcca tggtgcgggg gcgcagaggt acgcgccatg      8640
     cgtagcggct gtccgacttc cctggcaaac ggtccaagtt cggtgtcaga ggacacggag      8700
     gcgcgcagct ccccgtgatg tcacagggtt acagatcgcc tcccggaaac gcgtctgcct      8760
     ggggaaacgg cctcataggc tcacaggtaa acagggtgaa ccgggcattt ctggcttcag      8820
     ccctcacagg gcttgtcaca tcgaacgcca gctggtcgac gccggcgccc agcgcgaggt      8880
     gggtgagttc ggtgagcagt gcggcgtggg cgagcagatg cgtggcgagc agatgcgtcg      8940
     gcagcagatc ggcggcggct gcgcgggcgg ccggatccgc gtagtgcccg cggtgcgcgg      9000
     ccaggacgtg ggcgagccac gcgtcgacgt ccttctgcac gtacaagccg gtccgccggg      9060
     tgagttcgtc ccgggcggct tcgtcgccct cgcggggctc ggtctgctcc agcgtgccga      9120
     gctcgcgcag cgcctggagc tcaccggcgc gggcccgacc cgggcggctt cgcgcagctc      9180
     ggcttcccgg gcggcggcgg ccgcggcttt ggcggcgagc tcctcctgga cgcgcgggtc      9240
     ggcgtccggg tcgtagacgg tgttcggggc cgcgtcggcg agcagctggt cgatgcgctc      9300
     ccactcagcg agctccgccc ggccgcgttc gtcgtcggcg aggtgctcgt gccgcgcgtc      9360
     gaaccgggcg tcctcgaggg cctgcgcgac ggcgcccgcg tccatcccct tcgcgcggcg      9420
     gcgcaccaca cgccgtccga tgtgggcggg gtcgaccggc tcacggggcg cggccagcgg      9480
     ggcgagcggt cggcgcaagg tgcgccgggg cgtggtcatc ttcggcctcg cattcgtggt      9540
     gcggattcgg agcggaccgc cgccagagcg ctgtgcgacg gcccgcgaat aaggtttata      9600
     gcaggccctg aattccgggt ggtcagaact caaaatctat cgaccgcacg tgcgtgaaat      9660
     ctgctcggag gccgtcggcg cgggtgcccc actccgtgaa atacgactcg gtgatggcct      9720
     cagcgacgat cggatgcagg tcttcctctg tcgcaccggc ctcctggagc tggaggatct      9780
     gcgcggcgta ggtgggcgag atcggcgtgg tgatggtgcg ctcgcggccg tcgtccgagc      9840
     tgcccgtgca ggtgaatccg aagtaggccg tcacctccac catcatgccg ctggaggtcg      9900
     ccgctcgctc ccgcgcctgt gccctgacct gcggttgcca ctgggattcg gtctcctcaa      9960
     ccagggccgc gtggagcttt ttctgaggct tcgtctgctg tccggcgcgg tagcgctgca     10020
     cggtgcgaga cgagacgccc agttgttcgg cgagggcctt cgtggacttc ttggcgcgcg     10080
     tgtagaggaa ttcaatctgg gccttcgcgg atttcggcgc gggccgggtg aacaccttgc     10140
     gctccgcccg cttgagggcg tccaggaccc tgttgcggcg cggggccagc ggctgtgtgt     10200
     cgttgctgtc gatcattcct gcagcagaca cccgttgccc tgtggacaga ttccgcggcc     10260
     ggtgccccac catcgcgggt ggggttgacg gcgtcgatca gcgggtcttg ggtggagggc     10320
     cacgtccaga gcaaggggac tggccatgga gctgctcagg ttctccgacc ggctaccgca     10380
     gtgttcacgc tgccggggcg acctcatcat gagtggggtg gcgccgcaga acgacaaaca     10440
     cgggcggccg atccacctgg agctgtgccc ggtgtgcgac accggcgacg tggaccgccc     10500
     ggcggccggc cttctcgtgc agtggttcgc cgaccgtggc ggtcatgacg agagtcgcgt     10560
     ccaggagggc tcccacctgc tgatggagtg gacgagggag tgcatggctg tccacggctg     10620
     gtacttgcag gacaccccgc ccgaccagcc ctgagccgtc atcggcagca gctgccgggc     10680
     gcgcggtgcc gccgcgtcgt acggactgga cggccgccgg ctcgaactac tgttggggcc     10740
     gtggcgacaa cgtacgacta ccccggcgac ctcatcgcag cgcagcaggc actcacccag     10800
     gtgcgggccg acctcaccgc cctgtacgag cggctgccgt actccgtcga accgatggag     10860
     gcctggcagc gccccgaggg ctactggctc gccacctccc gcgcgtaccc ggactcgccg     10920
     ggctggtcgg agcaggagcg gcgggaggtc gccgcgctgc gcgagcggga acgcgacctc     10980
     accgccgcga tcgtcacgca cgccttctgg aacgacgtcg ccgggcccga acggctcgat     11040
     gcccgttccc agctcaagca cgccctcgca cgtgaggacg gcgagggcca ggaggcggcg     11100
     tagccgtggc ggacacgcca cccgagccgg agccgccgcc catcatcgtg gttctccccg     11160
     acggccagga ggtcaccggc cgcctccagg agcgccagca ggtccagggc gcctggctgt     11220
     acaaggtggc cgtcccggcc tggcagaaca cgccttccgg gcaggtggag cccgcctggt     11280
     acgtggtgtg ggtgcaagcc cccggccatg tgaagcccgt gcctggcgtc tcatacaaca     11340
     atgtccccac gacccggctg ccaccgccga cgacggagca gcagatcctc ggggagcgcc     11400
     gaccgtccgg atgggtcctg cagaagctga acggcggccg cggtcccggc cggggcatca     11460
     tccacgccgt cgactgcgag gaagcatccg ccggggcacc gctgctgact ctggacaagg     11520
     cgctggacgc cgcagagcag cccggtaccc ggttgtgctc tctgtgcagc gcggccgccg     11580
     aactggaccc ggtactgaag ggcttcgacc acggcttcga cggcgaagag tagacccgcg     11640
     cggcggaatg gggtgatcag ctgcgggtga cggtgaagcc ggtgtcgttg accgcgcggg     11700
     tccacacgtt ccgatcgaac cacttgctga tgtccggctg catctcggtg atgacgcgca     11760
     tccggtcttc ccagtcgtgg ccggacggtc cgcggctttc ctcgcacccg tcgcagccgt     11820
     cctcaccgtg gatgtggccg gcgatccagg cgttgactgc cacgttgacg atgacgccgt     11880
     acaggtcgcc gccggtctgc gcgagggcgt tgggaacgcc ggcgaggatc agcgcgagct     11940
     cgggattgtc caccggcggc atcggcgcct ggcccgcacc cttgcgggtg ctgctctcct     12000
     cgaagctgcg cgagctgtcc gcgaggcgag cggcgagcgc ggccgcgtcg aagtaccgcc     12060
     aggccgaccg cacctggata ccgaggcggt cggccgccgt gcggacgttc ttctcaatgg     12120
     tgtcctcaac ggtcgccggg gcgagcgtca cgccctggtg ggcgagctcc gccagggtct     12180
     gggcaacggc ttccttgaac gccttcgtgt tccgcacgac cacagcgtag gggagctccc     12240
     ccgctcctct ctgccgaact gaactgtgca cgcagggcgt tgtcagtggc tgctgtcact     12300
     atccggttta tgccgatcag ccgggagtac gcgcgctccc tcttcgcgga cctgacgcag     12360
     agcgccacgg tgccgctgga ccctgacgag ctcctccaca tgccgggact ggcgcagcac     12420
     ggccacgttt tcttcggcga catagccgtg cgctgctaca agcacaaggc gcgctggatg     12480
     tatgacgagc gggacatccg gcgggccggg caggcattcg cggagctgcg cctggacctg     12540
     gacgacgttg tcgacgtcca actgcccgcg taccgcgact tcggacaaag cgacccggag     12600
     gagtggcagc gcgtcgactg gcggcgccga ctggtgtcgt ggatgttcgg gctggcccgc     12660
     cacaaagccc acgacgggat cccgtacgac gagtggaacg acgcctggca gcgggtcggg     12720
     gcgaacgggc tgcccgggga tctgacgtgg gaggaattcg tcgctgccag tagccgctac     12780
     cggcactcgc agaacatggc cggcacccga ccgctggagc tgctgacctg gtccgggaag     12840
     aggtggcttc tgccccgcgc ctacatcgag ctcctggacc gctgggcgca gcgggaggag     12900
     gaactggtca accgggcccg ggtctgctcc tcctgcggcg cccagggccc gtactgggac     12960
     ggctggcgga catcaaccag caagggctac gtcaccaggt gcccaccgtg ctccggagcg     13020
     gccttccggc cctacaccgg ccaactgcgc ggagtgcagt acgagtcgcc ccgcaggcgc     13080
     agcacccggg ccgacgacta cctgtgccgt ctgtgcaaga aacgccaggc gtcagcgtgg     13140
     gatcactgtc acgagcacgg ccatgtccga ggaccgctat gcggtagctg caacacccgc     13200
     gagggcaagg ccacgccgta ctacttcctc cagctcgaag gcggcacgct gcacctcctg     13260
     gagtgccgcg gctgccttga gcaacggacc ctgccgcgcc ggttccacct ggacgtggtc     13320
     cgcgcgcacc tggagcagac cgagcggcac gggcgctgcc gcaggcagcc gtacgcccgc     13380
     gaactggagc acactcacgg tgtgcaccgg ttccagctgg agtgcagcgg ctggcacgcg     13440
     gtcagcaact ggacgaagga cgtcacggcg tccgaggtga ccgcactcgt gcgggcctac     13500
     gtcgacgcgg cgctcaccgc gcaggagagc cagcctcctc ccggcacggc cacggacgcc     13560
     gggtgaccgc cgcgcggcag tgtcgttgag cacggcatcg cgtgcatgcc ccccccaccc     13620
     ccgcggatac gcgagcgagc cccggaccac atcggttcgg ggctcgcagg ctgttcgggc     13680
     gcggctgcta cagatcgagg tgtcacccga ctacaggagc cgacgcttcc gcgttcgggt     13740
     ccgcgatgga gctggccagc gcgttgatcc tctgctggag ttgcttgatg ctttcgcgga     13800
     cgtcatcgtc gatcaccgtt gccagttgct gggggtcgat tgattcgatg cccttcgcgg     13860
     tggacttcag tgccttgagg tactgggtgc gctgttcaat tgtctggagg tcccgatcgg     13920
     actccaccgt ctcctcgatg gcttcccgta cggtttcgta tgcatcggtg acgctctcag     13980
     gggtcgcctc tgagtcttcg acggctgcca ggcacgcgga aactttctgg cgggcctggc     14040
     tggtgagctc gatgatctgg ccggcggggg tcttggcttt cccgtctgtg gcgacttgcc     14100
     gtacgaactc gatgcgttct gccttgcgtg tctgggccgc ggcttctttg cggatcgccg     14160
     ggtcagacat cgcctgcgca accactgtgg ctctgagttc cgtgcgtccc atcaaggcat     14220
     cgcgagcggc ttcggctgtc ttggggtcgc ccaggatcgc ggtgcgcatc gcggccggat     14280
     tcttggccac cttcatggct tcggtgtagc tggtgcctgc ggctttggct tcctccgcga     14340
     tgcgctcgcg ccggtcggtg ctctgttcgt agacggtgaa gtagtcgccc caaaggttcg     14400
     cgtcgggcag gtcaatctct tggcccgggg tcagctggtc gaaactgggg actttactgt     14460
     ctgccgccgc acgttcccat gcacggtaaa agcgcatcac ccgcgcagca gaggtgccgg     14520
     ccatctcggc gaacctgctg gcggatacct tctcggcatc cccatcgtcg acaccccacg     14580
     tctcgctcgg tcggcgcccg actgcgccgg gctggacgtt gcgggcgacc aagagcccga     14640
     agacccatcc accgcttcgg tcataggcgc cgaaaacccg ggcatcgcgg gcgacggggt     14700
     cgcgttcggg gtcgggcccg aggagccggg tgacctccgc gcgcatggcg tccatctgct     14760
     ctcggatgcg tggcacgcct tcgtgtggat gccgcaactg aagcagtatg cggacgttct     14820
     ccacgctggc gccaagcccg aagggggggt tcgcttcgat gaactcggag aagctgttga     14880
     atggcttctc ctggttgacg ccggagggga ccttcttcca ggttccttcc gccatgacgg     14940
     ctgccagcag ctccaggaag ccgatcggcg tgccaccgtt gcgttccagg gagtctcgga     15000
     gctggtagac ctgatgctgc tcctcagtga gatagctgtt tgattcgact cggacggtca     15060
     tggagctctc ctacttgagg gccagtgcag cacggaacct cctgctggcc ttctctacgg     15120
     tattggcgtt cgctgccgtg cagccggcag cctcgttcac gcgtgccgtc gctttcatcg     15180
     cagcgtcccg gtagccggcg tctcccggct tcacaccgcc gcggtacaga tactgcctga     15240
     tcgtgtctga agttttggag ttgaaatcgg cgatcttctg acgttcggtc ttcggggcct     15300
     ccgtgggcgg ctccggttcc ggttcggtgc gcggctgggg gaccggggtc ggctgcttga     15360
     gcatcatccc ggccatctcg atgatctgct tcagcttggt gacgtcttct gcggcgtcga     15420
     cagctcgctt cagcgtctcg accatcagcg tctcgtccgc gtccatgtcg agttcgttgc     15480
     ttgaggccct ggtggtcgtg gcgaccgcgg agtcgatgta ggagaactct tcctggacgg     15540
     cgtctccggg ctcctcgcgc tcctcttgtt cccgttcctc caggaccttc agtccccggt     15600
     cgttctcctc gcgaaggagg tcgaggaagc cctgcatctt cgggtcgtcc ggggccacga     15660
     tcaggcaggt ctgttcacgg gccggtgtgc cgtcccatac gcgcaggccg cggccgatca     15720
     gctgcatcag gtggccgccg tcgcggtagt gggtcaggat gccgacgacg gtgatggtct     15780
     tgcagtcgta gccgatgaac gccatgcgca cggtcaccag caggtccatc ggcttgacct     15840
     tgaagtcctg caggatcttt gaggcgccgg tgtcggatga cacggcgagc gccacgcgga     15900
     ggtcggggta gcgctgttgg aggtacttgt agaccttctt ggcgtcctgc tgctgcatgc     15960
     aggagatcag gcctcggtag gaggcgtgaa acttctgctt gtcccggatg gccctcacga     16020
     cgtcgtcgac gaggggctgc caggtcttct cgtccctgag cacgggtacg agttcgctgc     16080
     cgtcgtcgga caggttgtac tcgaggacgc tgtccccgcg gccagcatcg tcggcgagcg     16140
     tgcgcttgga gacgcgcgca ttggtgaggc gcatctcgaa cttgcgcagg tagccttccg     16200
     cgatgccgtt ggagtacttg gcttccgcgt ggtggaccag gacctcacgc ttggggtcgg     16260
     tcgggtgggg ctcgtagtca gccagcacca gccgctggtt gtctgcgcgg tttggcgttc     16320
     cggtcaaaag cagggtgtgc cgggcgtact cgtgcatctg cttgatcaat gcgccagcgc     16380
     gggtaccgcc ctcgccggcg tcggggtcgg tcgtgtcgcc acagaactgc gcctcgtcag     16440
     ccacgagcag gaaccggccc tgatgcttgg ccgcccattc cagaaagacc gactcgttgg     16500
     tgaccagcgc gctgtaggtg gagatgaagc cgcttcccgg ttcggttacc ggtgtgagcg     16560
     gcttttcttt gatcttgtgg cggatcatcc cgatgcgctt ggtgctgtcg aacagcaggc     16620
     agtccccctt cgtcacagaa ccttggctgt cccgctgcat ccagtcggtc tcgcactgct     16680
     cggcgagggt gacccggggg gcgaagaccg ccacgtggtc gatcaggccg gccctgaaga     16740
     gcctggtggc tgttgcctgg taggtgagcg tctttcccga cccgggagag gcaaggacgg     16800
     ccgtcaggcg ctcacccgca tggatacggt caaagacttg atcgatgacc tcccgctgga     16860
     agggccgcgg cgagaattcg tcggtgtact gcaccccacg tccttttcct ttgttgcact     16920
     gcgcacacag tgcttgcccg ttctcgatca ctgtccggcc gccctgcacc cagggcacca     16980
     tgtggtcggc ctcccagccg tccagcagcg gtgcactgca cgtctcgcac cgtccttcgg     17040
     cgaggtcgta caggatgttg cgctggttct gggtgaagaa ccgctgagga tcccgatccg     17100
     ccactacagc tccctaagtc ccccgatatg cacctcagtt gccggttcgc aggctacagg     17160
     cggggtctga caacgagccg tgtactgaac gggattgacc gatcatcact tctttctgat     17220
     cggcggacgg gccgaaggac aggtcggcag gcgcacaacg cactgagcgc ctggagaagc     17280
     cgtcgacggt ccgcgagatc ctagggccgc gccggcactc cggctggctc ctgcagaagc     17340
     tgggcagcgg ccgcggcccc agccagggcg tcatccacgc cgtcgactgc ggggaagcac     17400
     ccgccggggc gccgccgctc cggaccaggc attgggcgcg gcggagcacc cggcgaccgg     17460
     ctgtgttccc tgtgcggcgc tgccctcgaa ctcgatcccg tgctccgggg cttcgaccac     17520
     ggcggcaact gacggacgta cgaggatccg ggcgctgcct cagttaccgg actggcccaa     17580
     gaaggcatcg aacatggcgc gggtgcgctc cggcccgtac agggtcatct gctgctggac     17640
     gagggcctcg atgcgctcct tgactttggt gagctcctcc ggcgtgtcca ggtgtgtggg     17700
     atcgaacggc tcctcgacac cgaccaccgc cgggaacggc tggtctgccg tcccgatgtc     17760
     gtaggcgcgc acctctggga cgagcggcag cacgatcagg cgggagccct ccgtcaggtt     17820
     gagcgcggca gcggagggcg cgtacaggtt gccgaccttc tcccgcagga agaacgcggc     17880
     catctccgcc ggggagacga tgaaccccca cctctcgtac atgtgcgcca gatcgtcgtc     17940
     ccatacgtag ccggtcagca gccggcggcc gcgccgacgc tcgatgtcgg cggctgcacg     18000
     gaccagctgc cggccgatgc cctgcccgcg ggaggcgggt gccacagcca taaaggccaa     18060
     gtgcgcgctg accgcgttga cccggtcgaa catcttgcgc tgcatgccaa cctgctgggc     18120
     atacaggttc tgatgcgctt tcaggtcggc caagtcgtcg cccggcttcg aaccgaggtt     18180
     gccgccctgg accagcacgg cgcccagcag tgtgcggcgc cgctcgaaga ccaggaagcg     18240
     gaacggctcg gcgtaccggg ccgtgtcgac cccgctgtcg aggagatgac aggacgccgc     18300
     cagctgcatc cggtcctgtt catcccgggc cacctccgcg agcagggtcc ggacggcgtc     18360
     gccttctccg acacgagccg ggcgtacgcc cgacgtctcc cccttgcgtg ccttgacccg     18420
     ccccatgtgt gtctccctcg gtgtcggtgg tgcgcagtgt tccggagaag cagctcaccg     18480
     tcgttgctcc cgtccagaat ctccccggct gagccgttgc gtggcagatc ccgcgaaaga     18540
     tccttcggaa ggcttgagcc tcgttgggtg tcgcatcggg tccatgcgcg ggcgagcccc     18600
     ggaccacgtc ggtccggggt gactgagcgc ctcggttggc gagttgagcc cgccggtgca     18660
     gctgtgtgct gctccgggcg ctggtcccac ggggtgcggc gccgctcgtg ttgggtccgt     18720
     ccgatcaggc tgtgctcgtg cgccgtcggg tcaaaccgat agtcctcgtt cccgtgtccg     18780
     gaggatgatg cgcgcatgca gtcgggcaac gaacttccga acgaccgccg ggccgaatat     18840
     ttcggacagt gcgcggtgat gatgctcaac gcgctccggc aggagaatga cgcggaccca     18900
     ttttccgagg tcaccagcgt cgacctgtcc gcggaaaccg agcccgggca cgaaggaatc     18960
     tacgaccagg ccctgtccaa cgccctagcc gcgatcgtcg cagcagagtg gccaggggag     19020
     gaagcgaatg acaagggccg tgtgcacttt gcgaggaccc tgttgaaggt gatcgccgag     19080
     aagatcacgc ccgacccgac gacaggcctg tgcgtcatac ctgatcgcga cgccgacgtc     19140
     cgctccccgt gggagaagca aaaccgtgcg cctgaaggct tctgggacac ccggatcgac     19200
     gttgacctcc tgaccgatgc gctcgatgtc agcggtcagg cccgccatgg aagcggaacg     19260
     ggacgcttgc agcgccgtca cgtccaagcc ctgcttgccc tcgaccacca ccccaccctg     19320
     agaacgctcc tcgaggccca gtctgaccgc gacgacgaac gggcccagga cgaggacgcg     19380
     cggtcggccg atcaggcgcg cgctctgcta gaactcatcg gtgatgaaga ggccaagcgc     19440
     cgtgcggagt cggccgagaa ccccaacgag taccacccca agcacaaccc tgacggccac     19500
     gacttcgagg agtgcccggt gtgtgggtac gagaccttct gtatccaggg cttggacatg     19560
     tcggggcggg tcggcttcgg gcagtgcatc gtctgctcgt acaggcgcag tccccgggtc     19620
     gctgaccagg aaggcttcgg cgagcacctc gcatggctga tgggaaaaga ctgaaactga     19680
     acgctcagct cgccaagtgt cgcgctccct cgccaagtga tgcgctcagc tacatccggg     19740
     gctcgcgggc tgtttggggt atggctgcta cagctcgaac tcgaggtgct cgatgtccgt     19800
     gaaccggacc tcttccaggc ttccggcgcg gcggccgccg tcctggaagt acacctcctt     19860
     gagcgcttcg gcggcgatct cctggagtcg ggcgtcgctg gcgccggcct cctgggcgtc     19920
     gaagaggcgg gcggcgtaga cgggcggcag ggctacggtc aggtgccgga tgcggtcctg     19980
     gtccgtcgac ccgatcggcg cggtgtagcc gagccgggcg cgggtgtcga cgacgatgcc     20040
     gccggtggtc gccgccttct ccctcgcctt ggcgcggatc tgcggctgcc agcgggcctt     20100
     cacctcgcgc tccaggcgcg cggcgaggtc ggggcggggc tttttgatct ggtctttgac     20160
     gtaccgctct acggtgcgct gggagatgcg cagcatctgg gcgaccgcct tggtgccctt     20220
     gagctgcttg accaggtacc gcatctgcgc gcccgcgctc ttgggcgctg ggcgggtgaa     20280
     cgccttctgc accgcggcgt ccaggccgtc cccgaacagg ctcatcgtcg ccttctccta     20340
     ctctccgttg tcgacgtcgg tgacggtgcc gtccttgatg taccgggcga ggttgagttc     20400
     cggggcgttg aaccgctcgc ggacctcttc gccccacaag acgctctggg tgccctcgtg     20460
     cttgaccagg ccggggttga tgccgagctt gaagccgccc ggcagcggct tgccgtcccg     20520
     gtagggcagg aagtccagcg ggctggtgcc gtcggccgcg tagacgacgc agtcggacag     20580
     gactgcgatc gggtactgcc cggtgaatgc cgcgtgcttg acgatcttgc ggtgcaggtt     20640
     gatccgggtg cgggagatga ccgccgcgcg gatgtcgggc cgccaggtcg ggcgggacag     20700
     agcacgccac ggcccgcccg gacgccagcc ctcaccccgg ggccgctcgc gcagcttgcc     20760
     caggccgccc ttcaccgtcg ccttgaccgc ggagacgacg atcgccagct ccgggtcacg     20820
     gccgcggtag ccgtccatcg cggtgaggaa gtcggccggc gacaggtcgg cgtcgactcc     20880
     gaggtcggcc atcgtggcga ggtacgcgtc gcgcagccgg ttgtaccagc cgtccaggta     20940
     acggccgttc tcgtagcgga cgtacgcctc gagcggcgtg acgtcgtagc cgagctccac     21000
     cgcgtacgcc acggtcggcg tcgcgtacca ggccgggccc tcggggcgct cgcccttcgg     21060
     cgtgaacggg ctgggcagca gactgccgtc caggtccgcc cacttgtcct tgccgagctt     21120
     caccctcgac aggtcgacgt gggacaggtc gaccagccac gagccgggca gcttcgggtc     21180
     gaacaccgga gccttgacgt gcgtcggcgc accgaggccg acgaccaggc cgttcgcgcc     21240
     agcggcgaag gccatgttca cgtcgatgcc caccaggtgc cgcagggtgc actcggcatc     21300
     cgtcatcggc cgcgcccagt cgtacgcctc ctcaaacagc ttctcgccgg ggccgcgcac     21360
     gtggaaccgc ggcaggtcct tgaggagcgg gtgcccgtca ggggcctcgc acggcgcgca     21420
     gtccaccggg tccttcccga gcgagccggg gttgtgctcg gagtgccgct tgcccgtcgc     21480
     gtcggcctcg gaggcgcggg tcggcgggtg cagggcggtc atcagttcca ggccggtcac     21540
     ggcggtcgat ccgcgcggcg tcatcacccg ggacgcgtac acgcccagca cacgggcgag     21600
     ctccgctggc gggagctgcc cggcctggcc ccagtgacgg gtgtccagcg cgttccacga     21660
     cggaatgcac agctgcacgc aggcccgctc cgaaccctgc gcgggacggt agatccgcgc     21720
     ccacgggccg aacccgcgct tcgtcagctt ccactccgct cgggccaact gcttgatgac     21780
     cttgtggccc tcggggatcc gcccggcgag ccgctcctca tccgtgaggg tggtgggcag     21840
     gccgtagcgc tccagcgcgg actgggtgag cacaagcagt gggtcggcgt ccttgcccgg     21900
     cccggacagc tgcggctgac cgagcttggc atccttcagg gtccagtcga ccagggccgg     21960
     gatggacttg gcgggcacgt ccaggaccag gccgccgacg cagtacgcga ggacctggcc     22020
     gtcggcgtcg acgtcgacga ccgcgatcgg accgttggca aaacgcgggt cggtgccggc     22080
     cggagtgttc gccggggcgg ccttccgcgc agccgggcgg cgcgacgtcg acgacggcct     22140
     ggcggtgcgc gccggacgcg acgcggcagc cggagcagcg gcgttgtcgg tggggcgggg     22200
     ctggatgttc tcagaaacag tcatggtcgc agcctcggag gccggggctg tggacagagt     22260
     ccgcgcttcc ggagccacgg ggacgctcgt gaacgtctcc gggaccttgg ccgtgacacc     22320
     ggacggggcg tcggcgttgt ccgtgggagc cgggtacatc gcggcccatc cgtccaacag     22380
     gtgcttgtac gcggcgaggc gcggtgggcg gggcatcgtg cggccggtct cccagccatt     22440
     gacggtctcc cgtttcgtct gcagcgcgat cgccacatcc tcctgggtca gacctgccgc     22500
     ttcacgcagc cgcttccgct cggtcggcgg cggcagcaat gggccgcggg ccagtagctc     22560
     tgcggcccgc gccatcagtt cttcttccgt gggcatacgg cgacctccta cacccaccct     22620
     accgaatctc acattggaaa tcacatcgaa cgtcactttg aacgtaactt ttcagctcac     22680
     gcgagtgtat gatcacgctc gttctgcgat ctcgcgcccg acagaggcca gggcgcggca     22740
     cccgtcacca ggaggaacgg tggaacaagg aacagccagc ggcccggcgg ttctctccga     22800
     gcaggagagt tctgaggtgc tgcaccggct gatcctcccg gcagcgacgc gaagcgccgt     22860
     ccggcagccc cggccggtcg tgggtgtcgt cgccgggcag cccggcgccg ggaagaccga     22920
     gatcgccgac ctcgtgcagg ctgtgctgga ccgccgcggc ggctccgtac gcgtcggccg     22980
     ggacctgtac cagccgtttc accgccacta cgccgacgcc ctggccgccg atgtccgcac     23040
     ggccggagcg gtggtgcgcc ccgataccgc gcgctggcag gccgccgtcg aagcccacgt     23100
     ccgcgagatg ggcttcgacg cggtggtgga gtcggcgctc gccgactcag acgacttccg     23160
     cacctcgtct gccgcctacc gggccgccgg gcaccggatc gaggtggtgg cgctggccac     23220
     cgcagaggcc ctgagccagc tcggcatcgc ggaccgcttc ctcaccgagg acgctgccgg     23280
     cggcggccga tatgtgtcct gggaaaacca cgacggctgc gcgacgaaca tgctggccac     23340
     gctggccgtc atcgagaccg agcagctcgc cgaccgcgtc accgtcgtac ggcgcgacgg     23400
     caccgttctc tacgccaacg agctgaccgc cgaaggtggt tggcggcgcc ggacggctgc     23460
     ggatcgagtg gtgcggcggg agcggtcacg gccgtggacc gcgcccgaga ccgcctcttt     23520
     tcgccgcgag ctggcccgca ccgaccggcg cgtgcacgcc gaactcgtca gcgaggaccg     23580
     gcgcctggcc gtgcagcggg acaccgagcg cgcagccgcc tggtccgagc cggtccgccg     23640
     catcgcccag ccccgcaggc gcgcgcccgg cgtcgactac caccggctct cgcccgacga     23700
     acaccgctgg atcttcgagg agctgatcgc cccgtcgtac ctaaactgcg ttgtgccccg     23760
     cgacgatccg cgcgccgtgt acgtcctggg ccagcccgga gcgggcaaac tcctggccgc     23820
     caggatggtc cgccgcgcca tgcggcccgg tacgacccgc ctggtcggcg acgacttcaa     23880
     ggcctcgcac cccgactact accagctgct gcgcgacgat ccccgcagcg ccggggcagc     23940
     aatccgagcc gactacaagg cgtggttcgc ccaggctgag gagtacgtac gcctgcggcg     24000
     cggcgacgtc ctgatcgagg ccgcccccgg caacgcggag gagttcatcg acagcgccct     24060
     gccgttcgcg accatcggct atccggtcga actcgtggtc ctggccgtac gggaagccga     24120
     cagccggctc gccaccgcgc tgcgctacgc ccgggcgctg cagcgcggcg gcaccggcag     24180
     gttcaccaca cgcgccgggc acgacacctg cttccgcgcg ctcgccgacg tcgtcgccgt     24240
     cgctgagcgg cacccgcaga tcgcggccgt gaccgtgatc cgccgggacg gccacgccct     24300
     ggtgcgccac gaggccggcg gcgccggacg ggcgtcgtgg gcgctgacgg cggaacggct     24360
     ccgcccgtac accgagcagg aggccgccgc gttcctccgc ctccaccagg cgctgcgccg     24420
     ggcgctcccg cagcaccggg ctgagctgga cgagatctcc gctctcgccc ggcccctgat     24480
     gccgcctcgg gtgcagccgg cccgcatcga ccggccgcgc ccgaccgtct ggcccctgcc     24540
     gatcccacga cgggccccgg gctatgactc gctgagctcc ctcagccgtg ccgcataaac     24600
     ggcggcgatc cgctccgcct cctccgggtc ggcggtcgcc agctgcgcct ggtcggcgag     24660
     cgcggcctga cggccggcct tcagctcctc gatccgctcc tcatcgggca cgggtgcgcg     24720
     gcgctccgtg atgatctgag tgttgtacca gttcaccact tcctggacgg cgtcctctgc     24780
     cgcttgttcc tcgccgcctc ccaggccgga gaagtcgggc tcatctggtg taccgggcat     24840
     ggcaaactcc ttttgatctt gagtgggcgg ttattgtccc cgctgcctca gagccctcgc     24900
     ccaccacggt ctctggccct gctgtctcct ctcccagcgg cggtgtttca gcgcccagcg     24960
     ccacgccctg atccgccgat gaattcggcc gatgcggctg tcgagcacgt gatactcggg     25020
     atcggccagc cggaccaagt cctggtcgac gcccagggaa agaccgaaga aggtgccttc     25080
     ctggacttct ttgaacaggg cgacgccgct gacgacgacc gtgttgatcg gcacgctccc     25140
     ccggtacgcc gcgcggggct cgggcaggag aagcgtgtga cggatgtccg aggggtcgaa     25200
     ccagtcgtca gagacggcga aggcgttgga gccgaagtcg ttgacgccga cgtaccacga     25260
     gcgatagcca ccgacgttgc cgaagtagtg ctcttcgaag tagccgtagc ggcggttgcc     25320
     gagccaggcc cgatggatga cggtgctgtc gtcggagaga gtcgcgaagg tgctcttgcc     25380
     cagccggatc cgcgtttcgt tgacccgtat ccagggcctg aaccaccagc tggtcgtggt     25440
     gatcccgtac atcaccacga cgtcgtcctc acaccaggtg accaggtagc agagtctcga     25500
     caggagccag gtccggacag tgagctcgac tttccgctcc ccgtcatcgg ctccttcggg     25560
     ctgctcatcc ggggcgagtc gcgtggcgtg cagcgtcgac tgccacctcg gcttgtcgag     25620
     cagggactcg acatagtcgt gccggacgcc cggggtgatc ttgcggagac gggtggtgac     25680
     atagcgccgg cggccgacgg tgcggcgcca tccctcggtc agcgttttgg tgagggtcca     25740
     gctggcgacc aggactcccg ccgcctgcca gaggttgagg gtggtgctgt accagggctc     25800
     gggatcgggc ttcatcgctg aaggatgccg tacgccccag gccccgcagc agtctgccgc     25860
     cctggagcgg ggcggactcc ccaacaggag tgcggcgggc ataagttgga tcccgcaggt     25920
     gatcatcatt cgggggtggg tgtggcaggc cgggatctga gggctctgtt cagtacgaac     25980
     gaccgcagcg tgcaggccga cgaggcgttc acaaaccgcg cctcacagtg ggagacggtc     26040
     gcggccgcgc tcaccgaaca catccagcgc atcagcgcac ccggcttcga cgcagaggac     26100
     ctcgaggcgc cccgcaacca cgttctggtc ttccacggag tgggtggcat cggcaagacg     26160
     accctgtccc ggatgctgga ggcggcgctc accgacgccg gacggcgacc ctcccagtgg     26220
     ggcgagcccg gctggccggc cgaccggatc ctgcccgtac gcatcgacct cgcccgctcc     26280
     gccggcaccg acttcgagca gatcgtgctg acgatccggg ccgccctcac ccggatcggg     26340
     cgccccctgc ccgccttcga cctggccctg cgccgctact gggaagccaa ccacccgggc     26400
     gaaccgctgg aggagtacct gcgccggggc ggtctcggct cccggttcgg gcaggccctg     26460
     ccgcagcaga tgcagtccgc gctctccgac gtcgcccagg cgctcatgct gcccggcacc     26520
     atcggctcgg tcgtcggcca ggtcaccggc gccctggtcg gtgcgctgcg tgaacgccgc     26580
     cagaccgtac gggccctggc aggatgcgcc cggctggccg atctgctgga ggccgaaccc     26640
     gacctggacg ccttgtcctt ctacccgcac ctgctcgcgt gggagctcgc ccgcctcccc     26700
     gaaggcaaac gcgtcgtgcc ggtcgtactg ctcgacacgt tcgaggacat cggcgaccgc     26760
     acccgccgcg accttgagcg cctggtccag cggacggtgt ggctcttgcc gaacgcctta     26820
     tgggtgatca ccggccgctc ccgtctgcag tgggccgacc cagcgctgca gggccagctc     26880
     gactacaccg gccccgccgc ctggcccggc ctcgtccact cggccgtgcc agccgcccgc     26940
     acccccactc cggccggcac cgcacggcag gtcctgatcg gcgacttctc ccccgaggac     27000
     tgcgacgact acctcgcccg ccgcctcacc cgcggcgggc agcccctcat cagcgagccc     27060
     gtccggcagg tcatcaccgc ccgctcgcac ggcctgcccc tgcacctcga tctgtccgtc     27120
     gcccggttcc tggagctgag ccgcagcggc cgcaccccgc accccaggga cttcgaccac     27180
     gacttccccg ccctggtcgc ccgcaccctg accgacctca ccctcgatga acgccacgtc     27240
     ctgcgctcgg tgagcctgct ggacgccttc gacgtgccgc tcgccacgag ggccgcgggc     27300
     ctcgcccacg aaggcccggc ccttcggctg accgagcggc ccttcgtcca cgacagcccc     27360
     tttggcctgt ggcccttcca cctccacggc ctgatccgat ccgccgtacg caacgccgac     27420
     gacaccaccg acgaccgctg gactgaacgc gactggaagc aggccgccca gcgagccttc     27480
     accgccctgg gcgagcaaca ccaggccgcg cccggaccgg accggctcct gctgatcgcc     27540
     ttcctgcgcc aaggcctgcg cctcgcccgg gaccaccgac tgaacctcgg ctggctcacg     27600
     cccgccgcct ggacctacgt cagcgactcc gtgtgggaac ccctcgcccc acccgacacc     27660
     gacaccgaca ccacgggact ggacacggcc gccgacgccc tggtcgaact cctcagcgcg     27720
     ctcggccgcc gccagcacca gcaccgctcg cacaccgtcg cccgtctcac cacggtcatc     27780
     accagccgcc tactccccga cgacttgcag cacatggcgt tgtactaccg ggccaaggcc     27840
     caccgcgacc tcggggacag cccggcctcc cgcgcgggca tgcaggctgt cgccgacggc     27900
     cgaggccgcc ttgcccccgc cgctcgccgc ggacttgccc atctcgcccg tatggccggc     27960
     gacttcccca ccgccctggc caccgcacgc accctgggct gggaaggacg ccaccaccgc     28020
     gtcgaaggcg acatctggtg gccccacggg gacatggacc gcgccgccgc cgcgtacgcc     28080
     gccgcacgcg acgaagccga acatcacggt gtcactggtg agcgtggcaa cagccaggcg     28140
     caccgcgcct tcgccctggc cttcgccgac ccgatcgtcg ccgacgacga actcgccctc     28200
     gctgagcagc ttctggccga cgtggatctg cgcgccacca ccctgaacac ccatatcgcg     28260
     gcgctcgccc gcgacgccgg ccgcaccgac gccgacgtcg acgaccgcgc ccaggtgctg     28320
     cgcgccgaca tccgcacggc gggcgtgacg tacgccggac tcaccctgga actcgcgctc     28380
     tccttccact acgccgtccg tgaggcccac gacgaagtgg acgccgcgat ctcccggctg     28440
     cacgcggcca ccggtggcgg cgattacgcc tactacagcg acatcgcaca cttcatggcc     28500
     ggtctccccc tcgaggcggc ctcacgtgcc cgttggttcg atggacagca gcccacccgc     28560
     cagcggtggc ggacgctggt caccacccgc cgcgatcagc tgcacgtccc ccggtgacac     28620
     atgcccgcag ccccgccgga tggcggggct gcgggttggt gctgctgcgt tcagggcgtg     28680
     aggtccagta cgcggactgg ctcacctgcc caccggtgcg gggcagtggt ggcgatgatc     28740
     gcgccgtcgg ggcggtccgg ggtgggctgc gccgcgcact ggctgtgcgc cgcggcccaa     28800
     gtctcctgac gcgcgacggc cagggcggcg gccaggtcca gatcgaggac ggtgatgccg     28860
     ggcagggagg ccaggtgctc ggccgtgccg ggccgggcgc ggtcggcttc cactaacgcg     28920
     cacgcggggg cgtacaggaa ccagcccgat tcggcgtggg cgcggtggat cagacgggaa     28980
     gcaaggacgt tgccctggcc ggctgcggcc attgcggtgt cgtccaggac gatgtgcaca     29040
     gcgtcgctca ctggctggtc acctgggcca ggcgccggtc cagctcgctg tccaggtcct     29100
     gctcctcggc agcggtcggc gcgtagccgt tccactcctt cagcgcggcc agggccttct     29160
     ccgcccgctc ggcccgctcg gccggagtca gcagcgtctc agcgagacgg gcgagatacg     29220
     cgcgcagcga cagaccctca gcggcagcta tggcggccag ccggtccttg gcttcctcgg     29280
     ggatgcggac gttggcatcg gacatcgtcg tgctccttcc catccctaaa gggtacgggt     29340
     acgtacccgt acccgtcatg ggactgattc cagtcactac cctgttgtgt ggccgaaccc     29400
     agtgcaatgc tgtgactgcg gtgatcctcc aacccccgtg gaggcccccg cttcttggcc     29460
     cgcccgtgtg ctgtcacctg ggcggggccg cgccgtccct cccggccctc cccacgggag     29520
     ggccgacggc tgcgcagacg ccgcgctctc acatcagtcg gtgatgtgca cggtgacgta     29580
     caggtctccg ggcgcaccgc cgtggcgtgc cggggccgcc aagttcgcgg atccggaact     29640
     cctggccgtc ctcgatgccc gcggggatgc ggaccttgta ggtgtgctgc tcgcggacga     29700
     tccggccctc tcccttgcag gtggtgcagg cttgtgcccc cttctcgtct gtgtgaaccg     29760
     tttgaaaacg acatagcgcc acgttggccc ggcggcgcag tggcgggtac ctcagctcca     29820
     cagcttgcgg gtgaactcct tcgcccactc cacccgctcg tggtgcggac cgtggggcat     29880
     gcacggggag ttcgggccgg cctggcactt tgggcaagtg acctccttcg catcccaggt     29940
     ccgcgccgcc gagcccgcgg tctcctgcgg ttcccgctct ctcctgcgcg gtcgaggagg     30000
     ccggacttta gcccgggcag gcggcggggc ctggtgctga cgttcgtcgc gggcgccctt     30060
     ctgcttctcg ccggggccaa ggcggtcgtc gctctgcagg acgcggcgca ggcgttcgtc     30120
     gtggggaagc tgtcgcttct cgctggggcc gacgcgatcg tcgttgtcgc acagcttgcc     30180
     cggtccggcg tggcatcgcg ggcacatcat tcggtaccag tcgccgcgtg gcacttggtg     30240
     gtgcagccgg gccgcggtct tcttgcccgc ctcctgcgcc tggccctccc ggtcggcctc     30300
     cggccgccgc tcctggagcg gacgtggggg actgacttca cgctcatgcg cctccggggc     30360
     cggctgcatc ggctcggcag aagcctcaac atcttgccga gccttcttct gttgccgggc     30420
     catcttttgt gcggctttcc gctcgtccac gatcagctgc agccgctcat tgtggccgtc     30480
     cttgcgcggc ttcccgctgc tgggcccctc gaccagcaca cagtccttgc cctgctccgc     30540
     gttgcagcgc ggacaactcc gctggatcca gtaccgccgc gccacgccca gctgctcctg     30600
     cggccccagt gccgcccgct tcttccagac ctccacacgc cgcgcttcac cacgcgtcag     30660
     tagttctccg gccgaggccg cggaccgcaa caggtcctcc acctgagggc gcagattgaa     30720
     cgtgtacgcg tcgtacccgc gaaggcgatg gagggcgctg cggacgctag ccgcagcctt     30780
     ttgtgcttcc ttctcagtgt cagcttccgc ttcgaccgcg tcccgcgtga ggtcgtccag     30840
     gctctcgaag tacgtgatcg cccgctcgta gacggcggac tcggcgtccg tgcgatcctc     30900
     agccgccgtc gcgttgacgc gaatcagaag cctgcgcacc cgcccaggct tctgctcagc     30960
     caccgccctc ttcaacttgt cgaacagctt gccgcgctcc tcgttctgct cgaccagcca     31020
     gatcctcgcg tggcgaaccg cagcctcgag ctgctcctgg agctcgccct ccacaccggt     31080
     cagatcctcg atctccccgc acacctgctt caccaaggac acagactcga tccgacgcgc     31140
     atacaccagc cggcgcagca gggcctgggc gcgcgcctcc ggctccggca ccttcctcgc     31200
     cttgccgggc gaccacagcg atggacgcgg cgcattgcgg gcctgaacga tcttctcaac     31260
     ggccggtgtc gacaacccgc gctccgtcat ctcgcacttg tccagagcga accattcgat     31320
     cggcctggcg aaggcctcgg ttccgatctg cacgtggcgc gcggtgccca cgctgtccag     31380
     ccggatccga tgcacgtacc agcggcggat cagtgtgtcg cggtcgaccg gcaccatcgt     31440
     cccgaggaca ggctccacat cgtcgtccca caccggcgcg accgcctggt ccaaatgcac     31500
     ccgcagagcg ccatgccgcc agcgcacatc cacgacggac ccgatcggtg ccccttcggt     31560
     gcgggtgtac tcgaaggtcg cctgctcccc gcggccggcg agccaggccg cggccgccga     31620
     ccgcacataa aggtggtctg cgctgtccac gccgtgggag cggcgcccgc acacatgcgg     31680
     cagcccgtcc ggatcagggt gatgtgcgaa atgacaggcc cggtccgtgt acagcttcgt     31740
     ggtcaactgg ccgccgcagc cgccgagcag cgtcccgcac caaaaggtgt cgtcctcgtg     31800
     agaacggcgg aatgcatcca gctcgatcgc ttccatcggc agcatcaacg gctcatccga     31860
     gtccgctccg ccgagcaccg ccgtctggat ccgccgcctg tccgtgcgca caaactcccc     31920
     cgtcctctcc agccaacaca tcctgtcacc agcggagttc accaaccaga tcgcctctgg     31980
     gctggactca cgccgtacgc cctacctctc ccccgaggac gccgtcgcgg ccgtgaagac     32040
     cgtgccgaag aacgagccgc cgaactcccc cggcttcgtc gaccgctaca agagggccgt     32100
     ggaccagctc gccgagaaac gccgccagaa ggaagacgcc aagcgccgcc aggctgtcga     32160
     tgacgaccag gccgccccgt ccagccaggc gcccgcagct tgacggccaa gggtctagcg     32220
     gcgacggcgg ccgccgtcgc cgctggccga ccggagagga tgtcccgcct cacctggtgg     32280
     gatccggtgg gcagccgcac actcggcatc cggcttggcc tcgatgcccc ggctgcgtgt     32340
     tacccctcga tccgcacgac gacgaagagg tcccccgcct cgcccccgtt ccttcccggc     32400
     cagcccagtc ctttcagacg tagtcgctgc cccgctttta cccctggggg aatccggatc     32460
     cgatgggttg tttcggcgga agcctcgccg gttccctgac aggactcaca gccctccgca     32520
     ccgcctgcgc caggctcgga ggcgcaggcc gggcagggcg cccggtctgc cagaagaatg     32580
     tgcgtgaccg cgccgaaggc tgcgatgcgg gggctgacgg cggagcggac gtatctgtcc     32640
     agcccacggt tgggcaagcc ctcatcgaag taccgccggt cgatttcgcg gagggccagc     32700
     atgacctgga aggcgtcggc tgggcggtcg tcagggttct tggccaggag ccgttcaaca     32760
     aggttgacca gtgcaggcgg ggtggagagc cgtcgtttga tcaagggagc cggctgttcg     32820
     ttggggtgct ggttgatcag gtgccaggag gtcccggtga agggctggtg cccggtgagc     32880
     atctcgtaga gcacgcaccc gagcgagtac aggtcggagc ggtggtcgaa ggtcccgttg     32940
     aagcactcgg gcgccatgta ggccggggtg ccgatcagga cgccgctggt ggtgatgtca     33000
     tgccgttcgt cgctgctctt ggtgatgccg aagtcgacca ccgtcgcctg gccgttggag     33060
     cggacgatga tgttggacgg tttgatgtcg cggtgggtca gacctgcccc gtgcgcggtg     33120
     cccagggcat cggcgatgca gaccgccgtg cgaacggcat cgggcagggg cagtcggccg     33180
     tccttcagca caacgctgag gggccttccg cgaagcaact ccaccaccag gtaggcgtgc     33240
     aaccgtccgt cgtccatcgc ggagccgaag tcgtgcacgg tgacgatgtg cggatgggac     33300
     aggccgccgg cgaccgcggc ttcgcgggcg aagcgggccg cctgccggct gctgtccgcg     33360
     ctgccgtcgc cggtgaggac cttgaccgcc accagccggt cgaccttggg atcgtgcgcc     33420
     ttccagacct gcccgaaccc gcccgcaccg atcggctcga tcagccggta gcggccgtcc     33480
     agcacggtcc ctgccagcac gactccccct tcacggcacg caccgcgacg catggtgtac     33540
     caggcgtgta cccgtcacgc tacgccggga caaccaccag taacagggga tgctgatcta     33600
     tcagttgggt caggctgtgg tccgcagtgc cgccggcggc ccgacggtcg gcgtcccggc     33660
     ttcacgggcc gcgcgctctt gtcgggcccg gcgcagggcg gcggcctcgg ttgcagcagc     33720
     ctggcggcgg cgctgcgcgc gggcctgctc gatcggggcc ggcccatcgt cggagacgac     33780
     gtcgggctcc gggaacgccc tacggctcag ttcccgcatc gcggcggttt gccgctccac     33840
     cgcttcggcg atggccgggt ccacccggcg cggcggggcc acctcctggt gcgcggcgag     33900
     tgcgcggcgg taatcgtccg acgcggtctc ccgggtgcgc acaggcccgg cgggcgcggc     33960
     cgcgaactcg gggtcccggt aagaaacctg tcaccagccg caaaccggtg tgtggactgg     34020
     ttcagctgag gagtgcggtg agggttgcgg tcacggtggc ggcgagggtg atgaccgtgg     34080
     cgaaggtggt ggcggcgcgg gtgagggcgg cggggtaggt ggcgccgtcc atgcgggcga     34140
     gcttgcccgc gccagcggca gccagcagcg cgacgacgat cacgagtgcg gtggtcagta     34200
     tgacgacggc gacggccacg gcgggctccc tgtaggcggt ggggtgttga cgtggtcgaa     34260
     ggtcgcggaa tcggtgcgcg ccggggttcg gcgggacgaa gatggacacc ggcgaacaca     34320
     tcagggcctc gggggcgagc acgtgcacgg caagcagagc ggcggcagtc tggcactcac     34380
     cgaactgcgc gagagactgg ccgacgggtt ggcccgggcc cggctgaatc agacgcagct     34440
     cgccaagcag gctgagctgg ggcgcaccac ggtgtcggag gcgctctcgc ccacgaagcc     34500
     ggtgccgtct gcggagacgg tggcggcgtt ggcccgtgtg ctgcggctgc cggtggggga     34560
     gctgctggag ttgcggtgga ccgcggtcga ggaggcgggc acggtcccgg cgggcgggcc     34620
     ggggcgtcgg atcggacagt gggatccgca tgatctggag gttcatccgg ccggggccgg     34680
     ccgggcccct tcggaccccg acacgcctgt gctgcgggcg ctgcccgggt atgtgccccg     34740
     cgagcatgac gggttgctgg gtgaagcggt ccgggacgct gcggccggcc gcagccggat     34800
     cgtggtgctg gtgggcagct cgtcgacggg gaagacccgg gcgtgctggg aggccgtcca     34860
     gcccctcgcg aagaaggggt ggcggctgtg gcatcccttc gacccgaccc gggcggaggc     34920
     cgcggtggag gatctgcacc gtgtcgggcc ccgcaccgtg gtgtggttga acgaggctca     34980
     gcactacctc ggcaacccgg tatccggtga gcggatcgcg gcggctgtgc atcacctgct     35040
     ggtcagcccg gagcgcgggc ccgtcctcgt gctgggcacg ctctggcccg agtacgagaa     35100
     gcagtacacg gccctgcctc gtccaggaac ggaagatccg tacagccggg cgcgggaact     35160
     gctcgccggt cgcaccctgg ccgtcccaga ggccttcgac gctcgggctc tggctgcggc     35220
     cgctgtcctt gccgagagcg gtgaccggct gatggcggac gccctcaccc gcgcccgaac     35280
     cgacggacgc atgacccagg acctggccgg cgcccccgaa ctcctcaacc gctaccagaa     35340
     cgccagcccg gccgccaagg cagtgttgga agcggcgatg gacgcgcgcc gcctcggcgt     35400
     cggcctccac ctttcccagg ccttcctcac cgacgccgcc accgactacc tcgatcagaa     35460
     cgactacgac cagctcaccg acgactgggc agaacaggcc tacgccgaac tcgctctact     35520
     cgtccacggc aaacaggccc ccctgcgccg taccaccccc cgcgccccac ggcgtccgcc     35580
     tcccgccgct gccaccgaag caccggcccc gccgcctgcg ggaccacagt tccggctcgc     35640
     cgactacctc gaacaacaca gccgcaccac ccgccgccac ctgtgcccgc ctgcctcctt     35700
     ctggcacgcc gcccacaccc acctcgtccg ccccgacgac ctgggcaacc tcaccgaggc     35760
     agccgaggga cgccaccgct tgcaatgggc ccaccaccta cgccaccgcg ccgccaccca     35820
     cggcagcacc accgctctgt tccgcctggc catgatgcgg gagcgggccg gggaccggga     35880
     gggtgctgaa gccctgctcc ggcaggccgc cgaccgcggc agcaccaccg ctctgtccgg     35940
     cctggccgac atgcgggagc gggccgggga ccgggagggt gctgaagccc tggcccggca     36000
     ggccgccgac cgcggcaaca ccgacgccct gtaccgcctg gccgacatgc gggagcgggc     36060
     cggggaccgg gagggtgctg aagccctggc ccggcaggcc gccgaccgcg gcaacaccga     36120
     cgtcctgtgc cgcctggccg acatgcggga gcgggacggg gaccgggagg gtgctgaagc     36180
     cgtgctccgg caggccgccg accgcggcaa caccgacgtc ctgtaccgcc tggccgacat     36240
     gcgggagcgg gacggggacc gggagggtgc tgaagccctg ttccggcagg ccgccgaccg     36300
     cggcagcacc accgctctgt tccgcctggc catgatgtgg gagggggccg gggaccggga     36360
     gggtgctgaa gccgtgctcc ggcaggccgc cgaccgcggc aacacccacg tcctgtaccg     36420
     cctggccgac atgcgggagg aggccgggga ccgggagggt gctgaagccc tggcccggca     36480
     ggccgccgac cgcggcaaca ccgacgtcct gtgccgcctg gcccaggtgc gggagggggc     36540
     cggggaccgg gagggtgctg aagccctgtt ccggcaggcc gccgaccgcg gcaacaccga     36600
     cgtcctgtgc cgcctggccc aggtgcggga gggggccggg gaccgggagg gtgctgaagc     36660
     cctgttccgg caggccgccg accgcggcaa caccgacgtc ctgtaccgcc tggccgagat     36720
     gcgggaggag gccggggacc gggagggtgc tgaagccctg gcccggcagg ccgccgaccg     36780
     cggcaacacc gacgtcctgt gccgcctggc ccaggtgcgg gaggaggccg gggaccggga     36840
     gggtgctgaa gccctgttcc ggcaggccgc cgaccgcggc agcacccacg tcctgtaccg     36900
     cctggccgag atgcgggagg tgctcagaag gcagtggcca tacggcttgg acccggacgg     36960
     tacgccgaca cctccatggc aaccgccgtc ggctcccacc gtgctcggct gacacgtacc     37020
     gccagacgta tcgcacggga cgccgtcgtt tgcggttggt gacacagttc tttacgggca     37080
     ccccgactcc ggggtgacgt cggccggctc ggacacgggc accgagccgg gcgcgaggat     37140
     ccgcagcccc cgtacgaccg tgcggcccgc agactcgttg gccgcttcga cgacgcgggc     37200
     ctgctccagg cgcagcttcg tcgcccaggc cgccgactcc gggcacacgg tgagccggcc     37260
     ggagtcggcg tcgcacccga ccgcgacgac gtgcccgaag tcaggtgcga tggcttccca     37320
     ccgtgcgcgc agggaagcgc ctgcggccgg gagctcccag gcccgctcgg tcaccagggc     37380
     gctgatcgcg gcaccgagcc ccatcggctc gcgcccgtcg cgccggacca cccgggtcgt     37440
     gcgcggcttc ggctgcgccg tacggccgcc gccgttcttc tgcgccgcta ccttggctgc     37500
     gcgcagtgcg acgcgggcca ggtccacgcc gctgagctgc ggtgtctcgg tcatcacgcc     37560
     acctccccgg ccagctcctg gacgcggtgg actccgcaga cgttgcgaaa cggcaggggc     37620
     ttccgcccgc acggcacggt tccgtcccgg cccgagcagg tctgctgctc agccgtcacg     37680
     gggcccgcct ggcggggcgc ggccgcgggt gcggaggcag cggccagcgc ggcggcttcc     37740
     tcgcggcaga gcttgcacag gccgtcctcg agggcgcggc cgaccacgac gatccgggcg     37800
     ccacagtccc cgcaggaacc gcgcggcgga ccctccggct cgcgctgtgc cggggccggg     37860
     gccgacgccg ggttgcggat cgcgtcgtcc agcacgcagt cgacgcagtg gccgcccggg     37920
     ccgggccggg tgccgtgctc ggggcacagg ccctgctcga tgcgctgggc gtgcctgcgg     37980
     gcggcggtct tgtcctggac gatctcggca cacacttcgc agtccttgcc ggtcgaccac     38040
     aggacaccgg cctcacagtc ctggaagccg cagccccagc gcggcagggc caccccgagc     38100
     agccaccggc ccgggtcgcg gatctccgag agcatcacct tggagaaccg ggcggtgagc     38160
     cggtggtgca agcgttcggc atccgtgccc tcgcgcagct ggcggcccac cgcacgggcg     38220
     atctgccgga cgacgaagtc gctgttcacc cgctccagca gcaggtgaac cggctccagc     38280
     acggcgtaga tctgggggtt catggccaac tgcggtccgt cgtacgacga ccggcgggaa     38340
     cctccgtccc tgctgctgcg cttttcggtt tctggcttcg aaggggaggg tcggctgttt     38400
     ccacccgcgc gaagcgcgag accaccgccg ccttccgcac gcgcactcgc agcagccgag     38460
     ttttccacag ccccagcgcc ctcaactacc ggtacctcgc ctacggcggg tgacaagaac     38520
     gcgccctcgt catccggtga gtcagtccta ggtgattcct cattcgcgag ggatccctca     38580
     ccaaccggcg aacccgatcc ctcaccaacc agagaactaa ccgactcctg cgaaccactg     38640
     gtcacaccag cctcaacagc ccccgcgacc gccgcgcagc caccctccgg acgggcctca     38700
     ggagcgatgt cgtgcgcgat ataccggtgg cgcccctgcg cccccgcacg ccgctgcacc     38760
     gtcacccagc gcgccgcctc cacctcgtcc acgaccgccg acgccgccgt caccgacaac     38820
     ggctgaccgg ccttctggcc cgagtgatgc cgcaggccgg ccgccagctc agcctccgtc     38880
     agcgtgatcc cccgcgcctg cgcatacgcg atcagagcga acgcacgcag ctctcggggc     38940
     gtgaggtcct ccgcggccgc caccggcagc cacacgaacg cctccgtacg agtcatcgcc     39000
     cgtaccgtcc gcaccgccga cgtgcccgtg ccgcccggca gcgtccgacg atccgagaac     39060
     agctccacca ccccgtccgg accaggacga cgcagctgcg tcatcccccg ctccaccgac     39120
     gccgtcgaca gccccagata cgaggcgatc gtcgtggact tcgcctggca cccctccggc     39180
     cgcagcccga gcgccttcac cttcacgtac accgacaacg cgacgtcctg gtagtgcggc     39240
     gaggacacca gacgcatcgg cacccgcacc cgctgccgcc gaacccgccc ggccggagcc     39300
     ccgtcgacgg agttgtcgat ggactcccac agggggtgat ctagcgtggc ggccgacgcc     39360
     gctccagcgc tcacaggaac atccccgagg tcaggcggtc cgccggaccg gcgtcatccg     39420
     tgtgacagtc aaggagtgtg atgtacgtca caatcccgcc aggagggaca ccacaaccag     39480
     cagaaatcac ccccggcggg ggtgcggcct ggtcgtggtc gacctgacaa gacgactcac     39540
     gctcgtgcac tatggcgata ccgaccttcc atatggatca acgcagaggg gccccttggc     39600
     cggggccgat ctcgatggct cgtgtggcgg gacaggtgag ccccctccgt gaggagcggg     39660
     cgacagtacg aaggccagag gcggatctcc ttccgttgac gacttggtgc tggtgttccg     39720
     aaagcccttg gccgggcctc ggaacgaacc gcgaagcccc ttggcggggg cccgcgggtg     39780
     gtgcagtgca gtgcagtgca atggccctga tgaggggccg gatcgaaatg agcggcttga     39840
     taagccgcgg ctcagaaccg gtagcagccg ggatctgagc ggaccgctct ggtggctatt     39900
     ccaggcggta gacgggccgc gcgaggccga aggggatggc tagtccacct tttcttggcg     39960
     cgcgcggccg atggccacta ggtcatccca accccctgaa tccggaggct ggcgtcagca     40020
     tgcgcgcgta cagcccggat ggcgtgatcg cgattgaaga acggcgtagc tgcgcgtgtg     40080
     gttccacgcg tgcgggtaac cttcatcccg cgagcacctc ccatcaaggt gtgtcgccca     40140
     acggagcttc gccccgttcg agagccccca gtggaccagg cccggtcccg ggggttctcg     40200
     ccgttatgga tcacgtctgc gagcagccta accgcacgac cggatagaac tgcgaggcga     40260
     attcgcacaa cgcccgaggt gcccggaatg ccgagcccgc cagacgggaa gcgcgcagta     40320
     aattgcccgc cacacgggaa agtcgtctgt cgtataggca cttcacaccc ccttataggt     40380
     cgggcagcag cgcggacgcg gctagcgtgg catgggactt gactaggtgt ctggtgacat     40440
     tcggcggtga catccggatc aactcctggg cgccgcggac tatccgggcg ggtcgaccgc     40500
     ccggatgaag gtgctgaaag tccgcgcgat cgacgacgtc gtgttcgtcc gctacgcgcc     40560
     caaggagcgc ggctgatgta cgcgcgcggt gacattcggc ggtgacatcc ggatgtcacc     40620
     gccgaatgtc accgcgcgcg tacatcagcc gcgctccttg ggcgcgtagc ggacgaacac     40680
     gacgtcgtcg atcgcgcgga cttccagcac cttcatccgg gcggtcgacc cgcccggata     40740
     gtccgcggcg cccaggaact gagccgcctc gggctggccg acaaggagcg gggcgatagc     40800
     gaggtggact tcgtcggcga ggttcgcggc catcagctgc gtgtggatgg tgccaccgcc     40860
     ctccaccatg agccggccga cgccgcggcg cccgagctca tcgaggacca ggccccagtc     40920
     gagctcgggg ccgacaccga ccacgtcggc caggtcgccc agggtggcgc gcaccttctc     40980
     caccgcgctg tccacggtga ccaccagctt gtcgccgccg tggtgccaga agttcaggtc     41040
     ggcggagagg tcgccggact gggtgaccgt gaccttcagc gggtactccg gcttgccgtc     41100
     ggcgacgcgc tgagcgcgcc gttcgtcgct gttgaccagc agacgcgggt tgtcccggcg     41160
     catggtgttc gcgccgatca gtatggcgtc ggattcggcg cggacctggt cgacgcggtc     41220
     gaagtcctcc gcgttggaca ggcgcagccg ctcggggctg gtgtcgtcca ggtagccgtc     41280
     aaccgacatg gcggcggaga gcaggacgta cgggcgggcg gtcatctgat caggcttccg     41340
     tttctgtctc gtggacaagg gtggagtcga aggcggcgcg gaactcttcg acctccggca     41400
     cgcgctgcca gggggtcagg gccttgtcga gccgagtgag ctcgttcgtg atccggcccg     41460
     atcccgtgtc tcccgcgacc atcagcgcgt tcataccgac cgcagcggcc tgctccggca     41520
     cccgggcgcc ggccagagcc acggcctgcc gcgccatgta gacaccgcgg tcgcggtggt     41580
     agccgtccgg catcatccgg atcgcagcgg cgaacccatc tgcggcctgg tcgtgcttgc     41640
     cgagggcctc caggccctga gcgcggtgga tctctacata cgaggcggac agccacacgc     41700
     cccacggagt ggggtcggcg gccgcgccat cgagggcgtt gcggacgtcg tcgatggcgc     41760
     gctcgctctc gtcagcgtcg ccgcgcaacg cgtgcccgta cgcctcatac gtgcgcgcga     41820
     cggcggcgag ccggctgcgc gggcgcgcca tgcgctgcgc ggcttctgcg aggtcgacta     41880
     cgtcgaccaa atccgctgtg tcaccggcca gttgcgcctt gcgggccatg acgtatgtgc     41940
     tcagatcggt gtctccgacc gtgtgcgacc actgcattgc ccggtccagc cagtacgacg     42000
     ccgcctccgg gttgcccaga tcctggtaga tccaggacag gaactctccg tactgcgttt     42060
     gcagctccat gaggtcgcgc cggtcgatgc ctttggcgtc ccgccgcagc tcctggatga     42120
     cctggatgtg gtcgcgtacc gcgccgacga cttgccgagg ccccaggagg ttgtcgctgt     42180
     cgatcaggag gcggcgggtg cggcgcaggt gctccaccgg cgtggacccg tacgctgacg     42240
     cggcccgcgc cttgcggacc aagcctggta cagcgctcga gtccgctgtt gccggcgaac     42300
     ccactccgac cgcggcagcg gctccaagcc ccaccccagt gcgcagcagc gcacgccgat     42360
     ccagagccac ccaaaccacc gacccatcac gtagacgaca cgggacagag agcccctcac     42420
     cgtccgacgc tgcctggtct ggcaagccca aagctagatc aactgatgac ttggccacat     42480
     gaaccggcga attggccaca tggccacgtc cgtcgtcgat ccgctcccac aggcggaata     42540
     acatgccgtt cgcgcccagg acttggtcca ggagtgcggc ctgtgagcgg tcggccttcc     42600
     gttcggcgcg ctcgaatcgc cccaggtggc tgtggtcgag caccgctcgc tgcgacaggt     42660
     cgcgcaggct ccaccctcgc agctttcgga gctgccgcag ctcgtaaccc cagttgtgca     42720
     agggcgacac ccagggcgtc aactcccttg gcctctgtgc catcccgccc caatcctgtg     42780
     gctgatgtgg ccagttcgtc aggccacatg tcagatctgg aactcatgac tcccccgggc     42840
     ctagaaccga actgcaagca gtcaagcccg gtcagggagg tgttcttcag tggtcttctt     42900
     cgtctccgtc ttcgtccgca tccgagagcc gggcactggc gtgacgacgg atggagtagc     42960
     cgatctcgaa ctcttcggcg ctcatccggg tgtcgttgag ctcaacgact tcgccggtgg     43020
     gcgaggtcgt gactcgtacg acgcgcaaga gcggaacgcc tacgtcggca ggaaggttca     43080
     gggcttcggc ttcttcaggg gaaggcatgc gagccgagac gctctcgctc cagcgcaggg     43140
     gtcgatgtcc catctcctcc agccggtcgt aaatacctcc tgggccggta tcggcttcgg     43200
     cgaggagggt tcctcgagcg agttcggccg gcaggtagct ggtcgccaac tgcttcggct     43260
     tcctcgtctc ggggtcgccc atcacgcggt cccggatgaa gacttcggcg ccggtggcga     43320
     ggcccatgag ggcagcgaga tcgaccggca cgatgcccca ccgcagggtg ggcgtctcca     43380
     gggccgccca cgactgggcg gtcgggtcga agtagtagcc gatctcgtca cggaagacct     43440
     ggcgcgaccg ggtgatgcgt cgcttctccg gacgttcccg aacgatcgtc cctcttcggc     43500
     gtaccgcgat gaccaagccc tcttgctcca gaagagcgat ggcgctccgc accgtttggt     43560
     agcccgcgcc gtactgcgtc tgaagctcgg tcagcatcgg cagcttgtcg cccggcacgt     43620
     accgcccgtg gctgatctgc tgtcgcaggt cagcggcgat gtcgcgatac gagacgggca     43680
     tcggagccac ctttcggagt gctgctcggg tctgattcta gggctagctc tatcagtcag     43740
     cgatgggcga gcacaagcga tcaacacgaa tagagctatc gctattgact cggcgttgcc     43800
     gcatggtctc tacttggcga tagcgatagc cctaacgatc cgttgaacag ggctacgcac     43860
     cctgcaccac cgcaagaccg caggaagtcg tccgcccctc acggggtggc cggggttgat     43920
     gcaccactaa atcccccggg ttctcgactc acctgcatgc acgtcgcagc gctgatgcgc     43980
     tgtccgtccc ccaggacgcc gggtctcccg tgcgcctggc gggcggagag agcaccgcga     44040
     cgcagcccct cccctccgta cacaaggaga tcccgcatga ccatcacgtc cgcgatgccc     44100
     acggcccgca agcgtccgac ccggacccgc acgaagcagg tcagcagcct ccccgcgatc     44160
     accgtctcga agctgccccc catcgacatc gacctgctcc ccggcacgga gagcctggtc     44220
     tgcccgaact gcagtcgctg gtgccccatc accgggcacg acggccgcaa cccgaagctg     44280
     gtcccccacc acaccggccg cgccggcacc gccgaacccc gccgatgtga cggcagcaac     44340
     cggcgagtga agctcgatct gacgatcgct gagtggcggg agctcctggc cgacgccatc     44400
     acggaagcct ccagccgcca agccaccgca gtgctgccca aggcgttcag tccgcagacc     44460
     gaccggaccc tgcgggctcg cgcggagcgc acgctggcag ggcgcgtggc cgactgggac     44520
     gcggtgctgc cgcgcgtggc agacgccgat aagaaccgcc gggcggtgcc cgctggtgac     44580
     gctcccacgg agggccccgc ggttccgctg accacgctcc accccaagcg ccccgagcgc     44640
     tgaaccgacc cgcacgaacg accacggccc cggccgaccc gatcacctcg ggtcggccgg     44700
     ggccgtggct gctcgtacga ccagccaaaa cgagcggccc cgggattgcg ccccagggcc     44760
     gttcagcagg tcaatccgtg agaggaaaaa ccttgagtcc catcatgaca tctcccgcgc     44820
     ctcctggtgc acgggcagac agcagcccgg acatggacga catgttgcgc cgaacccgca     44880
     tggacgacca gcgccgttcg caacggccgg cgcttccggc ctgcgtcccc ggcctgtacg     44940
     tccagcaccg cgaccgtggc ttcgtcgccc acatcacggc ctccgaggtc gccttcagca     45000
     cggtgcgcgg tctgaccgtg tcggtgccga tggcgtacgg ggccggccag gcgaccgccg     45060
     acaccgctga gtggctcgtc tcggagctgc tcggcaacgc cgtgcgggcc tgcggtgatc     45120
     acgtgccgct ggtcgtagag gtgtacgtca ccgggcgcag cgtccaggtg aacgtgcacg     45180
     accccgccgc cgatctgctg cctcaccgca gcgcggtggc gatggacagc gagaccgcgg     45240
     agtccgggcg cggcctgggt ctgctggaca tgctggcgcc tggctgggac gtcgtgtcct     45300
     ctccggtggg caagcagatc cgctgccaca tcgacgccaa gtagctcagc ccgccgccaa     45360
     tacacgagcc agtcccgggg attccgcccc ggggctggct cgtacacgga tcttttggga     45420
     ggcccacatg aagcgagtgt ccgtcgccgt cgtacgcagc cacgcctacg cgccggtctc     45480
     cactgacgcg atcgagcggt cccgcgccgc ctgcgtcgat gaggaccccg agctgttctt     45540
     cccgatcggc gacaccggcc cggcgctgtt ccagatcgag gaggccaagg ccgtctgccg     45600
     tcgctgcccg ctcatggaga gctgcctcca gggtgcgctg gagcggggcg aggacgcggg     45660
     tgtgtggggc gggctgtccg agaaggagcg ccgttccctc aagcgccgcg aggcccgcga     45720
     gcgcgctgcg gccgcctccg cctgacgcca tccgtacggg agcgacagtc aactcccctc     45780
     tcgcaccacg ctgttcaacc aggccagacg cccgtggtgc gggcggccgg cctttcgcac     45840
     gtctccagcc cgggaaagtc tcgggcccgc atccccgcag gagagcccat gcgcagcagt     45900
     acccagctcg acaccgcgac gactgcaacc ggctccaccc ggctgtcgga ctcactgtgc     45960
     acgcacaccc cgacgtgtcc gtcggccacc agctcggacc gcgaggccgc gcacgtcgtg     46020
     gccgcccacc cggagcaggg ctggagcctg ctgtgcaacg gcgtcctgct cttcgaggac     46080
     accggggagc tgctccccga cggccaggtc gtcgccccgc accggcacct cgcggtcgtg     46140
     gcctgacggt tgcctgatct gcccgcaccg accgccgaac gctggcggcc gggtcgggcg     46200
     gtgacgggga gccggacagc ccggaccacg tgacccgcca aggagttgcc gtgcgcgaca     46260
     gcgccaagag caccaccccc gcgatcaagt tcaagcaggg tcagttcgtc ctgtaccgcg     46320
     acccggagat gttctggacc gggcaggccg gccacacctt cgtgtgccgg gtccagcgga     46380
     cctggctgga gggcacctac gacctggtcg ccgtggccac cggccgcttc gtccactacg     46440
     ccaacgcgga ctacatgcgg ctgctgcccg ccgtcgacgc gatgcgcgac atcgacaccg     46500
     ccccgctcaa caccgacggc gcggccgacg acatgaccgc ggccgccatc gcctggctga     46560
     cccagcagca cgcgaccgcc aaccagcggc cggagctgcc cgcccagcgc gactgaccga     46620
     accacccgtg aaccgccgcc cccgggcggc atcgacctgg aaggaggcgg cgtggccgcc     46680
     actcgaaccc gcaacaagag gcccaccgcc cgtaagaagc tggcggcaac ccgtccggct     46740
     ccgcagccca ccgcctcccc cacccccgac gctcccgaga ccccggccgg gaccacggag     46800
     gcggaggtgg acttcgaggc gtcggccccc gtcgcggacg cccgggaccg ggccgccgac     46860
     gtcatcgaca ccgcacgcga gcaggccgcc gccctccagg cggaagccga gagcgcggcc     46920
     gcgcgcaccg tcgccgacac gcacgcgaag gtcaccgcgc tgatgaccga ggcgcagacc     46980
     cgtgccgcgg gcattaccgc cgacgccggt caggaggtca ccgcccagcg cacggcggcc     47040
     aagagcgacc tggaggccgc gcgcggcgag gccgaccggc tcctgacgga agcccgcgac     47100
     cgtgccgaga ccctcgtcaa ggaggcccgc gcgcaggtcg ccgacctgac cgagctggcc     47160
     gccaccgacc gtgaggcgac cggcaaggcg gttgccgagc tgcggcgcat ggccgaagcc     47220
     gacctcaccg agatcagcgc cttggtcgac cagcgccgcc ttgaggccgg gcagatcctt     47280
     gcccgcgccc aggagcaggc cgacgaactg gtggccgcgg cgcagcggga ggtcgaccag     47340
     gcccgcgagc ggttcgccca gctcgcggcg acggcggccg aacattacga cggccgccgg     47400
     gcggaggcgg aggcgctgta cgcggatgcg gtcaaggccg ctgacgaccg gcgccgcgaa     47460
     gccgacagct atgttgccgc cgcgcacacc gaggcggagc aggtccgcac cgagctgcgc     47520
     gagaagctgc gcgagctcac cgaccagttc gacacggagg ccgccgccaa gcgcaaggcc     47580
     ctcgccgatg aactcgccgg gctcaagcag gcgtgcgaca agcagcgcga gcggctgcgg     47640
     gaggaagcca agaccgtcgc ggtgcagctg cgggaggccg cccagaagga ggccgaccgc     47700
     atcaccacgg aggcggagcg caaggcgaag ggcatcaccg accgggcgca ggccgatgag     47760
     gcccgcgccc gccggctgct cgaggaggcc cgggcggcga agcgggccaa ctcccgcttc     47820
     cggggctggc agcagaacct cagccgcaag gcgtggaaga ccgccccgtg gatcgcgctc     47880
     gccgccggcg tcggtcttgc cgcctccggc gagtatgagc tggcccgcat ggtcggcatc     47940
     aaccagtacg tcgccccgct gctgccggtc agcatcgacg tctactgcgt caccgcgttc     48000
     cgggccaaga aggacatccc ctacgcgctg ctgctgatgg cgtcggcgaa cgtgacgtac     48060
     cacctgtccg agcaggccca catcgtcaag gaaggccagt cggcaccgtg gcagctgacc     48120
     acgttcgtcg tactgatctt cgtggccgtc atctggcgcg tccacacgct catgcacgac     48180
     gacggtacga acgggcacgg cagtacggct gctgcgggcg gccgtaccgg tacggacagc     48240
     ggaaacggaa cgcccgcccg tacaggtacg caccggcgta ccgacggaac ggacggcacg     48300
     tcgtccagcc gtacaggggc cgccagcccc gacctgtaca ccgctcgaag cacggtccgg     48360
     ccgcagggaa tgggcaccgg acgcgacggt acggaccctg tacgccccgc ctcgcacccg     48420
     ccgcacgatg acgggtccga agcggcggtg accaggccgt acagcgaccg tacagacggc     48480
     gtacacacca cccccgacgg ggcgcggcgt acaggtacag cggctgcggg gcgtaccggt     48540
     acggccagtg cggccgtaca ggcgcgtacc gggtcggtca gcgtccgtac acagtccggc     48600
     ggtgacggtg ttccggaggc ccgtacaggt acgggtgccg cgtcttctcc tgcaaccgga     48660
     accagcggtg cggcgggtgc ggaccgtccc ggtacgcctg tacggacgga cgctgaactc     48720
     ctgccgctcg tacagaacct gccgcgtgat gaggacggct tcgtcaccct ctaccaggcc     48780
     cgcaccaagc tcagcgtcaa ccagtcccgc gcagtccgac tgctgaagga ggccggcctg     48840
     ctgcgtcccg aggacgcgga caagcacctg cgctgatccg ccgtccggca cacagcagtg     48900
     agggccagcc catcggaagt gggctggccc tcgctgcgac tgccggaagc agtcgacagc     48960
     cccaccagta caccaggagg gaatccccgc cgtgaacagc aacagcgacc cgaattacgc     49020
     acctctgcgc gacgtcgcgc agagcccgga ggcaaccgcc cggtacctgg ccgacgttca     49080
     gcgggtcctg ctggacatcg gcaagaacct ggagaccctc gcgatcgaga cccgcgtgca     49140
     cctgcgcaag acgcacgtgg agggcgaccg ctggtaccac gccaggatgc gcgcgatgcc     49200
     cgtcgaaaag gccctcggga acgtgctcaa gaacctgaac aacctcaccg agggcctgga     49260
     aaagagcgcc tataagcgcc gcgcccacga cgagaacgtg gtgaatacgg tcaagggaag     49320
     gaaggaaaag gagctggaaa agcagcgtaa gaagaacccg ccgacgctcc aggccgcacc     49380
     caacccgccg cagcagggtg cgcagagcga gaattccgga tatggtggtc ccacgtcgat     49440
     ttacgacctc ggtcgggagt cggcgtgaac cgccccctca gcagtgccga acggtccgcc     49500
     gaacggcgtc agaactggct gaaggaagag gcgaagaaag cccgcgaatc tcgcggcgag     49560
     gcagggctga tggaattctg gctccgcctg gcacgatccc gaatgtccaa ggacgtcaaa     49620
     gccggtcgcg gcgacgtcta ctccggattc gcgctgatct gccgcctgtt catcacggcg     49680
     ctggaccagc gggtggaggg caacggacgg atctggaacg acctgctgca gtacgcggag     49740
     caggtcgtgg cgaagcaccc cccgcgtaac tgaacgtcac cagcgaaggc cccgccgggc     49800
     tccggcgggg cctcgcgcgc gtaaagcgtg cacacgtgca cgtgcacacg cgtgcacaca     49860
     agatcccacg ctctgtcaag tcccaggagg gaggcgcacc gtgtccgatg aggacggcac     49920
     agggaccctg gtccagggcc cctggagcgg tgattccacg tacgtgccac cgccgatccc     49980
     ggattacggc gacaccattc cgccgccgga agacattccc ccggcgccgc cggagtcgcc     50040
     ggaagagatg acgatggaac tgccgacgat tccggcagca ccggacccgt cagcggccct     50100
     gcgctctgaa ggaattacag caccggaaat cagcgaagat gacggcgaat gcgaggaagg     50160
     cgaatacgaa cagcctcgtt ctctcgctga ccgtctcggt gactggttgg aattccggct     50220
     ggaaatggcg cgggccaatc atgaaagcga aacgcctttc cgtgaggctg aaatagcacg     50280
     gaaggccgcg ctgctggagg gccgcaccgc gcaagaagtc gcgatgatgg agcagaacgg     50340
     aaagctccac gccgcgatga tgaaagcgaa gggcgacaag gcggcggcgc gcggaaaggc     50400
     cgacgccgac cgcacgaaag cgtccggctc cggcctgggg gcggacaagg gccgctcgaa     50460
     ggccggcggc gggggcgggt cctcgcgcgg cggtggcggc agcggtccgt cccacaacaa     50520
     ctcgggcccg gggtcgaacc gctccggcgg ctcgcgcggt cccaactccg gtggccccgg     50580
     cgggcgttcg gggtccggat cggcaggggg gagcggaggc ggcaagggcg gcacgaaggg     50640
     gtcccaggcg ggctctggcg gccgtgcatc cggtcctggg cgcagcggtt cgtccggggg     50700
     gtcgaaaggc tctcaggcgg gctctggtag ctccggccgg aacggcaact cccgtggtga     50760
     cggggccagt caggcgtccg gcgctcgtgc cgagcgggcc cgcggccgcc aggagcgcgc     50820
     cggggtccgg caggccgggc ggcaggagcg gcgcagcgcc gggcacgccg ccggtgtcgc     50880
     ggaccggagc aaggaccgcg accaggcgcg cgcccagcgg cagcaggcgt gggagggccg     50940
     ccgggccaag aaggcggagc gggcggaggc acggaaggcg aagcgggaag ccgcggcgtc     51000
     ggccgactcg ggccgcacca cgctgggtca ggccgtcggt gaggaagccc agcgccgctt     51060
     cgacaagcgc cgcgccgacg cgaaggccgc cgcggacgcg aaagatgcca aggccggcac     51120
     cgagaaggtg agcctgacca aggacaagga ctccaagggc aagggcaccg acgacggcaa     51180
     gagcaccgac ggcaaggacg ggaagtccgc caaggacggc cccgacgggg cctccagcgc     51240
     cgcgaaggac ggcaaggcgg gcgatgcgcc gggcgccgac tcaacggccg gtgacggggc     51300
     gtctgacggt gcgaagaagc ggcgccggtt ccggcgtcgg cgcaccggcg gcacgggccg     51360
     ggccggacgg cgcggacgta cccgccgcac ggggcgcacc agtcggacgg ggcgtggtcg     51420
     tacgggtcgt agtcgtaccg gtcggcgtgg ccgtccggcg gccagcccgt tcggcgagga     51480
     ggactccacc ccgacggtcg actttcccgg ccggcccacc cgcccgccgc gcacggacag     51540
     caagggcgag gacgacatcg tcgacgcgga catcgtcccc gacaagcccg cggccgtcac     51600
     gaccggcgtg aggggcctgc cgcccacgcc ggagaagcac accgcacggc ccggcaccag     51660
     ccgacccacc agcacggaag ggagcagcgt gagcagctcg gaagtcagca gcccgtccgg     51720
     cgcgggcggc ctcggtgtcc agcaccggac ggacatcacg ttcgacgagt tcctgatgga     51780
     gatggcgaac atcgccatcc aggccggcat ggaccaggag cgggccgaag ccctggcgga     51840
     ggcgctggcc aaagtcgccg acgccctgcg ggacatggcc accgacctga tcggcgacca     51900
     caacatctcc acccaggtca ccaacctgat cacggacctg gccgactccg cagcccgcat     51960
     gaagcagcag gccgaacggt gtgccgagca gtgcggcatc gccaaggagg ccgccacgct     52020
     cgcggccgcg atggtcgccc gcatctacgg ccaggacatg gccgccaagg aagacgcggg     52080
     cctgaagttc gcgtcggccg ccgcccacca cgactagaca cggagggaag acgccgatga     52140
     gcgatcttgc accccacaac accagcgcgg cgcccgcccc ggccgacggc gacaaccgct     52200
     acaaggccgt ccaggccaag ctggacaagc tcggcagggc catggacgac gccgtcctcg     52260
     aactggagtc gctgcggcgc agcatgcagg ccaacgcctc ccgcaccgag gacgtggccc     52320
     gcgacatcgc caacgccggc ctggacgtga agttcgtgga gctgaccaac aacgtggccg     52380
     tcgcgctggg cggcgccgcg gtccaggtcc gcaagctggc cgacaccgct gaggagaccg     52440
     ccgacctcac ccaccagacc cgacgcaccc actccacgct ctacggggcg ctggacgaca     52500
     tccgctccaa ccggcgcgag aagaccccca ggccgggctt cttcaaccgc tgaccctctc     52560
     ccccacccat ccccgccacg ggcggccccg cgatacctgc ggggccgccc gtcctgttcc     52620
     cgaaggagaa gccggtgacc acgccgcgca gtgtcgcgct cgaacgcctc gcctacaccc     52680
     tcgccgcgcc cctgctggcc gtggccccga acctgtactc cgacagcccc gtcaaccagg     52740
     tcgtgcagct ggccggcgct gccgggatcg gcggctggtt cctggccgcc aagagcgatg     52800
     agcccggcgc cggacgcaag atcctgcgct ggttcccgct ggtcctggcc gccgccgtcg     52860
     acgtcgccgc cgggcacacc accggcttcg gcccgtattg gatggacggg ctgctcgccg     52920
     ccggatgggc ggcggccggc tacctggtga tgccgttctc tcggcacacc cgccgccgcc     52980
     accgtcccgc cctcgccgcc ccggccccgc agccggcgcc cgccgaagtc ctcgaggagt     53040
     cggtggcgca gccggacgac ggcgccgacc tgctcacccg cgacgcacgg ttgctgtggg     53100
     agcaggccgg gatgcccggc cgcacgcaca tcgtcaaggc cacccggcac gacggtcagc     53160
     ggcacgacat gacgatcctg ctgcgcgcct cggagaccgg acggccgatc accggcctgt     53220
     cggaggccgc ggtcgccgcg ccgttcggcg tgcactccag cgacgtcgtc ctggcggagg     53280
     tcgccatcca gcctggccgc cagggcgggc ccggctggat ggaggcccgc atcacccccg     53340
     acgccaacgc ccggcgccgc accaagccga ccgcgcagga gcgctggacg gaccgggtcg     53400
     gcgggcccaa gggcggtgcc cccggctccg agctggtcca caagacccgc gacgacgaac     53460
     gcggggtgac cttctaccgg gcgaagatgg ccgactccac cgagaccccg cgtatcgacc     53520
     tggccaaggt ctgccgcgcg ctgaacctgc ccgaggacga ctcctgcgtg ttcgtcctca     53580
     tcgacggctc ggagttcctg atcagcgcgt tcgacacccc gccgctcagc gcgatcttcc     53640
     ccgccacccg cgagctgctc accccgaacg ccaagggcat gtacgtgtgc gggttcacca     53700
     tcactggcca gccggtgaag agcatggtgt accagcacga caagaacgcc gcggcccacg     53760
     gcctgatcct gggtgtgtcc cgctccggca agacgcagta tttcgcgatc aacatggccg     53820
     cccagtccct ggacggacag gtggtgtggc tgtccaccgt ccgcaaggac gagaagacca     53880
     ccgtgctcgg tcggtacatc gaccggcagg gctcgaacgc cctgtggatg gcgcggcagc     53940
     tgcgggcggc gaaggcgctg tgcgagatca gggcggagat gccctggccg cacgacggcc     54000
     agccgcacga ctacaagccg ggtgacacgc gctgcccgta ccggcagctg aacgtgtacg     54060
     ccgatgagtt catgaccgcg gcgcaggacg gggacttcgg cgagttcatc cagacggacg     54120
     gcgacgacct cacggtcacc gggctcaagt acggcatcgg cttcaacccc gcgggccagt     54180
     cgccgttcgc gcacaacggc ttctccacgg agatgaagga caacctgcgg cagaacagcc     54240
     gcccggtcat cttcaacatg ggttcgcccg gcgccacccg caaggcggcg gagggcacca     54300
     tggagaacgc ctacgacgtg ccgaccatcc cggcccgcta ctcccgcaac gaaggctccg     54360
     cgatcgagcg ggccatcaag ggcgaggccg acccggagaa cggcgtctcc acgggcggcg     54420
     tcgcggtcat cgtcctcgac aacggccgcg ccgtgctcat gcgctcgctg tacgcggact     54480
     tcgacaccga cctctccgaa ctgttccccg acgaggtcaa ccgcctcacc gactacgaga     54540
     tcagcgagct ggacaggcgc ggcctgtggt tcgactggaa cgagcccgtg cggcccggcg     54600
     agttctggcc cgagcccgac gaagacgacg agggcgaggg ccgctcccgc cggcgcggcg     54660
     gcggaggcgg cggcaagggc ggaggcgggc gcggctccaa gagcggcaac cgccgctccg     54720
     agcaggtcgc ctctccccgc caggcgctgg aggccatcaa gaacctcacc gacgcctgat     54780
     cacacccacc catccccggg gccggcccgc ccgagcacgg ccggccccac cccacccctt     54840
     gtgaaggagc accaccgccg tggccctctc catctccgcc gccgtgctgc tgggcatcat     54900
     cgtcgtcgtc ctggtcaagg gcggctacgt ccggatcggc tccgcactgg cctgcacgct     54960
     gttcggcttc accctcgccg cgaccggcct ggccccgacc atcaacagcg gcctcgcctc     55020
     gctcgccgga ctgatctcca gcctctgact acgcctcggt ccacggcggg tcgtgcgtgt     55080
     agttgagccc gtcgcagaag cggcagtccc actccgaggg cacctcccac ttgtcgaccc     55140
     agaagccgac ctgcttgccc acgaagaagt tgtccccgcc gcaccacccg cactcgaaga     55200
     cgaactccac ccgatcccct tccccgcgcc tgtcggcttc gaggatgccc ggggcgcagg     55260
     tgcggtgact acccacccgc cagccccaac tcacctgctg cacaacgccg aagggcgccg     55320
     ccggacacga tgccggcgac gcccttcgcc gttgcgcgcg gccactcccc cacgcgccct     55380
     cccggccacc acggccagga gggcgctccc cttcccgcgt gatcggagaa ccccatggac     55440
     cccctgcaca acacccagtc cgacatgccc gagtccgagg ccgcggccga agcccgccgc     55500
     ctgatcgacg actgggcgag caagcccgta cgccaccacc ccacctcgtt ccgcgacgac     55560
     accgagccgc cggccttcgg caccaccccg cccgtacggc aggaggacca ccggatcgtc     55620
     ccggcctggg cggccgggat cgcagtggcc tccatcggcg tgggcgccgg ggtaaccggc     55680
     atcggctgcg gtgcctggct cgtgctccag ggcctgtcct ccgtcacgtt gaacggcgtc     55740
     ctcatggtca ccctgccctt cgcgggcatc gcgatggtcg ccaccgccat cggcggcgcg     55800
     atcagcaagg cccgcgcggc cgtcaccaag aacgtcttcg agggtccggt cacccaccac     55860
     accgagatcc acaacaacag caccacgcgc ggggcgttct tcgcccgcac ccgcaacgag     55920
     atccgctgac cggctccgac cagcccacca ccactttcca ccgacccctc tgccgaagga     55980
     gcagcaacgc catgcccaac aacgacaagc cggtcaacgg ccaggagaac ccgtccttct     56040
     tcgacctgat cgaccagatg cccccgccgc cggtcctcga gctggacggc aagcccggca     56100
     cccggcggct cgcgcggctg cgcgccgcgt ggaaggagtc ctgggaagag ggcggcttcc     56160
     tctaccagcg gtgggaagag gtcttccagg cccggcacgg cagttggcac gaggtcgcca     56220
     actggatcaa ggcggcggca ctgttcggcg ggctcagcct catcgtcatg atgctggacg     56280
     ccgccggcga catcgcctcg gtcacgctca agggcctgtc cgccgtcccg gccacggacg     56340
     gcggtgacgg cagcggactg tggggcacgg tcgaccaccc catccggctc ttcctcgccg     56400
     accaggccgc gcacctgtcc gtcgccccgg ccgccctgta cgcgttctgg caactgaccg     56460
     gcctgctcgg tctggtcggc gggttcttcg gcaacgccgg agcccgcatc gcctggctgc     56520
     tgttcgggat cggcagtctc gcgatgatct ggtccaccgc cccggccggg ggccgcgccg     56580
     ccgctaccgg gctcgccgcc ctcatgtggg cgctggccag catcttcgct ctgcgcggcc     56640
     tgactctgcg gcccatcgtc cacaaccacc cgccgcagtt catgccgcag ttcaacccca     56700
     cgctgcacct ccacgccacc ctccccgccc cggccccggc gggcgacgac ttcgacgacg     56760
     aagacgacaa cgtccacccg ctccagcgct gactcacaac gccgctcgcg cccaccctcc     56820
     tgctggcgcc gcgaccgacc agggtgcggc gcccggaccc gaacggaatc ccatgacgct     56880
     gcagacgaac gagttctggg tcggcaccta ccacggccgc cacgacggcc gcctcgtcaa     56940
     ggtcaccgcc acccgcgacg acacccgcct cgagccctac gcctggacgt gcacctgcgg     57000
     ggcctcccag accttcccca ccgaggacgg cgtggaccgc accgcctggc ggcacacgca     57060
     cccgaccctc tgggaccggc tgcgccagaa ggccgccctg ctgttgcgga cccgctgaga     57120
     cctgacgccc tgcctggccc tcgcccgcac cgggcgagga ccggacaggc cgcccggccg     57180
     ccgtctcccg cgccccgctg acgaaccgac gtcggcgggg cgcggtgttg cccacccgac     57240
     ccgctggagg agatcactcg tgctcatccc ccgcccgcgc cgccgcatcg gccggccccg     57300
     cccgcagcgc cccggccccc gctacccgca ccgtcccgac cggctgcctg gcgcctggag     57360
     caggtgatga cgcgcgcccg gaagaagcgc cgccctcgcg aggtgaagcg ggtgccgcgc     57420
     agcgacgcgc tcctgccgga gcatgaccgc ggcgcagtac cggagggctt ggtcaccagg     57480
     cggcagctga gggacatggg cctcagcccg ggaggcaacg acggtccggt cgcgatcctg     57540
     cgatgcaagt ggtgctccta ccggccgcag tggtcatgca tccaccccac ccgcggcttc     57600
     ctgctccgcg tcgacctggc tgtacccaag cgcgttccga cgcttgctca ggaatgggcc     57660
     cttgatcggg ctatggcagc tcggcagacc tgtagcgaat gcaggaggcg tttttacatc     57720
     tgcctctcca agaagctcgg gtgctgcctg gagtgcttcg acggcacgcc cgctgacccc     57780
     agcagcctca tgacggcccc ggcctccgcc gctcaccggc tggccgcgtg agccgaaccc     57840
     cgtcccggcc acacaggccg ggacggggcc cgtacaaccc gggcggccgc agcaccggca     57900
     aaggccggcc gcccgctccc tcacctcttc gagatcagga gaaacccagc atgacgcatc     57960
     gctccgcccc cttcgccgcc gtcctcggat tgggacgcgc cgggtcgaac atcggtgatc     58020
     attttgtgca gtccgactac tgcgcccggg tcaagggcgc caccgacgcc aagccggtcc     58080
     acttcgccgc caccccggac gacgaaccca ccgtccacgg cacggccgac ggcatcaagg     58140
     catgcgcctg gcactgcctg acctacaccg ccacccaggc cctcgcggtc ggtgtcggcg     58200
     cccgggtcct gggcatccgg ctgcaccccg gagccgccgc ggccgcgctc gccctgtcct     58260
     tcgccacgca ttacgccgcg gaccgcaggg tgcccggcgg gctcttggag acgctcgcca     58320
     cgaagaccgg caagggcaac ttctggcgcc tggccgacca cggaatcaac ggcgcgtact     58380
     gcctcgacag cgcatggcat cacggctggg agacgatcgc cgccctcatc gccgccacca     58440
     aggcgacgac ccggtgaccg cccgctcccg cacccgtttg gagcgggtgc gcggctcgct     58500
     cggcatcgcc cagctcgccc tccagcagat cgaggacgac ctgaaagccg acgacgtcga     58560
     cgcccgcgag ctcgccgcga tcctgcgcga gatccaggag gacatcgaca tgcccggcgg     58620
     cctcttcccc gccctcgcgc agctggtcag caccgccgca cgcagggcgg agcagatcga     58680
     gcccgaccgc gacggcgacg cctcctgcta cctgcacgag gccgccgccc tgatcaccga     58740
     caacgccggg cagcgcctga actgggcggc ccgctccctc cacccgcaag gagacgacgc     58800
     atgacggtgc tgtacccgga cctgcccgag aacgggctca tcgtgctgat cggtgcctcc     58860
     ggcgcgggca agtccacgct cgcccgcacc cggccggcct cccaggtcct ctcgctcgat     58920
     cgtctgcggg gcgtggtcgg tgacgaccct gggcggcagg acgcgaccgg tgacgcggcc     58980
     gacgtcctca agctgatcct ggagcgccgg atggcccggg gactcaacac ggtgatcgac     59040
     gcgaccaatt gcgagcagcc catcagggtg gagctggtga cggccgccaa gcggcacggc     59100
     atgccgacgg tcgcggtcat cgtccccacg ccgctgtcgg tgtgcctgga acggcagcac     59160
     ccgcgcccgg ccaaccggcg cgtgccccag gacgtcgtcc gcgcccagca caaggcgatg     59220
     acgtactcgc accagcagct ggccgccgaa ggcttcaaca ccatcgtctt cgccgacaac     59280
     ctgtaccgcc tggagccgct gctgaagcgg ctttccgagc gccgtgaggc cgacctcggg     59340
     cgggacggcg gcaaaggact gggtgacctt ctcctggtcc gccggttctt cggcccggcg     59400
     atcctgccgc tgtggcggtg gcggcccggc tcggacctgg tgaccggccg ggaccgcgtc     59460
     gcggagatcc gcctcgggca gcagtacctc acccttgcct accgcgccga cgtcgacagc     59520
     gagggggact tcggcttcga cgttctgctg ccgtgccccg tcgacccgga gtgcgccggg     59580
     caggcgtggg cgccggtcta ctcggtcacc gacctgcaca aggcgctgac cggcgccatg     59640
     gacagcgatc cggatctcgt ctgcaccgtc cacggcgacg gcgccgacga cgaccaggac     59700
     gacgaccccg agggccgcgc ggaccttcag gcgcagttcg cggacgcggt cgcttgagcc     59760
     gcgccgccga cggaccgcac ccccacccgc tcaccccggc tgaccttccg accggggatg     59820
     agtggtggcg cggctgcccg gagtgccacc tgccgatcca gggcgggggc gccggcctcg     59880
     ccgcgcaccg ccgcaccgtc ggtgatcccc ggcgcccgat cacgatccat ctggagttct     59940
     gacccgccct caccggcgtg acggacgctc cgcgccgccc cggccccgtt cgacggaggc     60000
     cggggcggtc gcggtggtcc ctcaacaccg aggcaccaac accgagcaga gaaaggagct     60060
     ggacgtcatg cacctgcgca cctacgaggt ggacgtcccg atccacgaca ccaccgaccc     60120
     ggaccggcgc ggtctgcacg tctttaccgg cgtcgccgac tccccggccg cggccctgcg     60180
     gcgcgcgcac gaggtgtatg acgccgcgct cgccgcgcac acggccggac tcgaggtccc     60240
     cggcaagcag ccggacaact ggggagcgcg cgggctccgg cccggctggc agatggagtg     60300
     gcccgccgcg aaggccggcc tctggcacaa ccccgtcagc tggaccaccc gcagcgactt     60360
     cgcgctgtag ctccgccccg ggacagccgc tgtgcttggc ggctagacgg ctgtcccggg     60420
     cccatccatc ccgtacgaga cgagacggag aacccaagta tgtcgtccct cctgcgcatt     60480
     cacggccgga tcggccagcg caccctctta ctgacgaccg agtgggggcg agccgcatga     60540
     gcctcgctac cctgcccgag ggcgactgga tccgcggcat cacgatccgc cagccctggg     60600
     caacctgcat cctcgccgga aagagcccgg agaacaggcc cgccaactgg ccgtggcgtg     60660
     gctgggtgat gatccacgcc gggaagaaga agccggagcc cgccgtgctg cgcgacccgc     60720
     tggtcgccac cgcgatccgt ggccgcgaac tgcacctggg cgcggtcatc ggcgtcgccc     60780
     gcctcaccga ctgccacgtg gacctggggc ccgagcggtg caccagcccg tgggcggagc     60840
     gcgatgctca ccacctggtc ctcgccgacg tccaggagct cgccctgccc gtgcccgcca     60900
     cgggcgcgct tcccgcctgg aagccgcagc tggatctggt ggagcaggtg ttccagcagc     60960
     tgcccgactt ccggctgtga cgggccgacg cagcaagaag ccgctgttcg agccgggtct     61020
     gatcccggtt cccggcgccc ttctcgactg gcgcgacaac cagcatttcg accgctggca     61080
     ggaccgcccc tgcgcgctgt gcgacaagcc cacgcccatg cgctcgcact acggcgagcc     61140
     cgtgcacaag gcctgcgctg aggactggat cgccgcgaac cccaccgagg cccgcctcgg     61200
     acggttcgcc tccgacgtcc agcccaagaa gcgccagcgc gacgacgacc acgcctgaat     61260
     tcctccacct ggaggctccc ttgagcagca cccaacgcga ggtagaccac gcccttgcct     61320
     accccgagcc gcccgcgtcc ccgctctggc accgccacgg cgcgaaggcc cgcccgctca     61380
     ccgacgccca gaagcagcgc aaccgcgagc tgctggacct cgcgcagcgc aagccccgca     61440
     ccaccgccgc gtaggaggac cccggtcatg ttcaccgaca tgaaagaggc cctcgaagcc     61500
     gaggccctcg aactcacccc acttggcagc gaccagagca acgccgcctc cctggtggtc     61560
     gcccaccagg cccgcgacaa ggacgacctc gccgacctgc tgggcgccct cggactgccc     61620
     tgcgccgaag acgacctggt gcgcctgctt ccgcacctca ccaaccccaa cgacgacatc     61680
     ccgaccggag acccgatgac cgccaacgct ttcaccgcca cggccgcctc catgctcacg     61740
     aacggcgaca gccccgagca cgtacgcagc acgctcggac tgtcggagag cgaactcgcc     61800
     gaagctgtga agcacgccga actgcccgtc cccactgcca cccccgtccc ggagacggac     61860
     gacagtgcca gcgccccggc cgaagccgtg aagcacgccg aacccaccgc cgccccggac     61920
     acggacgcca gcgccagcgc cagcgccccg gaggctgtcc cggcgccagt gtctgacgac     61980
     acggtggaca ccgacgggat cgaggccctg ctctcctggg cggagagcca ccccgccgcc     62040
     agcatccgca accgggccgc ccgcgtgcgc agcgacctca ccgagctgac cgagcgccgc     62100
     gccaccgacg ccgcccaacg ggaggcagag gaacgcgtcg ccaacgccaa ggccgaactg     62160
     gaagccgcac aggcgcagct gcgcgcggtg aaggccggcg gtcacaccgc gacggcggta     62220
     caggacgcca cacccctggc tcccgctccc gccccggccc cggccgcgac cgcgaccggc     62280
     caacgcagca aggaagagct ggccgcgatc cggacgtggg cgcgcgccaa cggccaccag     62340
     gtcgccgaca agggcaaccc cgccaagaag gtcctggatg cgtacgacgc cgcccaccgc     62400
     accgccaacc tggcggaggc ttcccaatga tgttgtcaag cagcgcggtt tcagcgctga     62460
     atggtgacaa ccatctgcgg cagcactctg ccgacgatgg aacccgaggg cacgtttcct     62520
     atgcgaactg cgcccatggc gcggtagaaa ggctcggcgt tcgggtccgc atcgatcgtg     62580
     agctgggtga accccaggtc tcgtccagca gcgatggtgc gttcgaacag caggcggccg     62640
     atcccttggc cgatggcctg cggctcgacg aacatcatgc ccagaacgcc agtgggtggc     62700
     tctccctcaa gagtcgtgaa gcccaggatg tggccatctc tgtcagccac cgtggtccgt     62760
     cggcgtgcga cctcgtgcgc ggcaacggtg agctcgtctc gacaggcttc caggaagtca     62820
     gcgtcatagc cccaatgcgc tttggatcgc agcgccaagt cggtgagtac gtcggcttcc     62880
     gtcgcccgtg cagacctgat cagcacgtcc atctacgtcc cccgctcagg tgtaggtctt     62940
     tcgatcttcg caccctgcag tcgtgcggga acagtgcgcg atggcctctg cctggacagg     63000
     gcaagcgttc agcaggccgt tgctggaggt tcgacctggt agcaccgtcg gtcgcggatg     63060
     agtgcccaca ggacgttgac gcgtcgccgg gccagcgcca ggacggcctg gatgtggctc     63120
     tttccttcgg ctctcttgcg gtcgtagaac cgcttggagt tgggatcgct ccaggagctg     63180
     accagcgcgg atgtgtagaa gacgtgctgc aggcgccggt ggtaacgctg tgggcggcgc     63240
     agattcccgc tggtctttcc ggagtcgtgc ggggcgggag cgacaccgcc gaaggccgcg     63300
     agccggtcgg cggtggggaa gccgtccagg ctgccgccga cagcaaccag gaactcggca     63360
     ccgagcttgg gtcccatgcc cggcatgctg aggactatgt cggccagttc gtgttcacga     63420
     aaccggcctt cgatgagctt ttcggtcccg gtgatcttct cgttgagggc catcacctcc     63480
     tttgccaggg tgtggaccat ctgcgcgatg accttctcgc cggcgacggc ggtgtgctga     63540
     cgctcggcgg cctccacggc tgctttggcc aagttctcgg ccccacgaac cttgcggttg     63600
     cgcagccagg tcgtcagccg gttgaggccg atccggcgca gagcggtcgg agtctgatag     63660
     ccggtgagga ggaccagcgg tccggcgttg gtgagttcca cagcccgttc caaagcgggg     63720
     aacatgctgg tcagcaccga gcggagccgg ttgatggtac gggtccgttc ggcgaccagg     63780
     tcgatgcggc ggctggtcag aagcgccagc tcgatcgtgt cctcgtcgcc ggggcggatg     63840
     ggccgcaggt ctcggcgcat acgcgcctgg tcagcaatga tcctggcgtc gcgggcgtcg     63900
     gtcttgccct cgccgcggta ggcgtcggat gcgcggttca ccatgcggcc ggggatgtac     63960
     agcagctcct gcatgtggtt gatcagtacc gcgatcagca gcccgggttc gccgcccgtc     64020
     atgtccaatg cccaggtcac ctcgcggccg tccgcggtat cgaggacgtc gccgagcagc     64080
     tggaggagct ccggctcgtc gttggccacg cggcgagaca acagtgtctt gccgtcagca     64140
     tccatggcga cgcagtggtg gtgcgtcttg ccgcagtcga tcccggccca tatccggctc     64200
     atcgtgctcc cgaagtcgtt cctgccttgc gtaccacgga cgacctcgcc ggcattgctc     64260
     tacacagcga ccatctcgca cttcccaatc ggcggccgag tcgtcgtggg gagcgggacg     64320
     gccaagcctc cggagccaca gacggcagcg cagctgagag ccacacccca ctcccctggg     64380
     tgccacaacc ctacgaatgg ctggggccaa cccgtgatca gaaaggtaga gcgagctgat     64440
     ggacgccatc cccttcgcac tggacggcta cctggccgcc gaccccgaac ccggtgacgg     64500
     ggaggacacc gcctcctggc ggctgaactg ctccgccggc accgaccacc tgatggaaga     64560
     agcggtcatc ccctgcacca ccacgcagcc ggagatcgcg cacaccctgc tcaccgagcg     64620
     gcagcccggc gacctgctcc gggtcagcgg ccacctcacg ctcccggaca ccgccgacgg     64680
     agtcatccag ctgcacgccg acaccctcga agtcctctgg gcagcaccgg tactggatgg     64740
     ggacggggac gacgcagaca ccgcgaccac gacagacacg gacgcggacc gcaacagcgc     64800
     catcgcggct ctcgccgacg ctctcaccag cctcggacag gccgcacccg gctccgggca     64860
     gagcatccgc atccacatca gcccgaccgg gaccctcggt tcgggcctgg agcactgtca     64920
     ccacttcgac ctccccccgg ccctggccca ccggctcgcc gactacatcg acgccatgaa     64980
     ctgctccctg gacagccaac accccgacgg cgtcgtcctg gacccggaga ccatcgcgga     65040
     cctgaccgac ctgttcgagg acatcgacct gatcggcctc accaacacgg tcctcaacgc     65100
     gacccggccc gagtaccggc ccgccgtcac acaagcgatg gacgacatgt tcggcgacat     65160
     ccccgccccc gaggacaccg acccgtgacc gccagccaca cccgaaggga agcacccctg     65220
     atgcccccac agccccagcg cagcgtcctg gagcggttcc ccgccggagg cccccgcggc     65280
     tcgtggccgg cggaggagta cgccgccgcc cagcgtgccc agggcacgga cgctcaggtc     65340
     gtgatggacc tgcgcagtga ccagttcctc gtagttaccg gcaccgtccc gcagtagcac     65400
     caccccggag cgccgcgccc gaccttcccg gccgggcgcg gcgctccgcc gttccctcac     65460
     caccgagcag aagggcaccc cttcgtgcgt ctgatccgcc tgatctcctt cggctatctg     65520
     cacctgccca ccggcccgga cggctccccc gtcccgcctg ccgccgaccg tatcgaggac     65580
     gtccgcgacc ggctccgcga ccccgccgcc gcccgcgaca tcctcgacct ggacggcctc     65640
     aacccccgtg tccaggacgt cgtcctgaac acccccggcg cccgcgaact catcgccaac     65700
     ctcgccgatt acgccgacct gcccgccggt ccgagccgca tcgcgatcgg ctgtgcagga     65760
     ggcaggcaca gggccagcgg cctcaccgaa atccttgccc gcacactccg cgaccggggc     65820
     cgcgaggtcg aagtcgagca cctccatgtc cacttgccgc gcgtgctcaa gacccccgcc     65880
     cacggcaccg cccaccccag ctccacgcag gaggccaccc gatgaagcgt cccttccccc     65940
     gctgcggcca cacgcccggc gccctcagcc ccgaggacca ggccgccgtc aaccagttcc     66000
     gcgcgctgct cgccgcactg cgcgacatgg agccctggac ccccggcctc taccgggaca     66060
     tcgccgtacg cgtcggaccg ttcgtggaaa gggcccaccc ccgcccgggc gacgaccacg     66120
     atcccgacct gatcgccgtc tccctggtcc accccgacac cccgcacgcc gcggcctacc     66180
     tccacggcca ccagctctac accggtaggg gctggctgcg ctgcgagacg gacaagatcc     66240
     tcggagtgtg gcacccggcc ctcacaccgc tcacccacgc cgcggcgggc ctggacctcc     66300
     ccgacgacgt cggcatgagc ctggcgcact acgccgtcca tgtcgaagcc cgccggaagg     66360
     acaactccgg ccgcatcatg ctccgcatgg gcccgtacac ccagacctgg ctcgcctccc     66420
     gtgacgcgga ccgcctcaac accctgctgg agggcaaggc ggccaccgtc gtccccgggt     66480
     tcacggttac cgcgaaggcg gcgccgttcg atgtcagcga ccacgagagc tacgacgacc     66540
     cgtaggcgac cgaggccgcc gcgctcctgg cggccgccat cgctgccgca cgggcggcgg     66600
     ccgccaccgt ccccaacccc ggccccgggg agctgcccgc aacatgggca ccctgatctt     66660
     ccctccacac acgaagccct gttcccggcc gcacgctggg aacagggctt tttgtgtttt     66720
     ttaggagctt ccggcgggtg tgcgaggcgg cagcctcgtc agtcagcgtt ggcggcccgc     66780
     ttttctcgat cgcggagcag catgtcgcat accttgtcgc gttcctctgg cggcattttg     66840
     aacaggatca gggttcctgc ttcaaagccg tcgtggtacg ggaacttctt cactgccgat     66900
     tggtcctgct ggccatcacg gccttcagcg cctcgcggct caggaatcga ctccttgggc     66960
     ggatcttgcc cgtcggcagc aggcagcagt tgttccagca caccggccgt tacctcgctg     67020
     tgatttttca cggcgtgaaa atcagcgggc tcgggcgcag gctgctgtcg actccgcgcc     67080
     cggcgcttcg aggcctcagc ccgttcatcg gccttagctt tctgggcttc cggggagagc     67140
     ttggacaaat tccggacgtg ctcggtcttg cgctctcccg tcatcaggtc tttctgcagc     67200
     tcgggagaca gcttgagcag ggacagcttg ctcgaaagcg tggaggcgga catggacagg     67260
     cgcctgcacg ccttggtctg cgagcctccg tagtagtcca ccagttgctt gagggcgtga     67320
     gcttcctcaa ggtccgtcat gtcctcgcgg tggtagttcg cgatgaacgc ggactccaag     67380
     agcttttcgt cgctgctcag ccgggcgtca tccactcgca cgggaatggt cgccagtccg     67440
     acctgccggg ctgcctcgag acgccggtga ccgtctatga ccacatactg cgcgccggga     67500
     tcgagatcgt tggcgcgatc gggccggctg cgaacgtatg cgtcgacagt accgaccacg     67560
     atcggcagga tgacgccgac ctcacgcacc gactcaacgg tgtactcgag gttccggaga     67620
     tggttgcggg ggttgtcggg gttgtcgctg atggcaggga cgggcagatc ggtcaaatcc     67680
     gcagtgccga caccgccgtt gatcgtctcg ttgatcgcgt ttctgcgtgc gctgcggttg     67740
     gaggtgctgc cgaacgagga cccacgcccc aactggtcct tcttgctcac ttgccgaccc     67800
     ctgccacgat cagtcgcatg atgttcgcct gcttgctctc cgggacgtac gccagcagag     67860
     gccgcttgag ccgcacggac tcgcgctgct ccttgaggtc gtcgatcaca gcgatgaccc     67920
     tgtcgttctc catgttgtgc cactcctcca aagaggacgt ggcgatgtag ccgcggcgac     67980
     tatcgaactg gttcaccacg atgcccagcc ggtcgatctc gagatgtagg tccgtctcga     68040
     ggtcttcgat ctgctcgatg agcatctcgt aggcgtcggc tgaactgtcc tcggactgca     68100
     cggggacgag cactccagac cgaccaggct tctcgttcgg acgcctgcgc ccgtagtaga     68160
     ggccggcgtc catgctcagt cccaggcttg gcggggagtc gacgacgatg acgtcgaagt     68220
     cggcctcaag tgagtgcagc gcccgctcaa gcgccatctc cttctggaaa ccgcgggact     68280
     gggcggccgt gagtgccagc ttggagtcca gcaggaatgc ctcgcgcgtg cccggcagga     68340
     cgtatagccg gcccccgaaa cgcggatcgt cgattgctac gagcaggtcc ttgatgtcgc     68400
     cctgagcgtc accggacatg tgggtgacca ggctgtcttc acccacggcg atgggcggga     68460
     tacccagctg gttgctgagg tggagctgcg ggtcgtagtc gacgaggaga accctctgcc     68520
     cacccgcggt gtagtcggcg atcagggcga ggagctgctc acgggtgcgg ttgagccgct     68580
     caagctcggt gtcggtcaga gtctgcacga agttctgcag gcacttgacg ccgatcccct     68640
     gaggctcggc gtgagcttcg gcgattcccg cagagatggt ggtcttgccg acgccgccct     68700
     tctggttgca gacgatgatc cgacgcggcg gggcgggcag accagcctgc ttgggggaag     68760
     ggttgtcgtc cagccaggac cggatgctct gcgcaagccc ctggatgtaa gagaggccgc     68820
     gttcagtaca actggccttg aagtcgtcgt acatgcctgt aggcagccag gtggagaacg     68880
     acctcgcacc cgacgtgtcg acgtctgcgc ctgaccagtc gctggcacgc cagttggtga     68940
     tggccgtggt cgcggcatcc tggatgtcca ggccgaattc ggcgcaacgg atcttcagtt     69000
     cttgctggag cgcgggcgga agcttggacg ccaccttttc ccggtctccg tcagggtatg     69060
     gagaagccat ggcgtcacct tactgaccct tgattccggc gcggtgtccg gtgtgcaagt     69120
     tcttgacccg cttcacccgt tcgacgaccc gccgattttc acgccgtgaa aagtcacgga     69180
     aaggtaacgc tgcggtctgt ggtgacgctc ccacgatcga gtgacaccag ggcgatccgc     69240
     tcagcgagtt ggctacgctg ctcctcaaac ggcagcggca aggccgtgct cccttgaacg     69300
     ccatcggccc accggcgttc atctacgggc tgcgaaggag ctcagcttca caccgcaacc     69360
     acgcgcacca tcaacccggc tgacggcccg atcgccgtac cggagggccg actggtacgg     69420
     agaatcagga cctctcatgc gtagtgagcg gatcagccga ctcgccgccc gtcgccagca     69480
     gtacacgaac gagacctacc agcaggcccg caacctgctg cgccccgggc gaccgcctat     69540
     cccggatgcg gactgcgaca agcagcggaa cttcgaggcc gacctcttcc accagctcat     69600
     cgagtcgaac agggacttca ccgcctatcc cttcggaatc cggcgcgtca gtccgaagcc     69660
     cgacacgatc gagctggtcg tcgagagtga gcagcgcgcc agacggctgc tgtcgtggct     69720
     gctgccttgc tatgagcctg gcggtgaggt ccacggcgtc ctgggtcttc ggatccggca     69780
     gcgcacagtc aggggcgtgg agctgcacct tgctggccaa cgcacctccg tatggctaac     69840
     cggcccgcac cgcgacgtat ggaagagcgc ggagaacgag agcctcgaac atgtcgcgga     69900
     cctcggatgg aaggccctgt ggcgcggacc ggagcactgg tcggcggaag aggtcgcctt     69960
     cgagcatgag tggaacacgg gggagtggac acggcagttc cgggcgggcg cgtggagcgc     70020
     cagcgggctg ctgcgtcgtc tcgggctctt ccgcaccctc accgcggcag acgctgtcac     70080
     cggctacaaa gggttgggca tcaacggcta cgacggcagc ggcccggtgc gctggtgcct     70140
     ggacatcatc caccgatccg gcatccggca ccgcaagcag cacctgatcg aagcgatcac     70200
     ggacccggag ttcgggctgc ctgtctcccg agccgatcac ctggatgcga tctatccacc     70260
     agagacgatg gagaactgga tccgcctgga tgatgaggcc cggacaggcc tcatcgaact     70320
     ccgcttcacc acctgtgact acgagcaact gcagctgagc acctgcggtc ccgagtacca     70380
     ggcgatcgcc gaagcagtcg agcggcgaat cagcaccgcg acccagcgcc tcggccctgg     70440
     atgagttcct cgggaaaaac gaagaccgtc cgaggcttcc cacgggcagc gccggacggt     70500
     cacccctctt cgacccgcag tgccagcacg gcggtgccga cctgaacttc ccatccccga     70560
     cgcacacgga cggcatgggc gccggcgata ccggcctgcg gatcggtcag cgccatggcg     70620
     acgtcctcgg cgaaggggaa gctgccccac gtcagttccc accagtcacc gcgaccccaa     70680
     agacgcctgc ccacgcggcc tccccacgca ctggtgcgat ccagaggatc catgaaccag     70740
     ttccccagcg cccattgccg ctggggatca cgcagtccga tccgtgtcac caggcctgac     70800
     agaagaacca gcgtgtcatc tgtcataggc ggcacgtccg ccagtgcatc gtgctcctcc     70860
     ccggtcaggc cctggtccac ggtccacacc cggtgctcgt cgaagccacc gtcgaaggga     70920
     ggaaccgggg gacgatcggt gacggtcatt cgtgcgccgg tgaccagatg ccgaagctgg     70980
     aaggcgtcag cccttgcttc ctccagacgc aggccgggca gacccaccgg cttgccacga     71040
     ggcaccaagt acgtgagcac attggacggc gtgggcgtga tgaccaccaa gtcgtcgggc     71100
     ctgggggaga gaatcaggtc gtagtgggtc accgacgcca tagcccacat gcccggccac     71160
     tcctgcagag ggcctccgtt gaagatgccc aaagccagca atgcccgaag ccgttgctgg     71220
     gccaagtcgg aggtgtcgaa gcccaggtgg ccgcaaccgc ggggaacacc tcgtgcagcc     71280
     gcctgcctat gttcaccgga gaaagcgcga cgagtcgcag aagcggaacg acgaccggag     71340
     tgggccatgc cagagtcctt gcagccgccc ggccggcaga cagagacacg gatcgacgat     71400
     cactccgagt gggaagcgac gtgggcgccc cacaccctct ccgcagatcg gtgacagccg     71460
     ggcatcacag atatgcatgc cgagtcgtcg caaccggcag gaaaccccac catacccatc     71520
     aaccggcaca accaggtgtc aactgggtcc ataggcagcc gaccagagcc ccatcgttgg     71580
     gctgacagca cgccacatca gccatacggg tctactccgg aggcaaagca gcgcgccaca     71640
     ccgacgcctc ccgtccgctg cggcaggctg ctgcgcggcc ttccaggtag gccatcgttc     71700
     gcagggccac cgcccgaccc ggtgccacaa caacctctgc gagcgagaag gagcaaggcc     71760
     ccaccccgag aacaccagcg cctgccagac ccggctccgt ccatctgcgc gccggggtcg     71820
     gacggtgcgc ggatcaggat gacaatgagc cacggaaacg cgctcacaca gaaagcccgc     71880
     taccgctccc gctgcaccgg catcggccat caagcctgca cgcagcagca caccacagcg     71940
     gagggccagc accccgtgcc cgactcaggc cccgaccagg cccggctgga agcccaggtc     72000
     ttcgagcatc tgggcggcac gatcgactac tgcgcacacc ccgccggcat cgcccacgtg     72060
     atcccgaccg gcacgcacct caccgtggca ctggacccca aactcggccc caaccaccgg     72120
     ctttctcagc actgccttga agcgctgctt cccaccatct acaccggcac cgacgaggac     72180
     ccagaggggc ccggcagcgc cgtgggagtc cggctgcggg gaatcgacgc cgacggactc     72240
     cacctcggtc tcgccgacac caatgcccgt gtcacgctgg cggggccgtc acaggcagag     72300
     tggaccactg cccttgccaa ccaccgtgcc agatgccgcg agagtcacct cattcccctg     72360
     tgggacacgc ctggactgtc cgagcccgaa cgccgctatc tggacggcga cccggcctgg     72420
     tggaaggaac aggccgacac ggcgtggcta gccagcggcc tgctgcgcag gatcgccctg     72480
     ttccacacgg tgaccaagcc ctactgcgtg cgctactggc ggcacgggct gggctggagg     72540
     ttcgaactgc gttacgagca cggcctcact gtggaacaca acacccttat cgcgtcgttg     72600
     acccatccga aatgggggat gccgttgcag gtcaagcgcg accactgctc gtgcaagccc     72660
     tgcgcctgcg acgggggagc cgaacggaac tgctggttca ctctcgagat gccagacggc     72720
     caaggggaag ttgggatgca cttccgccgg gcgcgggccg acttcgacgc atcggggacg     72780
     tacgaacgcc tggtcacagc gggagccaac gccaggtggc ttgagcaggt tctgcccgcg     72840
     caccacagcc gtctgagcct ccgaacacgc ctcaccacag gcgagttggt atagccagcg     72900
     agcacttcaa gcgctcgcgt tcgaaggggt cgaacgatca gattccaatt ggaacactgc     72960
     catggtgggt agggcacgtg tggtcgtggc gcagcattcg cacggcgtcg tcaggcgtcg     73020
     tcgccgggca gtagcggcat cgcctccttc catcgctcgg gatagacccg gtggcagccg     73080
     cggggcacca gcggtccttg acgtcctctc gctgggggta gggcgactgg gcgctgagga     73140
     ccaggtacac caactccgta gtgggcgtgt ggcagagggc gcaggcgatt gcgtctcgtg     73200
     tgatctccac gggcgggaga gtgcacacgt cgacggcttg ccgtctcagg ctgtcgcggc     73260
     agcccgcctg gcgggcacca cggtaaagac ttcgtgatgg cctcccgccc ggcgggaagg     73320
     accccggatc gcgctttttc gcaggtcaac gccggagttt catggggcga tgatcagcat     73380
     gtcggaggtt cgcccgggga acgggtggcg ctatctcttc cgcggcgtga tggtcggcga     73440
     cggccaccgc cctgcgggca agtcactgcg cgccgcccag gacgaagccg gtgtcccacc     73500
     cggcgtctgg aagggccggg gactggccgc ggtcggtctc aaggccgggg acgtggtgac     73560
     cgagcggcag gccgaactgc tcctggggga aggtcggcac ccggacgccg accggatcga     73620
     gcgcgagcgc ctggcggagg gcaagagccc ggcgcaggcc cggcgggcga ccgtgctggg     73680
     cagacccatc gagcacaacc agtcacccaa gaccgacaag gccaaggagc ggacaccctg     73740
     gctgggcttc gacctggtgt tccggccccc gccgacggca cacatcgcgt gggcgctggg     73800
     tgactacgag acccgcctgg tgctggagct gtgccaggac atcgcccgcg acaagacgct     73860
     ggcgtggctg ggggaggagg ttgcggagat ccgctggaaa ggcggcggca agcaccgcgc     73920
     ccgggtcagg gacgggctga tcgtcgcggt gttccggcac tacgagtcga gagctgccga     73980
     gtcgaagccc cttctccacg atcatgcggt ggtgtcgatc cgggcccggc ggccggacga     74040
     caaggggacg tggggcaacc tgtcggcgga ctcgctgatg gcccacatcg tcgcggccga     74100
     caccctctac accctgtact tcatggagga ggtgtccgcc cggctcgggt gggcgtggga     74160
     gccgcgcgag gtgacgcccg gccgcaggcc cgtcatggag ctggcgggca tcgaccagcg     74220
     gctcatcggc tggcagtcga cccgccgtca gcagatcgag gacgcgctgt ccgtcctcac     74280
     cgccaactac gagaagaagc aggggcaccc gccgggggag cgggccggct acgcgctggg     74340
     ctgccaggcc gccgaccaga cgcgctcgcc caagcgcacg gagctgctgt cgctgaccga     74400
     gctgcgcgag cgatggcgtg actcagcgat ccgggcctac ggcgttgacg tcttcgaccg     74460
     gctggcggag cgggcgcggg cagcggccgc ggcggtgtgg gcgcgggtgc ggccggtggt     74520
     cgacatagcg ctggccgccg tcgacgtcgt cgccgtggtg tacgtgatgc gcggcgcgtt     74580
     caagcgccac cacctgctcg ccgaagcacg ccgccacctc tcctatgtcc tgcgcggccg     74640
     accccaccgg cccggcctgg acgaacagat cgtgcaagcg gtcgtcgacg actacacccg     74700
     ccccgtcggc cggggccgga tgatgaccgc cgacctgcgc gccctgtacc cgcgtgacac     74760
     cgaggaccag gccgtgctgc gcccgctgac ccgcaagcgg tccgcgcccc cgtacgagcg     74820
     ggcccgtctc gccgctggcg ccctggccgc ccgggtcaac gcagcgcgac gcgcggagcg     74880
     cctgggctcc cgcccccgtc cgtacgccgt cgcggtgccc gcggcctcga ggtcgcatcc     74940
     gcggccgttc cgcaccggcc cgaaggcggg ccgcctcctg gagccggaga ccggcgtcga     75000
     cgcggtggag cagacccgcc agaccctcga agcagccgcc gcgaaggtgg ccgccacgat     75060
     ccaggacagc aggcgggcgc gcgaggccgc ccacggcctg cgatcgcagc cggccccggc     75120
     ggcggtcccg ccgccgcaca cccagcagcc cggcgtacag cacacgccgg gccggagttc     75180
     aggaggagtc gcgtgagcac cccggaagaa cagcccaacg ccgaagaggc cctcgcccgc     75240
     gcccgtgccg cccgcgcgga gatagccgcc gcgctcgatg aggaccagga gcccgaggcc     75300
     gatgagcccg tggggtggca gccagtctgg aagcggcccc ggacgccgaa gtcgaaggcg     75360
     gacaagaaga aggagctgcg caagcagcgc cggcggctcc aagacgccgc caagcgccgc     75420
     ctcgccgcgg ggaactcgcg ccggccccgc tcccagcaga gccgaatcgg caacgcggcc     75480
     gcacgccggg atacccgcgc cctgtcccgg gtgcggcact ccaacgcctg gctgtggtga     75540
     cgatgccgga catcgtccac cgagtggata cgacgatgtt ctgcatccat tggcgatgca     75600
     cgacatcgag tgggctccac tcagtggact ccatccgatg gctgcaccga gtggactcca     75660
     cccgatggac gccaccgagt ggacgccatc gtggtgcgca ccggatgacg atggacctgt     75720
     cctgtctcaa cgaagttagt cgtccatccc cgagctgacc tgcgtggact ggattgggtg     75780
     agacgcgggg acttggttcg ttgagacaaa tctcggctcg ctaacgcagc tgcgcgttcc     75840
     catgcgggtc gcccgcctgc tccaaggcgg cctcgtaggc gtgcagggcg gtgatgactg     75900
     tggcgcgttc cgcggggtcg agaccgtgca tgacgcgttc ccaagcggag gcgctcccag     75960
     aaagccattc gccgatcggg gcggcgtagg cgggggcgat ggcgatgatg cggcggcggc     76020
     ggtcggcggg atcggcagtg cgctgcagga cgcccggccg tgacagctcg ctgaccatga     76080
     ggctgacagt cgtcggggcc acctccagcc gagcggctag ctcgttgatg ctggtggggc     76140
     cgtcgtactc caggtgggcc agcagtgcga ggtgtcgcgg ggccaggtcc agaccctgga     76200
     gcgcccgagg tatgggcagg cgcttggcgc ggcccacgag ccgtggcatg agcaacagca     76260
     gggtgcggac ggcctcattg acggctggac cgtccgattc cgtggacatc agcgacctct     76320
     tccagatacc tttaaaaaca aaggctttgt attcaaaggg aacgaggtcc actttgccgc     76380
     acctgaccgt tcaccttcca gagaacaggc tgaccgggaa cgaacctata ctcgccgccg     76440
     cactgaccga cgctgtcgtc gacgtgtatg gcgaatgggt ccgcgacctc gtaagcgtcc     76500
     gcctgaccgg agtccccgca ggccgtttcg cgcaaggtgg caaggccgtg gacacaaatg     76560
     cttcggtgat cttgggcgtt cgcgctggcg tcttcgaccg ccccgacgcc gcccagatca     76620
     ccgcgcgcct cggcaccgcg ctcaccgacg cgatcacacg tgtcgtcggt gatgacctcc     76680
     gcgccggcac catggtcgaa ctcgtggcgt caccgccaga acgtaccttc gtcggcggcg     76740
     ccctcaccgc gtgacacccc catccgggcc acctcacgac ccggctgtac tcaaactcag     76800
     cagcagtagt aggcaccccc agcgcgctca accgcgcgtc taggttcgct gagacagaag     76860
     cccgaacgac tcggttcgct gagaaaacga ctcggttgag tgagacggga caggacccca     76920
     ctccggtgcg caccacgatg tccgccaccg cacccggtgc gcaccatccg acgatgcccg     76980
     gcacgcacac gcgcacccgg tgcgccgcac ccgacgtccc gcaccgcacc ggtgcgcgca     77040
     ccgccgcccc acttcttgac caggtttcgg cgagcgcacg tccttcctag accacgttcg     77100
     ctacccggac gttttccctt gtcaacgctg gtctggactg acgatcaggt cgaggacaag     77160
     ggggtgtgtg atataggagc ccgccgcgcc gtggcgcgcg cccggcgcgg tgcggtgggg     77220
     ccggtggtgc gcaccgcgat ggatgatgcg gtgcgccggt gcgcgcacca ccgatgccgt     77280
     caccgcacct ggtgcgcgcg gtgcggtgcg tcgtccggcg gtggtgcgca cccgatgcgc     77340
     gccgaaccgc accaccgccg tcccggatgc gcggctacgc ggtggtgtgg tgcgccgggt     77400
     gcgcctccat cgcctgcttc atccccgcgg cctccagctg gcggaggacg tccgcgacgt     77460
     cgccgcggtc ctcggtgagg atgttgtcgg tgaagcggat gatggtgtcg gcgatgcccg     77520
     gcgcattggc caggccgtgg cagaggagct ccagcagcag tcgcccgagt gccgctgcca     77580
     ggaaggagtg cgggcacggc tccccgtcgc agtcgtccgc ggcggtcacc gggatgaaga     77640
     cgcgcgcggc gacgtccagg agcagccggt gcagctccgg gcccgtgccg tcggcgaccg     77700
     cgcaggcggt gtcgatgtcg tcggcctgca acgcccggat gtaggcgaag gcgtcggcga     77760
     cgtcctccgg ctccatcggg gcgagcggcg cggtgacggt gttctcgggc atgacagctc     77820
     ctcatatacg ggccgccccg ctgatcgcgg cggcctcgga accgatgctc ggatcgcggc     77880
     cctgtggaca gagtccgcgc actgacggtg agcgcacccg ccgggccacc gctcgcgtta     77940
     cccccttgtc cagctccgct acgtgcgaca ttccgtccca ttccggcagg aagaagtctc     78000
     cgtcccgcca cgctgcgcga cgtcccgcag aaaagccgct gccacccggg gcgcgccgct     78060
     gggagacttc ggggatgacc acgcagcggc tgccgttccc ggtcccggac gaacgcgccc     78120
     acctcttcgt cgacagctac gccgacatgc acgacctcgt tgaggacctg gtcgtgcccg     78180
     acggtgttcc cgaggccgcg gcgacggtcc tgcgtacggc gcgcgagctg ctgcgccagt     78240
     cgtactactg ctacgagttt tccaccgtgg cggtcatgca ctccctgatc gcggtggaga     78300
     tcgtgctgcg cgaccggatc ccggacgcgg gcaagaagcc gctgcacggg ctcatcaagc     78360
     agggtgcggc cgacgggatc ctgacggccc ggcaggcgga gtacctcgac tatggccgtc     78420
     agatccgcaa cgggatggcg cacggccaga ccacccacgc ggtgatgccg ccggccatgg     78480
     cggtgccgat ggtgacgacg tcgttcgcga tcgtctccga gctctgcgcg acgcccaccg     78540
     gatgatcacg gctcggtaac gtcgctcggt ggagtgtcac accgttgact ttcgccgcac     78600
     ctctagcaag tgacggggat tccatctgga cccccgcgcc acctgcgtga ggagcttcgt     78660
     catgacgtac gccagcagcg cccggcagcc cgatccggag ccgcgcccgg cctggtcaag     78720
     gggtgctgag cggcctccgg gcggcccgga atccagtgcc gtgaacggtg ccgcgaacga     78780
     ttccaacgtc gttcccatca ccgcagctca caccgcccgt cagggtgcct cgcggcacgc     78840
     tgacacctct cctgagacgt cggcgaaagg gaagaagtcc actcccacgg ccgggaaggt     78900
     gcgggccgat gcgctgcgga tgctggggtg tgtgcggata gcgacggttc ggcagatggc     78960
     ttcggtgatc acggcggagg agtcggacgg ccggtcgtac gtgcgcaggg cgatgaagga     79020
     gctggcggag ctggggctgg cggagacgaa cggcaaggcg ggcaagcacc cgatctggaa     79080
     cctgaccccg gccgggcaga aggctctggc cgacggcaac gagctgcctc cccgaccgaa     79140
     ggccggcacc ggagcgaagg cggtgaaggc cgggttcggt ccgcacggcg tcgcggtgac     79200
     ggacacgatc ctcgccttcg gcggccggga ccatctgacc gactggcagg tggaggtcaa     79260
     ccacgccatc aaggagaccg gcctgagctt caacaccgac gctgtcctcg cgtggcctac     79320
     caagaccagc gaggtgcgcc tcttcgagct cgacaacggc agcatgtcgc aggcccggct     79380
     cgcacgtgag gtctgggact acgagcgcta tgccgggcac cgcgtctggg agggcgcccg     79440
     cggcacgatc ggcgggacgt acccgttctg gcaacgccac cgctacaccc gctcaaagac     79500
     cttcccgcgg ctgcatgtcg tcctggcggg caaggcggag cacctgctcg acaaccgcct     79560
     ccaggcgctc gccgccgacg tgaagggcat cgccgtcgcg gtctgggtga acaccctgcc     79620
     ccggctccag cgaggcgagc cctggtacga gatcggcgtc gacgccccgg accggcgccg     79680
     tcggcgctac cccgaacccg ctggccgctg agcgagccgg gcaggccctt ccgcgcgagg     79740
     cggaagggcg gctgtccgcg acgccgcggc cagaacggga agactaacca gcgtgcgccg     79800
     ccgccgcgcc gtggccgcca ggtggccgga cggccaatgc agttgctttt gagctggggc     79860
     ctggtgggac gtggcctccg cccatgacgt ccgggagcct cgtgaatagg atcaagcagg     79920
     tgtgcattgg cttctaagcg tgggactggg gatgagatga ggggcaccat cagggtggcg     79980
     gcagccgcag cgttaactct cgtgatcgtt ggatgctcgt cgaacgctga cgcgaagaag     80040
     gacacgggga tgaacggcgg aggtggtaca gaccccacag cctccgcttt gaaattcgcc     80100
     aagtcatacc aggaagcggt taataaccgt gactggcaac acgtttgcca gatgaggaca     80160
     gagcggtacc gccacggcac ggtcaagcag tgtgtcgccg acaacaaaga gcctgcggcg     80220
     ccaacgcctt cggagtccga gacatctgct ccaccgccac tcgtacgagc tgacggttcg     80280
     actgtcccgc cgaaacagaa gcccacggcc agcggaccgg accgcgccca gcttggtccg     80340
     atcaaggcaa gcggtgcgaa ggccgttccg gccttcggtg atcacccagc tggcacgggc     80400
     gtgatggtcg agtggaccta cacctggccc aacgagtcgg gggtctcgaa ggacgtgctc     80460
     cgtgtggtcc ggcatggcga caagtggctg gtcgaccaga tggaagaggt cgcagactca     80520
     gacgaagcgc acggcgatcc cgtcggggac gccttgatga ggagttgaga ggacgccctg     80580
     ctgcggtcgg gggcacccgc agcggacctt aatattcggc acttcggaag tcacctttcg     80640
     taaggaagtg gcggtggtgg agactcgcga gcccggccgt ccagcgccgc ggtgcttgcg     80700
     tggcttgctg gtctggttgt ggacccaccg gcccggctcg acctcgcttc gggcgctccg     80760
     agttctccag accgtggccg cggcgacaac ctgatcctcg agggccagct ccgggactgg     80820
     tccgaggaac tccgcaggcg ttgacggcaa agggtcggct tgttgccgca gctcgttacc     80880
     ggccgaccgg aaaggcaagt gatcagcccg cccaaccgat gtcacggacc tcgatcgcac     80940
     cggcgtgcgg caggtactgg atccagcaac gccgtccgaa cgcctcccgg atctcctcca     81000
     cggagcccgg gtcacgcaca tcgggccagg ccctcggatc catccgcgcg acctccacga     81060
     gcgccagcac ctcccgccgg gcctggccgt ccggcaaact gcgccatgac ctccaccgcg     81120
     agttcctcca ccaccacgcc ataccgcatc ccgcacaccc ccgtgtgatc gactcgggca     81180
     gcagcgtacg gaggaactgc cgatcacgtt cgggcctgtg gatatcccgg atttcgcggt     81240
     ggtcgccccg gtgtctgggg gagtgtcagt gccgcgggtt accgtcctgc tgtcctgacg     81300
     gactgtttcg gctctcgcct ggcctccaac agcggccagg cgagagccag atgctcgctc     81360
     cccattgttc tcggcacggg agcaggccct tccggatgga aggccgacac caggggtgtc     81420
     ctgcttccat tgacgggggt gggcggcccg attgcaagga aaaccgggaa cttccactct     81480
     gcggcacccc gtactgggcg ctacctgcgc cggaatggtc aggtgtgctc gcccgggtgc     81540
     cgtcccgtga ctgtcattgt tccgtgaatt cgcgatcacg tggcgtagca actccttctg     81600
     tggccatgct gattgacctc cccggcggcg gcctcggcac ccgccttccg gggacccctg     81660
     gcggcttccg gatgggccgc ccgggcatcg gccgaccctg aaggagttcg atgaccaagc     81720
     aggtcctgat catcacggcc acggtgaccg tattcgcctg gagcgtggtg atggtagcga     81780
     tcggccaggt ggccgcgatc gccacactcg ccccggccct cgggctgacg gtgcaccaga     81840
     tcgctctcgc ggcacgacag cagaccgcgc cggcctcagg acaccgcgtc gcggcggtcc     81900
     cggacaagga gggcagcgcc ccgtgaccac gcccttcgag ccacccgcac caccacctct     81960
     gcgcccggca cccgcccggc ccggccgcaa gctcgggccg atcgcggaag aactcagcag     82020
     cgcccaccgt gcctggctgg gaccgatgcg cgagacctac ctgaccagcg ggctcaccct     82080
     gagcgagctc agcgcccggg tgcggctcgc caagtcgaag atctccgaac tgctgcgcgg     82140
     gatcggtctg tatccgcgat gggagatcat cttcagcctg tcccgcgagc tgaacatgcc     82200
     ttactggccc ctgtaccggc tgtggcgaca ggcagcgctg gaggcacaca agagccggga     82260
     gtgggttgag cggtgctcgg aaaaaaccgc tgtgaccatg tcgcatgcgg ctccgccgtt     82320
     ggaccaccgc gccttccgtg agctcgtgga gagcttctac agcctctacg cgcaggtctt     82380
     cctcgaggac gaagagcgtg acaccgcggt gtccgacacc ttcgacatcc tgtggctgtg     82440
     ctggaacgac gcgctcgcca gccccgacac ccgcaagttc gcctggaacg tcctgcgtgc     82500
     cacggtcatg gccaggacgc cgcacgtgga cggccggccc gaactcggat gggcggcgtt     82560
     tgacaccgtc gccctgcagt ccgtgatcgc cgcgtccgac cgcgccgagc agatcgagga     82620
     aacgttggat ctgttcaagg cgatgagccg tctgcccgac caccagctcg acgtcatggt     82680
     gctgcgccgc ttgtgcggga tcacccccga ggacgcctcc ggccttctcg gtgtcccgct     82740
     ggccactgtg cggtccgacg agcgccacgc cgtccatttc ctggagagcg tcatctgccc     82800
     gcccgagacc gaagggaaaa ccgcatgacc cgtcgcatcg aagaaatcct ctccagggcc     82860
     ctgctggtcc gtcaccgcac cgtgccccgc gacatcgtcc ccttctcccc ccgcaaggac     82920
     cgcggcaccc aacccgctgg ggaaccgtcc cacaagcccg gccagcccaa cgcggcggct     82980
     gaagacctgc gggccctgtg cgaaaccctc gtcacccaca cccccgccac cgccgtgacc     83040
     gacttcgtca ccgaccaggt accccaaccc cgcagcgcgc tggtccttgc ctgcgtgctg     83100
     cagctgaccg acaccgatga gggagcacgg ttttggtggc agtatgccgc cggcgccggg     83160
     caggccgccg ccgcgtactg cctctacctc caccacctgg ccctgggaga aagcgacaca     83220
     gccgactggt ggcaccgcca gaccgacgac gtccagccac cccccgggcc gcccgctgaa     83280
     gacactccaa cccccagtcc agaagcagcc cccagcgcct ggcacccggc cgaccaccgg     83340
     attaccaaca cctccaccac cacgatcctg cggatcctgc gccacctggc gaaatacagc     83400
     gcccggcccc gctccgccgc ggtcaccgaa ctcatggcat acgtgcccac cgcagtcgcc     83460
     gtcggctacc tccgccagcc cgaaatggac ctgcccacgc ccggcgctga cttcgcacgc     83520
     cggatcagca ccctgctcgc cacggctgcc gaccggcccg acgtcaccaa caccctcccc     83580
     gcacgaccgg attctcgaga gcatgcctcc cgcgatgctg ctcgccccct cgccggacct     83640
     tcccctgccg agaccagcaa gacagcgcac cagcaggtgg gagaaaccgc aaaacggtga     83700
     acacggccat atgaagtcga ctcgttcagc ctgcacgtag ggctgagcga gccgtgtggt     83760
     cagcgcgtta cgtctgtgga cgcgctgacc cggtccagtg gactcgctgg tcggggtcgt     83820
     ggacggggcg ccatacgggt gcggaggggc cgtgctggag caggtcggcc agtggcgcca     83880
     cgaggaccgg gacgtcgtgc aggaagccgg acggcatcag cagcctggac cccgagcgca     83940
     gggcgttgat ccggttctcg acaccggcgg gtccggtgcc gtccaggacg aacaggacgc     84000
     gcgggaagag cggatagcgc cgccgccact cctccagcgt cggctcctgg agggtcggcc     84060
     ggcgccccga gaccgcgggc acgtagcggt agaggcgctc gtacgcgggc agcttggcgg     84120
     cgaggcgttc ggggcccatg gtggcccggt cgacttccac gaacgcccgc agcatcgacc     84180
     cgttgtcgcc gcctgcgggg ccgcgccggt agtacaggag cgcgtcgggg atgacggcct     84240
     cgccactccc gatcgggtgg tggacctcgg gaatccagtc cagcggccgg aacaggtcgc     84300
     cgtgacgtcg ggcgtcctcg aggaaggcga gcgcggtctc ggccacggtc agcgtgtggc     84360
     cggccttcag ccgcacggcc gtcggatcgg acaccgtcct ggagggccgg tgcccgcgca     84420
     tctcgggcca ctcggatacg agttgcacgc cgtacgcggt ggggaaccac acccgggtcc     84480
     gccctgcctg cggcaaggtg atgcggtcga caagcccctc cccgcgcagt ctggccagcc     84540
     tgcgcctcgt ctgctcgatg cgcaccgacg gggcgatcac ccggtgcatc tgctcggtgg     84600
     tggccatccg gtactgcgac agcacgccca gcgccagccg gtccccgctg cccacctcca     84660
     cgccgatcat cacggatccg ctcgcttccc gtccggtgcg gcaccgtcct tgccgggcgc     84720
     cgcgcgtacc ggtcacagca gcagccggcc cccaccaaaa ccccgaccat gaaggcccga     84780
     ccacggtcac gaagcgacaa cgcctccgtg gaccaggccc aaatcccctc cgacaacccg     84840
     gccgacaacc gtcctcaccc actcccgcgc ctgcccgaga acccgcaggt caccacacca     84900
     gtccggccgt ggtcgggagg ccgacatccc ctctacgccc ccggaccacg ccccacagca     84960
     ggaaaaacaa ggaaggtggg tgggtgggac aagtgtcggg cggcgggcga ggggattggg     85020
     cgccgccagt gctcctcgcg cgtcggccgg ggccgccgcg ctgcgccgca gtcagagcgg     85080
     cgatgtcagg tgggggatgt cggcggggga gaggtcgggg cgggcgcggt gccagcgtgc     85140
     ggggtggcgc caccggccgg aggtgtcacg ggcgacgtcg acgccgactt ccgccaccag     85200
     ctcgggttct accagcgtga cgttcagcgt ctccctggtg ccccacccgg cggagaaaga     85260
     ccagcccgtc cagggatgac cgcgccgcgc cggagcgagc aggccggcga ccgcagcacc     85320
     tgccgtccgg gcgagggtgg tggtgcggcc gacgtactga aggcggcctt ggtcgtcgta     85380
     cctgccgagc agcagcgtgc ggggagaggc cggggagccg gtgaccgcgc cgacgatcgc     85440
     ctcgctcgtc tcgcggacct tgtatttctg ccagcccctc accgacgggc ggtaggcgtc     85500
     gtccaacctc ttgaagacca ccccctccat gccgaccgac gcccacgtca gccactcgcg     85560
     cacgacatca gcctcggtgg tcgacgggca cagcgcccac ggcgccgaca gccggcggga     85620
     ggcgaacaca gactccagcg cggccctgcg ccgctggtac ggccacctgg tcgtgtccgt     85680
     cccggacagc cgtagcagat cgaacgcgac gaagtgggcc ggccactcct ccgcggcccg     85740
     ggccgccccg gcaccgcgcc gggcaagccg gttctgcaac cgctcgaacg cgaggcggcc     85800
     cgcggcgtcc catacgacca gctcgccgtc cagcgcggtc gcttccgaca gctgcacagc     85860
     cccggccaca acctccggga acgccggccc catttccgtg ccccgcctgg agcgcagcac     85920
     cacccggccc gcgttgacgg agacccctgc ccggaacccg tcccacttcg gctcgcccgc     85980
     ccagcccggc cgcagttcag gcttgggtac gggagtgctc agcatcggct ccggcagcgt     86040
     ccacgtcaca ccggatccct tccaccaaga actccgatgc tgtcctgcct gttacgacct     86100
     gccctcggtc agctggctgg cggtgttctc gatccatagc agtgtccatt cgactccggc     86160
     ctgccacccg ggccccgtgc cggcataccg gccttcggcg gtggtccggg tgttggccgc     86220
     gagggtgcgc gggtcctccc ccctaggacg ttggggagat ggagctggtc ggccgcatgg     86280
     tccgcggctg gcaccgcccc agcggcgagt acacggcgcg tgggatcagg cgctggccgt     86340
     gcgggatgtg atcgcggctt aggcagcgca tcttcggcag ggccctatga cctgccgtgg     86400
     tcggggctga gcctccagtg tctgaggcgg tggggctccg catgcgctgt acaacccttc     86460
     agtcgctctg cgagtcagta acaggccgta tcagccgcgc ttccggagtc cccatgcaag     86520
     agcctcagca ccccatgccc accttgcctg ggttcgagcc ccccatccct ggcttgatcg     86580
     acgggatgga tgaagaagaa cttgcgatca cagtgggact gggtctcgtt gctcgcgaag     86640
     cggcagcagt cgagtacgtc ctgcatggga tctacgttca tctcgccaag gtcgccaagg     86700
     cctacaccgc gcaggccacc gccaccggcg gggctctgat caagcagtgc aggagtgcac     86760
     tggagcagct cggtgactca gcagttcctg caacgcgccg cgcgtcgctc gtgcgcgacc     86820
     ttgacctagc agaggaaggc ttccggctcc gtaaccggtt tctgcacggc tactggcaat     86880
     ttgatcatga ggttcagtcc tggctgaccc tgaagggcgc ccacggcatg acgcgacccg     86940
     agattgcgca cacggacagc gatgcagtct gggagctggc ccaccgcctt caagccttgc     87000
     atgaccgact tgttcattgg gacatcgctc agttcggcga actggcggag accgagaacg     87060
     gcgaccgcgg ctgggcatcg gtgaaacacc tctgactacc cgcgatctgg cggcggccgc     87120
     agatcgggcc cgggcacggt agcggtcagc atcggctccg gcagcgtcca cgtcacaccg     87180
     catgccttca ctcggtcggg tacgccacct gggtggctgc ggccagcagc ggtcggcctg     87240
     gtagtcgtac ccgaccacgg actcccgatt gcgctgcgga tcaggtgtcc ggtctgaagc     87300
     aacggctgtc agagtcagaa cccgcctcgc gtacgcgata tgtaactaag cgtgcgtaac     87360
     gggtacggtc tgcgcatgcc tacgggggaa cacgacacag aaggcccttc ccgcagcgga     87420
     gttggggtag gggtggcgag cgtcgccgtg ccatcgcaag cggggccgca cgaggcagag     87480
     ttccagctgt cggtcggcga gggcaagatc cttcagttca agaagaagcc ccagatcgct     87540
     gccgtcgcag agctggtgtg gaacgctctg gacgcgaacg cgacgctggt cgacgtcgaa     87600
     ctgcgtcgtg actgggacgc cattacccag atcgtggtga ccgacaacgg tcacggcatg     87660
     acgacggatc gggcccgcgc cgcgttcgcg ggatatggcg aaacctggaa gaccggcaag     87720
     acgcacaccg aaggcaacac gcgcatcctg cacggccgta acggcgaggg gcgcctgtac     87780
     gccttcgccc tgggcgaccg gctcacgtgg gagtcggtcg ctgaggtcga aggcgagctt     87840
     gtcggggtcc ggatcaatgg cgacgccgac cacgccacca tctggcgggt cgtagagacg     87900
     gagcccgccc gcgataagac cggcaccacg gtccggatcg atgtacccca ggggaagcca     87960
     ctgcgaggcc tggagcgcca ggatgctgct gcgaacctca ccgcgaagct ggcgttctac     88020
     ctcagggcct accccgacgt ttccgtgacg ttcgacggca agcggctgga ccccagcgac     88080
     atcatcgtcg gcgaacccat cgacctgcgg ctggacctgc cagaggagta cacccaggag     88140
     gacccggccc ccgtcgtgac cttcgtggag tggaaccagc ggatgagcga ccgcaggatg     88200
     ctcatctgca acgccgacgg tattgctctg tatgaacagg gccgggagtg gaccgacagc     88260
     atcgtcagct tcacgcccta cctgcggtcc agcctgttca acgacatctc cgttgacgac     88320
     ctgcacggcc tgcccatgtc ccacggcggt ctcttggacg tggccgccaa ggccgtccag     88380
     aaacacctgg ccctccgggg cgcccagatt tccgcagcgg tggtacggca gctgaaggac     88440
     gaaggcatct atccctactc ggggccgtcc gccagcggta cacaggcgat cgagcgccag     88500
     accttcgacg tcgtggtgac cgtcgcccgc gacgccctcc cggtcaaggg cgcagcccgc     88560
     cagctttccg tgagtctcat ccagactgcg ctggaaagca gtccgggcga cctccacacc     88620
     atcctggcaa aggtcctcgc gctcagcgac gaagaccgcc ggcatttgaa gaatctcttg     88680
     gacagcactg acctgaccca tgtcatcgag gccgctacca ctgtcaccaa ccgcctgaac     88740
     ttcatcggcg cgttgcggaa gatcctcgcc gaccctcagc tccgcaaaga cttgcgtgaa     88800
     gtcgaccagc ttcaccccat gattgccaag aacctttggc tgttcggtga ggactggaac     88860
     atggccatga acgaagtcgg gctcaccaac gtgctccaag cccacttgga agaccagctt     88920
     ggtgaggacg tcgtcctgga gaaccagctc gagcccgtca cgcagccgga cggacgcagc     88980
     ggccgggtgg acgtcctgct gttccgcagc cgacgcgacg acagctccac tgaacggctc     89040
     atcatcgagc tcaagcgccc caccgtccga gtcggaaaga aggaactcga ccagatcaag     89100
     ggctatgccc gggccatcgt cgacgacccg cagtacagcg gcgtcgactg caaatggcgc     89160
     ttctacctga tcacctacga ttactcggac aagatccttc gcgacattcg gcagaaggac     89220
     aaaccggagg gcctcgccga cgaccaccac gactatgaag tctgggtcaa gagttggggc     89280
     gagatcctgg atacggcgga gaagaaactg ctgttcttcc agcgtcagct gaactacgag     89340
     gccaccgacg accgcgtcac gcagcaccta cgcgagagct actcccgctt catcccggag     89400
     gccctcgccg aggacggcca gaacggcgcg gcagcgtcca acagcagcac gggcagtgaa     89460
     acaccgagca cgttgcaccc ttgacctggg cgggagccct tacgtccggg actgcggagg     89520
     acgcgtagca ccaaagcttt tgcagcgggg cgaccctagg tgagcggtgc cagcacgaga     89580
     ctccgggagt cagcgatgac gccccggggt ccctctgtgt tctggcgtgt ccgcccggtt     89640
     caagcgtcgt cacagtgagg gggttcccat gctcgagtgg tccggggcac tatgtgagct     89700
     agatggcgta tgccggaatc cgcgacggca aggcgtgatc ttcgaaaggc cccgcccagc     89760
     aggggggaac cagcgaggct gcggggagca gcccggggta gcggctgata ccagtaggac     89820
     ggctaccccc atgtctcggt atagcgagta cgtaggagct gatcagatcc ttgatctggg     89880
     cttcgtggtt tcggcagatg cggccggagc ttcggcaaag gcagacgagc tgcacttcaa     89940
     gaggatccac atggagagcg agctgagcct tgctcaggtc ctcaccgaca tgcactgcgc     90000
     tgtcgacttc ctgaagccgc agactgatgt gcagaaggct cgattccacc tcgatcgcac     90060
     ggctggaatc atcaagggca tggaggcgaa actcaacctc ctccggcctc catacttcac     90120
     ccaagagaga tttgaagaat tccgcgactt gcttgcccct gcctctggag cacagtccgc     90180
     aagcttcgca cgcgtccggc acttccttgg gctggagggc accgagagcc ccatctacaa     90240
     gcagttcata aatgccgtag cgggccacgg gaccagcatc cccgtagtcc ttcggtcgcc     90300
     cgcaagcccg ctctacgaag tcgctcacgc gctgctgggg gtggctacgg catacgaaag     90360
     ctgggcatgg agccactatc agaatatgcg cctggtcgta ggcgaaaaga aggagggaac     90420
     ggccggaacg ctgggggcgg atttcctcaa gggccgaatg gtggcgccat tcccagaact     90480
     ctggagcgct ataggggtta agaagggcgt ctgacgtcac cgactgtgag cggatgatcc     90540
     tggcgcccag atcgcctccg gccggttcaa tgatcggccg gagggcgatg tcacgcccat     90600
     tcgatgccca gttttcgtag tgcgtcgagc tgttcctggg tgagtttgtc gcgcctcgat     90660
     ttggtgttcg atgtccatac gcccagcttc acggccaccg gctctgtctc gccgtcgacc     90720
     gtgatccctt cagcgtggcc gcgcggtaca ggccggtggg cgccttcccg ctccacccac     90780
     tgtgcgaggg ccaccaggcc ccgctggaac gcttgctgcg ccttgctcgg gctcttcgtc     90840
     gcacgcgtgg ctgacggggc gggagacggc gcctggatgg gcttcacgcc cagctgggac     90900
     agccgctcct gctgttcggt ggacagctgc gcccaggcgc ccggttggga ttgccgctcc     90960
     agccaccggc cgatgtcgtc gccgtccatc agtacgccgg gggcgatctc gggcaggtgg     91020
     ccgtcggctt cgaccaggtc ggcgaggacg cggtagtggc gttgccagtc gagcggccag     91080
     gggcagttcc agtccgggtc gatcgccgtc agttgctgcg cgcgttccgc tgctcgctcc     91140
     gggtccttcc cgaggccgcc cttgcggcgg aggttggccg tgtgctgccc gatgggcacc     91200
     atctcgtcgt cctcgcccca cacggcgtct tgccggggcg cgaggtgccc ggtggcctgc     91260
     cggtaggagc gcagcgcggc gagcttgttt tcccaggctt cctcgccggg ctcccacacc     91320
     atcccggcct cgggcgcgtc cagcagggtc ttgcgccgct cctctagttc cccggcccgc     91380
     agcgccttcc gctgctggtg gacccatcgc ccaagcggaa acgccttcgt cacccccact     91440
     tcgacctcaa cgtcgtaggg cacggcgcag agcccggtga tctcgttctc cgcccgccag     91500
     cgcagcaggg cctggtagcc ctccagccac accagggact ccggccggta gacccgggtg     91560
     cggaggaagg ccgcgatggt cgacgcgtcc ctgggagagg agaagtggag cagggccgac     91620
     tcggcagcgg cgtcggtgtc gtcctgctcc tggtcctcgc cgtcgccgtc ggccccgacg     91680
     atccgccctt cttcatcgtg ccggatgtgc accttgcgct gtccgctggt gagtgcgcgg     91740
     gaggcgagct gctcgacgag tcgttcatcg tgcgagcgca ggccctgaag gacggctaca     91800
     agggggcgga acgaggcgga ggcgaccatg tcggtcgggt cctcgccggg ctccaggaag     91860
     acgggcacga tgatccgcgc gatcttcgtg gtgccgtcgc ggttgagtcg cagggcccgg     91920
     ccgatgttct gcacgatctc gacctgggag ccgcgggtgt cggcgaagca cacggcctcg     91980
     actccccgct cgccggtgat gtccacgcct tccccgagca cgcgacagct cgcgaggaac     92040
     gcgcggtgta cccggcggcc ggccgcgtcg atgccgttgg cgaactgccg cagcacctcg     92100
     cgccgctcgg ctacgaggtg gtcgccgcac agccacgccg cccagacgcg gttcggcggg     92160
     acgtgccgtc cggtctccag ctcgtagaac tccgcgtcga tcgacgacgc ggggagccgg     92220
     cccgcggccg ccaggtcctc gtcggaggcg tcgttcacgt acagctccgc ggccgtcttc     92280
     ggcaactgct ccgcgaaggc cgccgcttcc tccaccttct ggtggaacgt catcaccgtg     92340
     cgcaggttgt acgccgccgc gtgctccagg agcgccgtct gcaacaaagc gaggcgtcgg     92400
     ccccgctgcg cctcctccga ctccccgagg accggtgagg ggtcgcggat ctccagcacg     92460
     tcaatctcga aacccgccag gatgccccgc tcgatgctct cgctcagccc gagctcggca     92520
     agccacgggc cgtaggtttc cgattcctgg cccatcgacg cgatctccag ctcctggccg     92580
     tccgcgccct tctgcggccg gggcgaagcc aggatgcgcg gggtcgcagt caggtacagc     92640
     cggaagtcgg ccgggatgcg ggcgttgtca tggatcgccg cccacggcct accaagatca     92700
     ccagtggttc cgtgggcctc atccacgatc gcgaggtcga agcctgccat ctgctgcccg     92760
     tagagccgct ctccgcccgc cagagcagcc tccagcggcc cgcgaacctt ccgctgaccc     92820
     atcgggtcgt cgaagtcctc gcggtccacc agggaggcgt acgtggcgaa cacgaccacg     92880
     gtccccgccc ctgcccacag ggcgagttgg atcggattgg tggtggtgcg cactcccaac     92940
     tcgttcagca ccgggtcgtt ctccagcgag cacaccgcca ccatgggcga gcgatgaccc     93000
     accaggcgcc acgcctgggc ggtctgtacg agcaggtcca aggtcgggac cgtgacgagg     93060
     atccggccgc ctgagaagca ctccagcgcg cacgcagcgg ccgtgaaagt cttccccgat     93120
     ccggtcgcgg acacgatcgt gccccgcgcc ccctgagggg gcacagatga ccttgcaggg     93180
     aatcccaccc acttacggaa acttgccttc tgatccacct gatgttctcg aagctgaata     93240
     cccggcattt cctgatcctc ccctagctcg ctttctgacc gtttcggaaa atcaccggga     93300
     cggcatgaag ggcgggacag acaccgtacc gtcctcgctc accacaaccc gttcggcgag     93360
     ctgcgccagg atttgagcgg gctgcagccc gctcaggtcg gccaccgccc ggatccgccg     93420
     accgggtccg gcggacaacc acaactccgc ctgcaactcg tccggcccct cccgccgccg     93480
     cgcctcgaag gccgcccctg ccgcaagagc acccgcacgc cgatcttcgc gatcccgggc     93540
     ccactccgaa ccctgagcgt cccgctccgg ctcgtacacg ccccaaccgg cctcagtcat     93600
     cgagtctctg acgcgccgcc actcagcgtg cttggccgcc caagtgtcag ccagccgctc     93660
     cgggtccatc ccgaactcgg agaaggaacc gccccgccgc aagtgctcag ctgtctcaca     93720
     ctcgcggaca gggcctccgc taccttctcc gcaacggcag cgatagccag accatttgct     93780
     tggcggcgga cctgatcacg tgccacatcc tgagcactcc acatacgatt tcccttttcc     93840
     tgacggctca tcttgcgccc cgcccgggtg gttggggggt gtcccgtgtt tcctccaacg     93900
     gtacatgctg catcaacctg atgcacgcgg tacactggaa cccacacgaa cgagcgaccc     93960
     ccacccctcg tagccagccc ggcccgcgcc agcgggcccc aacggttctg gaggcgcagc     94020
     cggaaggacc gtcaggcggg ggagcgcagc ggacccgccc agagtccgca ggactcccca     94080
     actccccaac tggaggccta actagccgca cgtgacaccc cctcagcggg cgagcgcgca     94140
     ccgcgcgctg cgccggtcgc gcagcggccg gccccaccgg atcccggagc gcagcgcagg     94200
     gatccgccca cgcgatgcgt gggcagcggg agcgcagcga ccgcccccct tgcacatcgc     94260
     gcagcgatgt ggtacccgct ccgcggg                                         94287
//