spacer

EBI Dbfetch

ID   X58840; SV 1; linear; mRNA; STD; HUM; 2816 BP.
XX
AC   X58840;
XX
DT   02-NOV-1993 (Rel. 37, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Human mRNA for variant hepatic nuclear factor 1 (vHNF1)
XX
KW   DNA-binding protein; hepatic nuclear factor 1; transcription factor;
KW   variant hepatic nuclear factor 1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2816
RA   Bach I.;
RT   ;
RL   Submitted (09-APR-1991) to the INSDC.
RL   I. Bach, Inst Pasteur - UA 1149 du CNRS, Unite de Virus Oncogene, Dept de
RL   Biotechnologie, 25 Rue du Dr Roux, 75724 Paris Cedex 15, FRANCE
XX
RN   [2]
RX   DOI; 10.1093/nar/19.13.3553.
RX   PUBMED; 1677179.
RA   Bach I., Mattei M.G., Cereghini S., Yaniv M.;
RT   "Two members of an HNF1 homeoprotein family are expressed in human liver";
RL   Nucleic Acids Res. 19(13):3553-3559(1991).
XX
DR   Ensembl-Gn; ENSG00000108753; homo_sapiens.
DR   Ensembl-Tr; ENST00000225893; homo_sapiens.
DR   Ensembl-Tr; ENST00000561193; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2816
FT                   /organism="Homo sapiens"
FT                   /chromosome="17"
FT                   /map="17q12.2-q21.1"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="HV19, HV17"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..2816
FT                   /note="variant hepatic nuclear factor 1 (vHNF1)"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             195..1868
FT                   /product="variant hepatic nuclear factor 1 (vHNF1)"
FT                   /db_xref="GOA:P35680"
FT                   /db_xref="H-InvDB:HIT000322295.14"
FT                   /db_xref="HGNC:HGNC:11630"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR006897"
FT                   /db_xref="InterPro:IPR006899"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023219"
FT                   /db_xref="PDB:2DA6"
FT                   /db_xref="PDB:2H8R"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35680"
FT                   /protein_id="CAA41652.1"
FT                   /translation="MVSKLTSLQQELLSALLSSGVTKEVLVQALEELLPSPNFGVKLET
FT                   LPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAA
FT                   EQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQ
FT                   KRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDA
FT                   CSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPS
FT                   KAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHSLNPLLSHGSPHHQPS
FT                   SSPPNKLSGVRYSQQGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPD
FT                   GKMISVSGGGLPPVSTLTNIHSLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQSVPV
FT                   INSVAGSLAALQPVQFSQQLHSPHQQPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHKQ
FT                   EPPQYSHTSRFPSAMVVTDTSSISTLTNMSSSKQCPLQAW"
FT   misc_feature    878..1151
FT                   /note="homeobox"
XX
SQ   Sequence 2816 BP; 707 A; 879 C; 668 G; 562 T; 0 other;
     gtggcgatca tggcaagtta gaagttttct gactcctttc ggaggagcct ccgggacccc        60
     ggggagtaac aggtgtctgg aggctgaagg gtggaggggt tcctggattt gggttttgct       120
     tgtgaaactc ccctccaccc tcctctctcg cacccaccca ccccctcacc cccttctttt       180
     tccgtccttg gaaaatggtg tccaagctca cgtcgctcca gcaagaactc ctgagcgccc       240
     tgctgagctc cggggtcacc aaggaggtgc tggttcaggc cttggaggag ttgctgccat       300
     ccccgaactt cggggtgaag ctggagacgc tgcccctgtc ccctggcagc ggggccgagc       360
     ccgacaccaa gccggtcttc catactctca ccaacggcca cgccaagggc cgcttgtccg       420
     gcgacgaggg ctccgaggac ggcgacgact atgacacacc tcccatcctc aaggagctgc       480
     aggcgctcaa caccgaggag gcggcggagc agcgggcgga ggtggaccgg atgctcagtg       540
     aggacccttg gagggctgct aaaatgatca agggttacat gcagcaacac aacatccccc       600
     agagggaggt ggtcgatgtc accggcctga accagtcgca cctctcccag catctcaaca       660
     agggcacccc tatgaagacc cagaagcgtg ccgctctgta cacctggtac gtcagaaagc       720
     aacgagagat cctccgacaa ttcaaccaga cagtccagag ttctggaaat atgacagaca       780
     aaagcagtca ggatcagctg ctgtttctct ttccagagtt cagtcaacag agccatgggc       840
     ctgggcagtc cgatgatgcc tgctctgagc ccaccaacaa gaagatgcgc cgcaaccggt       900
     tcaaatgggg gcccgcgtcc cagcaaatct tgtaccaggc ctacgatcgg caaaagaacc       960
     ccagcaagga agagagagag gccttagtgg aggaatgcaa cagggcagaa tgtttgcagc      1020
     gaggggtgtc cccctccaaa gcccacggcc tgggctccaa cttggtcact gaggtccgtg      1080
     tctacaactg gtttgcaaac cgcaggaagg aggaggcatt ccggcaaaag ctggccatgg      1140
     acgcctatag ctccaaccag actcacagcc tgaaccctct gctctcccac ggctcccccc      1200
     accaccagcc cagctcctct cctccaaaca agctgtcagg agtgcgctac agccagcagg      1260
     gaaacaatga gatcacttcc tcctcaacaa tcagtcacca tggcaacagc gccatggtga      1320
     ccagccagtc ggttttacag caagtctccc cagccagcct ggacccaggc cacaatctcc      1380
     tctcacctga tggtaaaatg atctcagtct caggaggagg tttgccccca gtcagcacct      1440
     tgacgaatat ccacagcctc tcccaccata atccccagca atctcaaaac ctcatcatga      1500
     cacccctctc tggagtcatg gcaattgcac aaagcctcaa cacctcccaa gcacagagtg      1560
     tccctgtcat caacagtgtg gccggcagcc tggcagccct gcagcccgtc cagttctccc      1620
     agcagctgca cagccctcac cagcagcccc tcatgcagca gagcccaggc agccacatgg      1680
     cccagcagcc cttcatggca gctgtgactc agctgcagaa ctcacacatg tacgcacaca      1740
     agcaggaacc cccccagtat tcccacacct cccggtttcc atctgcaatg gtggtcacag      1800
     ataccagcag catcagtaca ctcaccaaca tgtcttcaag taaacagtgt cctctacaag      1860
     cctggtgatg cccacacacc acttacttcg tgcgcaacaa caaggaccct gttttccaca      1920
     ccatcaccct ctgggcagct gtcatggaaa agcccagtga cctgaccagc acctgcgaga      1980
     ggtccctgct tacctgacgg acgtcctgct ggcacctcag acaatccact ctcaggagcg      2040
     cagcccgaag cccagtttcc cttctatgca gtattgccac aatgcctctc ccacgatgtc      2100
     aaggactcct gtctgtcctg gaggtgggag acaaggaacc tccgaagagg aagcaagaaa      2160
     gccgtactgt ctatgttgtg atccttcatc gaacaaactg atgcgaaaac ttgaatctgt      2220
     tactgaaatg aggagagaag gacatgtgct attgaactga gccaaacaca ctgtaaatat      2280
     ccacagactc cctcccctgc ccccatccca aatgatcttg agatttcttt taaagaagta      2340
     aatttgtcca atggctgtaa actataaact actgtaatta agtgcaattt cccctctgtg      2400
     tcctctcccc tctgccctgt atataatact aaagtgtcta ttagttttct ttgtaaaggt      2460
     cagagtcaaa atttcaaaag tgatctgtcc cctctcccct catggagaaa catcctaagt      2520
     gggaagtgaa gccccttgtc ctctcccgcg aggcctggac acttatgggg acagcatacc      2580
     ttggactgac taccagctaa ctccagtctc ctgacattaa gacacacctc tggatccctg      2640
     gaggggctga atgtagtgtg tcagagtaac atgccagctt cctgtgggcc aggagctcag      2700
     ccgtgcactc cctaagaaac cccagggcag ggaaactggc tgtttgatag cagaagaaaa      2760
     agttgcagtc tcagaaagcc ttccattaaa acaatttatt ttatcactaa aaaaaa          2816
//


spacer
spacer