spacer

EBI Dbfetch

ID   X14827; SV 1; linear; genomic DNA; STD; PRO; 1995 BP.
XX
AC   X14827;
XX
DT   06-JUL-1989 (Rel. 20, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Staphylococcus aureus lacC and lacD genes
XX
KW   lacC gene; lacD gene.
XX
OS   Staphylococcus aureus
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcus.
XX
RN   [1]
RP   1-1995
RA   Stewart G.C.;
RT   ;
RL   Submitted (20-MAR-1989) to the INSDC.
RL   Stewart G.C., University of Kansas, Dept of Microbiology , 7042 Haworth
RL   Hall, Lawrence KS 66045, U S A.
XX
RN   [2]
RP   1-1995
RX   DOI; 10.1093/nar/17.10.3980.
RX   PUBMED; 2543958.
RA   Rosey E.L., Stewart G.C.;
RT   "The nucleotide sequence of the lacC and lacD genes of Staphylococcus
RT   aureus";
RL   Nucleic Acids Res. 17(10):3980-3980(1989).
XX
DR   MD5; cf401d3c39eed14df680689591c1fb27.
DR   GOA; Q2G2R0.
DR   InterPro; IPR003500; RpiB_LacA_LacB.
DR   InterPro; IPR004784; LacB.
DR   UniProtKB/Swiss-Prot; Q2G2R0; LACB_STAA8.
XX
CC   Data kindly reviewed (21-Jun-1989) by Stewart G.C.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1995
FT                   /organism="Staphylococcus aureus"
FT                   /strain="8325-4 clone=pFB30"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1280"
FT   RBS             41..49
FT                   /note="pot. rRNA binding site (lacC)"
FT   CDS             55..987
FT                   /transl_table=11
FT                   /note="lacC polypeptide (AA 1-310)"
FT                   /db_xref="GOA:P0A0B9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005926"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="PDB:2JG1"
FT                   /db_xref="PDB:2JGV"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A0B9"
FT                   /protein_id="CAA32935.1"
FT                   /translation="MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRV
FT                   LAQVGEPVLASGFIGGELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILE
FT                   QGPEIDNQEAAGFIKHFEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILD
FT                   CSGATLQTVLENPYKPTVIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVS
FT                   LGAQGAFAKHNHTFYRVNIPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLG
FT                   MLNAQEAQTGYVNLNNYDDLFNQIEVLEV"
FT   RBS             979..984
FT                   /note="pot. rRNA binding site (lacD)"
FT   CDS             991..1971
FT                   /transl_table=11
FT                   /note="lacD polypeptide (AA 1-326)"
FT                   /db_xref="GOA:P0A011"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A011"
FT                   /protein_id="CAA32936.1"
FT                   /translation="MSKSNQKIASIEQLSNNEGIISALAFDQRGALKRMMAKHQTEEPT
FT                   VAQIEQLKVLVAEELTQYASSILLDPEYGLPASDARNKDCGLLLAYEKTGYDVNAKGRL
FT                   PDCLVEWSAKRLKEQGANAVKFLLYYDVDDAEEINIQKKAYIERIGSECVAEDIPFFLE
FT                   VLTYDDNIPDNGSVEFAKVKPRKVNEAMKLFSEPRFNVDVLKVEVPVNMKYVEGFAEGE
FT                   VVYTKEEAAQHFKDQDAATHLPYIYLSAGVSAELFQETLKFAHEAGAKFNGVLCGRATW
FT                   SGAVQVYIEQGEDAAREWLRTTGFKNIDDLNKVLKDTATSWKQRK"
FT   RBS             1977..1983
FT                   /note="pot. rRNA binding site (lacF)"
XX
SQ   Sequence 1995 BP; 719 A; 306 C; 395 G; 575 T; 0 other;
     gaattcttag aaaaatggga cagaggcgaa taccacgatt aagggacgac acatatgatt        60
     ttaactttaa cattaaatcc atccgttgat atttcatacc cattaacagc attgaaatta       120
     gatgatgtta atcgtgttca agaagtaagt aaaacagctg gtggtaaagg tttaaatgta       180
     acaagagtac ttgcgcaagt aggtgagcca gtccttgcga gtggttttat tggcggtgaa       240
     ttaggtcaat ttattgctaa aaaattagat catgccgaca tcaagcatgc attttataac       300
     attaagggtg aaacacgaaa ctgcattgca attttacatg aagggcaaca aacagaaatt       360
     ttagagcagg gaccggagat tgataatcaa gaggctgcag gatttattaa acattttgaa       420
     caattattag aaaaagttga agcagttgct atttcaggta gcttacctaa aggattaaat       480
     caagattatt atgcacaaat cattgaacga tgccaaaaca aaggtgtgcc tgtgatatta       540
     gattgctcgg gtgcaacttt gcaaacagtt ttggaaaatc catacaaacc tacagtcatt       600
     aaaccaaaca tttctgaact atatcaattg cttaaccagc cacttgatga aagtttagaa       660
     agtttgaaac aggcagtgtc acaaccctta ttcgaaggga ttgagtggat tattgtgtct       720
     ttaggtgcac aaggtgcatt cgctaagcac aatcatacat tctatagagt gaatattccg       780
     acaataagtg tattaaatcc ggttggttca ggtgattcta cagttgctgg aattacttca       840
     gcaattctta atcatgaaaa cgaccacgat ttactaaaaa aagccaatac tttaggcatg       900
     ctgaatgcac aagaagcaca aacaggttat gtcaatttaa ataattatga tgatttattc       960
     aatcaaattg aagttttaga ggtgtaaaaa atgtcaaaat cgaatcaaaa aatcgcatca      1020
     attgaacaat taagtaacaa cgaaggtatc atttctgcat tagcatttga ccaacgtggt      1080
     gctttaaaac gcatgatggc aaaacatcaa actgaagaac caactgtagc tcaaattgaa      1140
     caattaaaag tattagttgc ggaagaatta acacaatatg catcttcaat tttattagat      1200
     cctgaatatg gtttaccagc ttcagatgca cgtaacaaag attgtggatt attacttgct      1260
     tatgaaaaaa ctggatatga cgtaaacgct aaaggtcgtt tacctgactg tttagtagag      1320
     tggtctgcaa aacgtttaaa agaacaaggc gcaaatgctg ttaaattctt actttactat      1380
     gatgttgatg atgctgaaga aattaacatt caaaagaaag catacattga aagaatcggt      1440
     tcagaatgtg ttgcagaaga tattccattc tttttagaag tattaacata cgatgacaac      1500
     attcctgata acggtagtgt tgaattcgca aaagttaagc ctagaaaggt taacgaagca      1560
     atgaaattat tctcagaacc acgctttaac gttgatgtat tgaaagttga agtaccagta      1620
     aacatgaaat atgtagaagg ctttgctgaa ggtgaagtgg tttatacaaa agaggaagcg      1680
     gcacaacact ttaaagatca agatgcagca actcatttac catacattta cttaagtgct      1740
     ggtgtttctg cggaattatt ccaagaaact ttaaaatttg ctcacgaagc tggtgctaaa      1800
     ttcaacgggg tactttgtgg ccgtgctaca tggtctggtg ctgttcaagt atacattgaa      1860
     caaggtgaag atgctgctcg tgaatggtta cgtacaactg gtttcaaaaa tattgatgac      1920
     ttaaataaag tattaaaaga tactgcgaca tcttggaaac aaagaaaata agtttaaaag      1980
     gggattaatg ctatg                                                       1995
//


spacer
spacer