spacer

EBI Dbfetch

ID   U37138; SV 1; linear; mRNA; STD; ROD; 2472 BP.
XX
AC   U37138;
XX
DT   03-NOV-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Rattus norvegicus steroid sulfatase (Sts) mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-2472
RX   DOI; 10.1007/s003359900125.
RX   PUBMED; 8662223.
RA   Li X.M., Salido E.C., Gong Y., Kitada K., Serikawa T., Yen P.H.,
RA   Shapiro L.J.;
RT   "Cloning of the rat steroid sulfatase gene (Sts), a non-pseudoautosomal
RT   X-linked gene that undergoes X inactivation";
RL   Mamm. Genome 7(6):420-424(1996).
XX
RN   [2]
RP   1-2472
RA   Salido E.C.;
RT   ;
RL   Submitted (26-SEP-1995) to the INSDC.
RL   Eduardo C. Salido, Pediatrics, UCSF Sch Med, 521 Parnassus, Box 1320, San
RL   Francisco, CA 94143, USA
XX
DR   MD5; 4f8461a4e6bb122bd75fb4b780ab3f5c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2472
FT                   /organism="Rattus norvegicus"
FT                   /chromosome="X"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS             527..2260
FT                   /codon_start=1
FT                   /gene="Sts"
FT                   /product="steroid sulfatase"
FT                   /EC_number="3.1.6.2"
FT                   /db_xref="GOA:P15589"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15589"
FT                   /protein_id="AAC53097.1"
FT                   /translation="MLWPCLLALLLSQLNFLCAARPGPGPNFLLIMADDLGIGDLGCYG
FT                   NRTLRTPHIDRLALEGVKLTQHLAAAPLCTPSRAAFLTGRYPVRSGMASHGRLGVFLFS
FT                   ASSGGLPPNEVTFAKLLKGQGYTTGLVGKWHLGLSCQAASDFCHHPGRHGFDRFLGTPT
FT                   TNLRDCKPGGGTVFGSAQQVFVVLPMNILGAVLLAMALARWAGLARPPGWVFGVTVAAM
FT                   AAVGGAYVAFLYHFRPANCFLMADFTITQQPTDYKGLTQRLASEAGDFLRRNRDTPFLL
FT                   FLSFMHVHTAHFANPEFAGQSLHGAYGDAVEEMDWAVGQVLATLDKLGLANNTLVYLTS
FT                   DHGAHVEELGPNGERHGGSNGIYRGGKANTWEGGIRVPGLVRWPGVIVPGQEVEEPTSN
FT                   MDVFPTVARLAGAELPTDRVIDGRDLMPLLLGHVQHSEHEFLFHYCNAYLSAVAWRPHN
FT                   SSSVWKAFYFTPNFDPPGSNGCFSTHVCMCHGHHVTHHDPPLLFDIARDPRERHPLTPE
FT                   TEPRHGEILRNMDAAARAHVATLEEAPNQLSMSNVAWKPWLQLCLPSKPHPLACRCAGD
FT                   G"
XX
SQ   Sequence 2472 BP; 496 A; 813 C; 688 G; 475 T; 0 other;
     ggcaacaccg cgacctctga acccgtgcct cagagacaac accgcgaccc tctggcgacc        60
     tctgaccctg tgaccctgtg tggtgtgacc tcacgaccct ggcgccctca gcggtgacct       120
     ttgaccccgc agcgaccccg agaccccagg acccctgcac ttatccacaa ctctgggacc       180
     tccaaccccg cgaccccaac agcgacctct gaccctggtg aaagcaggag aacccgggac       240
     accagtgacc ctgcaacttc tgaccccact aagggcaaca actctgagac tgtacggtga       300
     cctctgacct ctgaccctgg gctgttcccc cgagataaca gtgaccccag gaactccaac       360
     tcagctacaa cctggtgaca accaaggtaa cccagggaca acctctgacc ccttgaatcc       420
     acgacttttc acccagtgct gaccactgca gtgtggggca gtctgagaga gtgcgtgacc       480
     tttgatctct gacctctgac cccgacccag ccttgcccac aggacgatgc tctggccctg       540
     tctccttgcc ctgctcctct cccagctcaa ctttctctgt gctgcccgtc ctggccctgg       600
     acctaacttc ctgctcatca tggctgatga ccttggcatt ggggacctag gctgctatgg       660
     caaccgcaca ctcaggacgc cacacatcga ccgcctggcc cttgaggggg tgaagttgac       720
     tcagcacctg gcggctgcgc ccctgtgcac cccgagccgc gctgccttcc ttaccgggcg       780
     ctaccctgtg cggtcaggga tggcatcaca tggccgcctg ggtgtattcc tgttctcggc       840
     atcatctggg gggctcccgc ccaatgaagt cacctttgca aagttgctca agggtcaagg       900
     ctacaccacc gggcttgtag ggaagtggca tctggggctg agctgccaag cagcctctga       960
     cttctgccac caccctgggc gccatggctt tgaccgcttc ctgggcacgc ccaccaccaa      1020
     cctgagggac tgcaagccag ggggcgggac cgtgtttggc tctgcccaac aagtattcgt      1080
     ggtcctgccc atgaatattc tgggggcagt gctgctggcc atggcacttg cgcggtgggc      1140
     agggctggcc cggcccccag ggtgggtgtt cggggtgaca gtggctgcca tggcggcggt      1200
     gggcggggcc tatgtggcct tcctctacca cttccgccca gccaactgct tcctcatggc      1260
     cgacttcacc atcacccaac agcccacgga ctacaagggg ctcacacagc gcctggcaag      1320
     cgaggctggg gacttcctgc gcaggaacag ggacacgccc ttcctgctat tcctgtcttt      1380
     catgcatgtg cacacggcac acttcgccaa ccctgagttt gccgggcaga gcctgcatgg      1440
     ggcctatgga gatgctgtgg aggagatgga ctgggccgta ggccaggtcc ttgccacact      1500
     ggacaagctg ggcctcgcca acaacacact cgtgtacttg acgtccgacc atggcgcaca      1560
     cgtggaggag cttggcccca acggtgaacg gcatggcggg agcaacggaa tttacagggg      1620
     cgggaaggcc aacacgtggg agggtggcat ccgtgtgcct ggacttgtgc gctggcccgg      1680
     cgtgattgtg cccggccagg aggtcgagga gcccacgagc aacatggacg tcttccccac      1740
     tgtggccagg cttgcagggg cagagctgcc gactgacagg gtgattgacg ggcgtgactt      1800
     gatgcccctg ctgctgggcc atgtacaaca ctctgagcat gaattcctgt tccactactg      1860
     caatgcctac ctcagcgctg tggcatggcg gccccacaac agctcgtccg tgtggaaggc      1920
     gttttacttc acaccgaact tcgacccccc gggctctaat ggctgcttct ccacacacgt      1980
     gtgcatgtgc cacggccacc atgtcacgca ccatgatccg cccctgctct tcgacattgc      2040
     ccgtgacccc agggagcgcc acccgctcac gcctgaaaca gagccgcgcc atggtgagat      2100
     cctgcgcaac atggatgctg cggcccgtgc acacgttgct accctagagg aggcgcccaa      2160
     tcagctttcc atgtcaaatg tcgcatggaa gccatggctg cagctctgcc tgccttccaa      2220
     gccccaccca ctcgcatgcc gctgtgctgg cgacgggtga gttgggcatg ccaaacacac      2280
     aggtatgcaa gcatgggaca ctgtggcctg gtgatttcac ctcctgaact gatacctgac      2340
     acaatcttgc tgacatgtat gaaaacatat gaacatgtat gaacatgtgt atgctgagta      2400
     caaaacacag gaagagcccc tcagcatgac cctgatgaat aaatgatgtg gacacggaaa      2460
     aaaaaaaaaa aa                                                          2472
//


spacer
spacer