spacer

EBI Dbfetch

ID   U29153; SV 1; linear; mRNA; STD; INV; 8230 BP.
XX
AC   U29153;
XX
DT   15-SEP-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Drosophila melanogaster nudel (ndl) mRNA, complete cds.
XX
KW   .
XX
OS   Drosophila melanogaster (fruit fly)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
OC   Drosophilidae; Drosophila; Sophophora.
XX
RN   [1]
RP   1-8230
RX   DOI; 10.1016/0092-8674(95)90475-1.
RX   PUBMED; 7671306.
RA   Hong C.C., Hashimoto C.;
RT   "An unusual mosaic protein with a protease domain, encoded by the nudel
RT   gene, is involved in defining embryonic dorsoventral polarity in
RT   Drosophila";
RL   Cell 82(5):785-794(1995).
XX
RN   [2]
RP   1-8230
RA   Hong C.C., Hashimoto C.;
RT   ;
RL   Submitted (14-JUN-1995) to the INSDC.
RL   Charles C. Hong, Cell Biology, Yale Medical School, 333 Cedar St., New
RL   Haven, CT 06510, USA
XX
DR   MD5; 2d0c22bdff55e5d3b358b7f0ed600ccb.
DR   Ensembl-Gn; FBgn0002926; drosophila_melanogaster.
DR   FLYBASE; FBgn0002926; ndl.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8230
FT                   /organism="Drosophila melanogaster"
FT                   /chromosome="3"
FT                   /map="3-17; 65B5-65C1"
FT                   /mol_type="mRNA"
FT                   /tissue_type="ovary"
FT                   /db_xref="taxon:7227"
FT   CDS             269..8119
FT                   /codon_start=1
FT                   /gene="ndl"
FT                   /standard_name="nudel"
FT                   /product="serine protease"
FT                   /note="soma dependent gene required maternally for
FT                   embryonic dorsoventral polarity"
FT                   /db_xref="GOA:P98159"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR015420"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98159"
FT                   /protein_id="AAA83086.1"
FT                   /translation="MNYNMDEMEATRLLRHPRRWWSIGFGKRIVAISILVIIVLLFSLV
FT                   YHGLVVEKIDQVQQIAALNARHQVLFNQPFEEDQSALTVSPQTLHFKLLDEDMNKDMED
FT                   SKNRRRKHMRQMLVKLRLNKKHRMRRDLHGLDLLDPVRMEANMQHLYTKLRSKRAREAL
FT                   SQLEHEFVRCKKHTPQDCMSAFLRMYKMAKEVTEKMEKMKAIMREQQPKLESSSMESHE
FT                   QKGTFSPADLIQVTTAEATTVAVHATEKPARTKIKPSRISWIIDGHDHDESPVYTDGAP
FT                   KKETTKAPWNTTQLVEITTTKIDATATERTTVESTTEKISWILDHFDKPQEILRTTEGP
FT                   GQRIIRNVTTTSASSEPIVDTETTNSDHVPTTENGLVFNITTDGPVETTKSTAQRKLSF
FT                   DWILDGEENVEPEVKSTNTTTTTAATTTTGATSETIIVTTELPKITFDWIIDGREVVEP
FT                   QETTTEVTGTTERLRKMPFDWIIDGEEVVEPQENVTTTTIATTVAVSTTEINERIHNST
FT                   AYPTKPKPVKFDWIIDGGESSGEVSTSSTSQPKLTTREAISNPESPRSSHPLDNPTSIE
FT                   NMLESFEQHEEQKPILRVLNANESSSETVTDGYERQLWLKKFEDQARPNQNELIDTFGT
FT                   ALDAKALDKMGPKINPLNGHTWNAADAQILSLCERVALRMRNKVATMSDGETKEKGETF
FT                   TASPSVQFTSRAPGGFPVSGETMKASAQFMFNPNFGMPSIPVCFYMTPANFRMPMWSNT
FT                   PTFMGMQGAHFGGSSNPGAGIFFVPQQFGPSGNFFGGSGGSGAGGQGANIFSKNASPQK
FT                   PTNGQQQVYCSYMQNQSGRGAGQSQTSSQQQQGGQSAFSNANFKMRHANQTSTANQQGQ
FT                   IIYASYAGLPQQPIQERSRCPEPDQFSCFGQQECIPAARWCDNVVDCSDGSDESACTCA
FT                   DRVDEERLCDGYEDCPMGEDELGCFGCESLAYSCYENPQDFAKRNRSTISMCYSRLERC
FT                   DGFMNCLNGRDEEQCSMLVTDVADHMSHGASASEGYLYHNYRGDWHPVCNNGEKWAALA
FT                   CQMDENSRMDHSASLNVSFQTLTLPGPFIEPSLHAGVHFAQACHGRNSHDSLVDHVAYV
FT                   KCPPMQCGLPSKSSMLEHSKRVRRAVSDSKEIVGDGRIVGGSHTSALQWPFVVAIYRNG
FT                   KFHCGGTIYSDRWIISAAHCVINYGKYFYEVRAGLLRRSSYSPATQIQPVSHVVVHQAY
FT                   ERRSMRNDLSLLRLLNPLQFNRWVKPICLPDKGRTTVGDDWIWGPVEHTLCTVVGWGAI
FT                   REKGPSSDPMRQVIVPIRKKCTDPEDQASEDICAGDPDGGRDACQGDSGGPLFCRSVSN
FT                   ADEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWLEMATTPRLLPKLQPLQLCPGFICV
FT                   WGGKRCISKRQRCDRNVDCLGGEDEVGCTYNFLPDMVGGVRQNISTTTESDYHPVKESE
FT                   EKSKMREVIPIDDEDLKAEQDEEDLLKSTTSLGQTETTQGPMDLSFAEQITSTTSDDLS
FT                   ITDETTSTDFTVSDSATSPSTLLPTTTNPSTWLPSTNIETSTFSFTTTESEASTKQETL
FT                   PTTVAQTTTIPTSTEDLKKLTDLVTEFMESTTFETTMEVETTTLSLTSTDAPILVTTEG
FT                   VKETTTTEDTTTISSIVTLTTTPLATISTTIPTTEKHVAVTTLAPTTTTESAKTTTTHS
FT                   SSTHSEKDQIQIPNKFVCKKMSQIVDIMMRCDRKVDCEDGTDELDCTCKDYLKGSLKGL
FT                   ICDGKADCEDLTDEQNCVECQSNEFRCPLSKTCLPLSKRCDNKVDCKFKEDEKDCFALT
FT                   NGHDVHFDVHQQPKFSSTGIFSRNGHGVWRVVCAHETGYHEHQAKTANAVCALLGFNGA
FT                   HYFNSSEFVTQQEKQPITPELKGGRNRMAAQIHSMVGDNVQFTENEVIIPELGHPSASR
FT                   PEKDRLLPRKCVGIYVECNPYSNKTTPLKTFSAGQVVKEKPIEQVPVLSPTIETHNTPN
FT                   VHFKPQIPAMVVNKKDEILDRLDKLIKSKKNKTILVNEQLHEAIEELHWPWLADVYMNG
FT                   DLWCIGVLIDKHWVMVHESCLSGIDLETHYVSVLLGGGKTKRSAHRSNHEQIRRVDCFE
FT                   GVPKSNVLLLHLERPVRFTHHVLPTFLPDSSHQNQSNARQCISVLHDDATGRIKTVAIT
FT                   RIHNATNCDSCYKLQEKQPPANLMRLLNVSAEDMASISEEVELINGVAPTELPAITKFT
FT                   TCNQFGLKNVSDAHHNPSDQGVLVCRDSHTGWFPTALFNYNNSDCQSFKQPFGIRTLEL
FT                   VYKSLQDIIDKPSCKMLLPAPDCSTHRCPLGTCLPQAAMCNGRSDCHDGSDEEETKCRQ
FT                   QKQQCAPGEMKCRTSFKCVPKSKFCDHVPDCEDMTDEPTICSCFTYLQATDPSKICDGK
FT                   RNCWDKSDESSVLCNCTADHFQCSSSPEDCIPRDFVCDKEKDCPNGEDERYCFGIEHPL
FT                   HLQKKDFWTNSQHTQPEIAPQYGQVIEQTYGIWHTKCFPKSKPPQVDEVREICKKLGYN
FT                   PYRQPSYRLIDDEENKPVHTYELADRQGRSFSNESLMGKYRDSTKALIISKFSPLQLNE
FT                   RLTLFLKSSRPIAELVRWNATDSSMCYRLEIRCA"
XX
SQ   Sequence 8230 BP; 2354 A; 1971 C; 2047 G; 1858 T; 0 other;
     ccggccggat cgcgcggaag tcgtcatcgt agtgattatc accgttctgg attatcgtgc        60
     atatcaaatt gctttgcgat tgctttttgt ggatttttgt ttgagtgaat cgctgtaacc       120
     tgaggctcct tgtttcccgg ccaatttaac aaagtgctta acatataatt gaaagaaata       180
     atcagcgatt ttgtggcgta aaagcttatg tgttaaaaat gtccagagct taagtgaaaa       240
     atccagaaga taaatcaatt tatgaataat gaattacaac atggatgaga tggaggccac       300
     caggctgctt cggcatccgc gacgttggtg gagcattgga ttcggcaaac ggatcgtggc       360
     catctcgatt ctggtcatca tcgtgttgct attttctctg gtttaccacg ggctagtggt       420
     ggagaaaatt gatcaagtgc agcagattgc agcgctgaat gccaggcacc aggtgctttt       480
     caaccagccc tttgaggagg atcagtctgc cctgactgtg agtcctcaaa ctttgcactt       540
     caaattgctc gacgaggata tgaacaagga tatggaggat agcaaaaaca ggagaaggaa       600
     gcatatgcgg caaatgctgg ttaagctccg gttgaacaag aaacaccgca tgcggcgtga       660
     tttgcatggg ttggatctgt tggatcccgt ccggatggag gccaatatgc agcacctgta       720
     caccaagctg cgaagcaaaa gggcaagaga agccctaagc cagctggagc atgagtttgt       780
     gcgttgcaaa aagcatactc cgcaggattg catgtccgcc tttctgcgca tgtacaaaat       840
     ggcaaaggag gtgaccgaga aaatggagaa gatgaaggcc attatgcggg agcagcagcc       900
     gaaattggaa tcaagcagca tggagtccca tgaacagaag ggtacttttt caccggccga       960
     cctgattcag gtgacaactg cagaggccac aacggttgcg gtacatgcca ctgaaaagcc      1020
     agcgaggact aagattaagc cttcaaggat cagctggatc atcgatgggc acgatcatga      1080
     cgagagtcca gtttatacag atggtgcccc caagaaggaa acaaccaagg caccttggaa      1140
     caccacacaa ttggtcgaaa ttacaaccac aaaaatagat gcaaccgcta ccgaaagaac      1200
     gactgtggag agcactacag agaaaataag ctggattctg gatcactttg acaagcccca      1260
     agagatttta cgtacaaccg agggaccagg gcagcgaatc attagaaatg taaccaccac      1320
     atcggcatcc tccgagccaa tagttgacac ggaaaccact aacagtgatc acgtgcccac      1380
     cacggaaaac ggattggtat tcaatataac taccgatgga ccagtggaaa ctacgaaatc      1440
     caccgctcag cgaaaattgt cattcgattg gatactggac ggagaggaaa atgtagagcc      1500
     ggaagtcaag tccaccaaca ctacgacaac aactgcggcg accacgacga caggagcaac      1560
     ttcggaaacc atcattgtca ccacagagct gccaaaaata acttttgatt ggattattga      1620
     cggaagggaa gtggtagagc cgcaggaaac tactactgaa gtcactggga ccacggaaag      1680
     actgcgtaag atgccattcg attggattat tgacggggaa gaagttgtgg agccgcagga      1740
     gaatgtcacc accacaacca ttgcgacaac tgtggcagtc agcacaaccg aaatcaacga      1800
     gagaattcat aattccactg cctatcccac taagccgaag ccggtcaagt ttgactggat      1860
     catcgatgga ggagagtcca gtggtgaggt aagcactagc tccacaagcc aaccaaagtt      1920
     gactactagg gaggcgatca gcaatccaga atcaccacga tcctcacatc cgctggacaa      1980
     ccctaccagc atcgaaaaca tgctggaaag ctttgagcaa cacgaggagc agaaacccat      2040
     tctcagggtc ttaaacgcaa atgaatcctc ctcagaaacc gtgacggatg gctacgaacg      2100
     tcagttgtgg ctgaagaagt ttgaggatca ggcaaggcca aatcaaaacg aactcataga      2160
     tacttttgga accgctctag atgctaaagc cctagacaaa atgggaccca aaatcaatcc      2220
     acttaacgga cacacttgga atgctgccga cgcccaaatt cttagtcttt gcgaacgagt      2280
     ggctctgcgg atgcgcaaca aagttgccac catgtcagac ggtgagacga aggagaaggg      2340
     tgaaaccttc acggcttcac ccagtgtaca gtttaccagt cgagctcctg gcggatttcc      2400
     agtgtccggt gaaacaatga aggcctcagc acagtttatg tttaacccca acttcggaat      2460
     gcccagcatt cccgtttgct tctacatgac gcctgccaat ttccgtatgc ccatgtggtc      2520
     gaatacgccc acatttatgg gcatgcaggg tgcgcacttt ggaggatcat cgaaccctgg      2580
     cgcaggcata ttttttgtgc ctcagcagtt tggaccgagc ggaaacttct tcggcggaag      2640
     tggcggatcc ggagccggcg gccagggtgc caatatcttc tcgaagaacg cctcaccaca      2700
     gaaaccgaca aacggccagc agcaggtcta ctgcagctac atgcagaatc aatcgggtcg      2760
     gggagcagga caatcgcaga catctagtca gcagcagcag ggtggacagt cggcattctc      2820
     caatgccaac tttaagatgc gtcatgccaa tcagacaagc accgccaatc aacagggaca      2880
     aatcatctat gccagctatg caggattgcc acaacaaccc atccaggagc gatccagatg      2940
     cccagagccc gatcagtttt cctgcttcgg tcaacaggag tgcattcctg ccgcgagatg      3000
     gtgtgataat gtggtggatt gttcggatgg cagcgatgag tccgcctgca cctgtgcaga      3060
     tcgcgtggat gaagagcgtc tgtgcgatgg ttacgaagat tgccctatgg gcgaggacga      3120
     gctgggatgc tttggctgcg aatcgttggc ttactcctgc tatgaaaatc cacaggactt      3180
     tgccaaacgc aatcggtcta cgatttctat gtgctacagt cgactggagc gttgcgacgg      3240
     attcatgaac tgtttgaatg gacgcgatga ggagcagtgc agcatgttgg tcaccgatgt      3300
     ggcggatcat atgtcccacg gtgcatctgc ttctgaaggc tacctctacc acaattatcg      3360
     cggggattgg catcctgtgt gcaacaatgg tgaaaagtgg gcggctttag cctgtcagat      3420
     ggatgaaaac agtcggatgg atcactcagc ttcgttgaat gtcagtttcc aaaccctaac      3480
     tttacctggt ccttttattg agccatccct gcacgctgga gtccactttg ctcaggcgtg      3540
     ccatggacgc aatagccacg attccctagt agatcatgtg gcctatgtca agtgcccccc      3600
     gatgcagtgc ggcctgccct ctaaatcatc tatgctggaa cactcgaaga gagtaagaag      3660
     agcagtatcg gattcaaagg aaatcgttgg cgatggccga attgttggtg gaagtcatac      3720
     aagtgcactc caatggccat ttgtggttgc tatctataga aatggaaagt tccattgcgg      3780
     tggaaccatt tattctgatc gttggatcat cagcgctgcc cactgtgtca taaactatgg      3840
     aaagtacttc tatgaagtgc gtgctggtct cctgcgtcgc tctagctact cacccgccac      3900
     acagatccag cccgtctccc atgtggttgt ccaccaagcc tacgaaagaa gaagtatgcg      3960
     caacgatctc tctctgcttc gcctgctgaa tccgctgcag ttcaatcgat gggtgaaacc      4020
     tatttgctta cccgacaagg gaagaactac agtaggcgac gattggatct ggggccccgt      4080
     ggaacacact ctatgcacgg tggttggttg gggagccatc agagagaagg gtccaagcag      4140
     tgatcccatg cgccaggtta tcgtaccaat tcgtaagaaa tgcactgatc cagaagatca      4200
     ggcttcagaa gacatttgtg ctggcgatcc agatggaggt cgcgatgcct gccagggtga      4260
     ttcgggtggg cctctcttct gtcgcagcgt ctctaacgca gatgagttct atctggccgg      4320
     agtagtaagc catggcaatg gctgtgctcg tcctcaggag tttggagtct acacgagggt      4380
     cactctctac ctggactggt tggaaatggc tactactcca cgactgttgc ccaaacttca      4440
     gccgcttcaa ctgtgtccag gatttatctg cgtgtggggc ggtaagcggt gtatttctaa      4500
     acgacagcgc tgcgatcgca acgttgattg tttgggtggc gaggatgagg tgggatgcac      4560
     ctacaacttt ttaccagata tggtgggtgg cgttcgacag aatattagca ccacaactga      4620
     gagtgactat catccagtga aggagagcga ggaaaagagt aaaatgcggg aggttattcc      4680
     cattgacgat gaagatttaa aggctgaaca agacgaggaa gatttattga aaagcacaac      4740
     atctttaggg caaactgaaa caacacaggg cccaatggat ttatctttcg ctgaacaaat      4800
     tacttcaact acctcagatg atctatcaat aacagatgaa accacgagca cagattttac      4860
     agtgagtgat tcagccacta gcccttccac tcttttgcca acaacgacaa atccttcaac      4920
     ttggttgcca tccacaaata ttgaaacatc aacattttca tttactacaa ctgaatctga      4980
     agcttcaacc aaacaagaaa cattaccaac tactgttgcc caaactacga caatcccaac      5040
     ttcaactgaa gacctaaaga agctcacaga tttggtcact gaatttatgg agagtacgac      5100
     ttttgagacc acgatggaag tggagacgac tactttatct ctaacctcaa cagacgctcc      5160
     aatattagta acaacagagg gagtgaagga aacaacaacc acagaagaca caaccacaat      5220
     tagcagcatt gttactctta ccaccacgcc cttggccaca atctctacta ccattccaac      5280
     cactgaaaag catgtagctg taaccacatt agcaccaact actactacag agtccgccaa      5340
     gacgacaaca acgcatagta gcagcactca ttctgaaaag gatcaaatac aaattcctaa      5400
     taaatttgtg tgcaaaaaga tgtctcaaat tgtggatatt atgatgcgtt gtgataggaa      5460
     agtggattgc gaggatggaa ctgatgaact ggactgcaca tgcaaagatt atttgaaggg      5520
     atctctgaag ggactcattt gcgatggcaa ggcagattgc gaggacctca cggatgaaca      5580
     gaactgcgtg gaatgtcaat caaacgaatt ccgttgcccg ctgtctaaaa cttgtttgcc      5640
     attaagcaaa cgttgcgata ataaagtgga ttgcaagttc aaggaagatg aaaaggattg      5700
     ctttgctttg accaatggcc acgatgtgca ctttgatgtg catcagcagc caaagttcag      5760
     cagtaccgga atcttctcca gaaacggcca tggcgtgtgg cgggtagtct gtgctcatga      5820
     gactggctat cacgagcacc aggccaaaac agcaaatgcg gtttgtgctc tccttggttt      5880
     caatggagct cactacttca atagctccga gtttgtgacc cagcaggaaa agcaacccat      5940
     cacaccggag ttaaaaggag gcagaaaccg catggcagca caaattcatt ctatggtcgg      6000
     tgacaatgtc caatttactg agaacgaggt cataatacca gaactgggac acccatccgc      6060
     ttcaagacca gagaaggatc gtctgttgcc ccgcaagtgt gtcggcatct acgtggagtg      6120
     caatccgtac tccaacaaaa ccacacccct aaaaacattc agtgctgggc aagttgtcaa      6180
     ggaaaagcca attgaacagg ttcctgtcct atcgcccacc atcgagacgc acaacactcc      6240
     caatgtgcat tttaagccgc aaattccggc gatggttgta aataaaaaag atgaaatttt      6300
     ggatcgtctg gacaaactca tcaagagtaa gaaaaacaaa accatactgg ttaatgagca      6360
     gctccatgaa gccattgagg agctgcactg gccctggctg gcagatgtct atatgaatgg      6420
     cgatctctgg tgcatcggag tgctgattga caagcattgg gtaatggtcc acgagagctg      6480
     cctgtctggc attgacttgg agactcacta cgtcagcgtt ttgctgggcg ggggcaaaac      6540
     aaagcgatcg gcccacagga gcaatcacga acagattcgg cgtgtggact gctttgaggg      6600
     agtgccaaag tccaatgtgt tacttttgca tctggagcgc cctgtgcggt tcacccacca      6660
     tgtgttgcct accttcctgc ctgacagttc ccatcaaaat caaagcaatg cgaggcagtg      6720
     catcagtgtg cttcatgacg atgccacagg acgcatcaaa accgtagcca ttacccgtat      6780
     acacaatgct accaattgcg attcctgcta caagctgcag gaaaagcaac caccggctaa      6840
     tctgatgcgc ctgttaaatg tgagtgccga ggatatggct tccatttcgg aggaggtgga      6900
     actcattaat ggtgttgctc ccacggagct accggccatt accaaattca ccacctgcaa      6960
     ccaatttggg ctgaaaaatg tgagcgatgc acatcacaat cccagcgatc agggtgtatt      7020
     ggtctgtcgg gactcgcaca caggctggtt cccaacggcc ttgtttaact ataacaattc      7080
     ggactgccaa agttttaaac agccatttgg tattagaacg ttagaactgg tatacaaatc      7140
     gctgcaggat atcatagaca aaccgagctg caaaatgctc ctaccagccc cggattgctc      7200
     cacccatcgt tgcccgctgg gtacctgttt gccgcaggct gcgatgtgca acggccgctc      7260
     cgattgtcat gatggcagcg atgaggagga aaccaaatgc cgacagcaaa agcagcaatg      7320
     tgcccctggc gagatgaagt gccggaccag cttcaaatgc gtgccgaaaa gcaagttttg      7380
     tgaccacgta cctgactgcg aggacatgac ggatgagccg accatctgca gttgtttcac      7440
     atatctgcaa gccactgatc cgtcaaagat atgcgatggc aagcgaaact gctgggacaa      7500
     gagcgacgag agttcagtac tgtgcaattg cacagcggat cacttccagt gcagttcctc      7560
     ccctgaagat tgcattcctc gtgattttgt gtgcgacaaa gagaaggatt gtcccaatgg      7620
     agaagatgag cggtattgct ttggcataga gcacccattg catctgcaga agaaggattt      7680
     ctggaccaat agtcagcaca cgcaaccgga aatagctcca caatacggtc aagttatcga      7740
     acagacctat ggcatctggc atacaaaatg cttcccgaaa agtaaacccc cgcaagtgga      7800
     tgaagtgcgt gaaatatgca aaaagttggg ctacaatcca tatagacagc ctagttatcg      7860
     attgattgac gacgaggaga acaaacccgt gcacacctac gagttggcgg ataggcaagg      7920
     tcgaagtttc agcaatgagt cgctgatggg caagtatcgc gactcaacaa aggcgttaat      7980
     catcagcaaa ttctcgcctc ttcaactgaa tgagcgcctt acattgttcc tcaagtccag      8040
     cagaccaatt gccgagctgg ttagatggaa tgccaccgat tccagcatgt gctacagact      8100
     ggagatcaga tgtgcctaaa aacctaaaag atgacaacat ttacttggta agaggttctt      8160
     tcgtactctc gtgatagtcc ttttgtgcgt tttagtagca aataaatgcg agagctgtac      8220
     acattttatt                                                             8230
//


spacer
spacer