spacer

EBI Dbfetch

ID   M28989; SV 1; linear; genomic DNA; STD; PRO; 841 BP.
XX
AC   M28989;
XX
DT   02-FEB-1990 (Rel. 22, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 9)
XX
DE   Escherichia coli succinate dehydrogenase (sdhC and sdhD) genes, complete
DE   cds and 5' region.
XX
KW   sdhC gene; sdhCDAB operon; sdhD gene; succinate dehydrogenase.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-841
RX   PUBMED; 3309132.
RA   Wilde R.J., Guest J.R.;
RT   "Transcript analysis of the citrate synthase and succinate dehydrogenase
RT   genes of Escherichia coli K12";
RL   J. Gen. Microbiol. 132(12):3239-3251(1986).
XX
DR   MD5; cde11540dfd7255df68243f96920b285.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..841
FT                   /organism="Escherichia coli"
FT                   /strain="K-12"
FT                   /sub_strain="ED8641"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="plasmid pGS91"
FT                   /db_xref="taxon:562"
FT   -10_signal      45..50
FT   -35_signal      69..74
FT   protein_bind    129..150
FT                   /bound_moiety="cyclic AMP receptor protein (CRP2)"
FT   -35_signal      185..190
FT   -10_signal      208..213
FT   -10_signal      208..661
FT   prim_transcript 222..>841
FT                   /gene="sdhC"
FT   RBS             428..433
FT                   /gene="sdhC"
FT   CDS             441..830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="GOA:P69054"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR014361"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="PDB:1NEK"
FT                   /db_xref="PDB:1NEN"
FT                   /db_xref="PDB:2ACZ"
FT                   /db_xref="PDB:2AD0"
FT                   /db_xref="PDB:2WDQ"
FT                   /db_xref="PDB:2WDR"
FT                   /db_xref="PDB:2WDV"
FT                   /db_xref="PDB:2WP9"
FT                   /db_xref="PDB:2WS3"
FT                   /db_xref="PDB:2WU2"
FT                   /db_xref="PDB:2WU5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69054"
FT                   /protein_id="AAA24616.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILL
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVLSLLAGVLVW"
FT   -35_signal      634..639
FT                   /gene="sdhC"
FT   protein_bind    644..665
FT                   /gene="sdhC"
FT                   /bound_moiety="cyclic AMP receptor protein (CRP5)"
FT   prim_transcript 668..>841
FT                   /gene="sdhD"
FT   CDS             824..>841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /product="succinate dehydrogenase"
FT                   /protein_id="AAA24617.1"
FT                   /translation="MVSNAS"
XX
SQ   Sequence 841 BP; 215 A; 199 C; 188 G; 239 T; 0 other;
     ataagttaat cttaggtgaa ataccgactt cataactttt acgcattata tgcttttcct        60
     ggtaatgttt gtaacaactt tgttgaatga ttgtcaaatt agatgattaa aaattaaata       120
     aatgttgtta tcgtgacctg gatcactgtt caggataaaa cccgacaaac tatatgtagg       180
     ttaattgtaa tgattttgtg aacagcctat actgccgcca gtctccggaa caccctgcaa       240
     tcccgagcca cccagcgttg taacgtgtcg ttttcgcatc tggaagcagt gttttgcatg       300
     acgcgcagtt atagaaagga cgctgtctga cccgcaagca gaccggagga aggaaatccc       360
     gacgtctcca ggtaacagaa agttaacctc tgtgcccgta gtccccaggg aataataaga       420
     acagcatgtg ggcgttattc atgataagaa atgtgaaaaa acaaagacct gttaatctgg       480
     acctacagac catccggttc cccatcacgg cgatagcgtc cattctccat cgcgtttccg       540
     gtgtgatcac ctttgttgca gtgggcatcc tgctgtggct tctgggtacc agcctctctt       600
     cccctgaagg tttcgagcaa gcttccgcga ttatgggcag cttcttcgtc aaatttatca       660
     tgtggggcat ccttaccgct ctggcgtatc acgtcgtcgt aggtattcgc cacatgatga       720
     tggattttgg ctatctggaa gaaacattcg aagcgggtaa acgctccgcc aaaatctcct       780
     ttgttattac tgtcgtgctt tcacttctcg caggagtcct cgtatggtaa gcaacgcctc       840
     c                                                                       841
//


spacer
spacer