spacer

EBI Dbfetch

ID   CR956413; SV 12; linear; genomic DNA; STD; MAM; 73061 BP.
XX
AC   CR956413;
XX
DT   01-JUN-2005 (Rel. 84, Created)
DT   17-MAY-2007 (Rel. 91, Last updated, Version 17)
XX
DE   Pig DNA sequence from clone CH242-178F16 on chromosome 17
XX
KW   HTG.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-73061
RA   Wright D.;
RT   ;
RL   Submitted (17-MAY-2007) to the INSDC.
RL   Wellcome Trust Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK.
RL   E-mail enquiries: vega@sanger.ac.uk Clone requests:
RL   clonerequest@sanger.ac.uk
XX
DR   MD5; ec5b83bdb5f8fc2e875859ea1bbc9843.
DR   ENA-CON; GL043841.
DR   ENA-CON; JH118031.
DR   ENA-CON; GL882245.
DR   Ensembl-Gn; ENSSSCG00000007520; sus_scrofa.
DR   Ensembl-Scaffolds; CR956413.12:1-73061; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000008239; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000032810; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000033038; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000033259; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000034043; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000034146; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000034162; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000035218; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000035265; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000035487; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000035506; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000035597; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000036218; sus_scrofa.
DR   RFAM; RF00733; mir-296.
DR   RFAM; RF02127; GNAS-AS1_1.
DR   RFAM; RF02128; GNAS-AS1_2.
DR   RFAM; RF02129; GNAS-AS1_3.
DR   RFAM; RF02130; GNAS-AS1_4.
DR   RFAM; RF02131; GNAS-AS1_5.
XX
CC   -------------- Genome Center
CC   Center: Wellcome Trust Sanger Institute
CC   Center code: SC
CC   Web site: http://www.sanger.ac.uk
CC   Contact: vega@sanger.ac.uk
CC   --------------
CC   
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats;
CC   all regions were covered by at least one subclone; and the assembly was
CC   confirmed by restriction digest, except on the rare occasion of the clone
CC   being a YAC.
CC   
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases:
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP;
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
CC   
CC   CH242-178F16 is from a CHORI-242 Porcine BAC Library
CC   VECTOR: pTARBAC1.3_BamHI
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..73061
FT                   /organism="Sus scrofa"
FT                   /chromosome="17"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="CHORI-242"
FT                   /clone="CH242-178F16"
FT                   /db_xref="taxon:9823"
FT   misc_feature    2000
FT                   /note="Clone_right_end: CH242-240K6"
FT   mRNA            join(19557..20737,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-003"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:AF105253.1 Em:AF107844.1
FT                   Em:BC036081.1"
FT   CDS             19943..20695
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-003"
FT                   /standard_name="OTTSUSP00000000942"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Tr:O18979 Tr:O95417 Tr:O95467
FT                   Tr:Q792G6 Tr:Q9QXW5 Tr:Q9Z0F1 Tr:Q9Z0H2"
FT                   /db_xref="InterPro:IPR009434"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFT7"
FT                   /protein_id="CAN13147.1"
FT                   /translation="MDRRSRAQQGRRARHTYSDLCPPIGRRAATALLWLSCSIALLRAL
FT                   ATSSARAQQRAAAQRRSFLNAHHRSAAPVFPQPPESDQEQEEADLELSLPECLEYEEEF
FT                   DYESETETESEIESETDSETEPETAPTTEPETEPETEPEDERGPVLPKRPSFAQSLTER
FT                   LNALRLQSPDASPSRAQPSTQESESPREGEEPKPEPEDKDPRGPEESEEPKAEEKKQQR
FT                   RCKPKKPTRRDPSPESPSKRGPIPIRRH"
FT   misc_feature    22803..22804
FT                   /note="number of bases in mononucleotide run unsure."
FT   mRNA            join(32911..34885,35106..36686)
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-022"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:AK030489.1 Em:AY519503.1"
FT   mRNA            join(32911..34885,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-017"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:AK132636.1 Em:AY519501.1
FT                   Em:X84047.1"
FT   mRNA            join(32911..34885,35106..35225,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-020"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:AY519504.1"
FT   CDS             join(32914..34885,35106..35995)
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-022"
FT                   /standard_name="OTTSUSP00000000981"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Tr:Q6R0H5.1"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFT8"
FT                   /protein_id="CAN13148.1"
FT                   /translation="MGVRNCLDGNNMSGQRNSPPEHGEQPEQPPLEAPGAAASGAGTGT
FT                   AEEMETEPPHSEPIPIKTEGEASGPPEVSRPNLQSLGQAIKEAGAGDHGDYSPPPEEAM
FT                   PFEVEQSGLGGFWPAQEHPGDTPGAGAGLETSSPAIMEPRAFRETIPSLGSYSPPPEEA
FT                   MPFEFEQPAQGGSSQPLLQVSDLAPGGPGAGVFRAPPQEPRALRPANAGFRRGCSPPPE
FT                   EDMPCEFDGAAFGDDSPPPGLPRALPQIDGSGDSQIAPVAVPSEVLLAPAANEPPLWIP
FT                   GSGGSPSREAVRPPPHFAGDSPPMEISGPQREAGIAPDGVDDAPVNVDSPPVAPDSPPI
FT                   EVSGAPVKREPAEGERPPAEGEEADMEGGSASAAAEGSKVPDPGDGAPAAGAAPASPAA
FT                   GAAPSVPASPAAGAAPEAPAEGAAPATPDSPASGAAPAAPDAPAAGAAPAAPAAPAARA
FT                   APAVPAARAASAAPAARAAPAARAASASRAVPDYGARPKIGFLRPPSPEIQAADPPTPQ
FT                   PPRAYAWRGRSERCCERYDDEISVSSDSGDESDDGTFGCRRWFLSRRNRRRRKPRRNLL
FT                   RNFLVQAFGGCFCGSESPQSGGSVGPKVKKVPLAEKRRQTRKESIEKRAQKRAEKRRSK
FT                   LIEKQLQNEKMGYMCTHRLLLLGGKVVPYNTEGRFQLDKPGPAIVRRRRVVGWGTARKA
FT                   GDSGEPGTGGEGCGVAQARLAGAVVVGWGRWGRRVPASPGTAAWTQTACCWCVSVSILC
FT                   PPVHDMLKCSPVPIPGTPITRRLCICTGEWAVLCCAPLRGRKLCVFATLRGYLCAGALQ
FT                   RQRENCGEGSGRCWGHWPGGGRGPPPAGLHNLFSVCLSLSLFFPLALSVSSLLIRSPNP
FT                   PAFSVEKPDTQVSGASGAVRINSVFCTHLAHLGGVEDGGRRRKKTTTHLTCCRQVWIPN
FT                   HAGPLPGAGWAWLWLKNMKSFLS"
FT   CDS             join(32914..34885,35106..35225,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155805..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-020"
FT                   /standard_name="OTTSUSP00000000953"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Tr:Q6R0H4"
FT                   /db_xref="GOA:A5GFT9"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFT9"
FT                   /protein_id="CAN13149.1"
FT                   /translation="MGVRNCLDGNNMSGQRNSPPEHGEQPEQPPLEAPGAAASGAGTGT
FT                   AEEMETEPPHSEPIPIKTEGEASGPPEVSRPNLQSLGQAIKEAGAGDHGDYSPPPEEAM
FT                   PFEVEQSGLGGFWPAQEHPGDTPGAGAGLETSSPAIMEPRAFRETIPSLGSYSPPPEEA
FT                   MPFEFEQPAQGGSSQPLLQVSDLAPGGPGAGVFRAPPQEPRALRPANAGFRRGCSPPPE
FT                   EDMPCEFDGAAFGDDSPPPGLPRALPQIDGSGDSQIAPVAVPSEVLLAPAANEPPLWIP
FT                   GSGGSPSREAVRPPPHFAGDSPPMEISGPQREAGIAPDGVDDAPVNVDSPPVAPDSPPI
FT                   EVSGAPVKREPAEGERPPAEGEEADMEGGSASAAAEGSKVPDPGDGAPAAGAAPASPAA
FT                   GAAPSVPASPAAGAAPEAPAEGAAPATPDSPASGAAPAAPDAPAAGAAPAAPAAPAARA
FT                   APAVPAARAASAAPAARAAPAARAASASRAVPDYGARPKIGFLRPPSPEIQAADPPTPQ
FT                   PPRAYAWRGRSERCCERYDDEISVSSDSGDESDDGTFGCRRWFLSRRNRRRRKPRRNLL
FT                   RNFLVQAFGGCFCGSESPQSGGSVGPKVKKVPLAEKRRQTRKESIEKRAQKRAEKRRSK
FT                   LIEKQLQNEKMGYMCTHRLLLLGGKVVPYNTEGRFQLDKPGPAIVRRRRVVGWGTARKA
FT                   GDSGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEA
FT                   IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRA
FT                   CYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFH
FT                   MFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNN
FT                   RWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAK
FT                   YFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL"
FT   CDS             join(32914..34885,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155805..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-017"
FT                   /standard_name="OTTSUSP00000000950"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Tr:Q6R0H7"
FT                   /db_xref="GOA:A5GFU0"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU0"
FT                   /protein_id="CAN13150.1"
FT                   /translation="MGVRNCLDGNNMSGQRNSPPEHGEQPEQPPLEAPGAAASGAGTGT
FT                   AEEMETEPPHSEPIPIKTEGEASGPPEVSRPNLQSLGQAIKEAGAGDHGDYSPPPEEAM
FT                   PFEVEQSGLGGFWPAQEHPGDTPGAGAGLETSSPAIMEPRAFRETIPSLGSYSPPPEEA
FT                   MPFEFEQPAQGGSSQPLLQVSDLAPGGPGAGVFRAPPQEPRALRPANAGFRRGCSPPPE
FT                   EDMPCEFDGAAFGDDSPPPGLPRALPQIDGSGDSQIAPVAVPSEVLLAPAANEPPLWIP
FT                   GSGGSPSREAVRPPPHFAGDSPPMEISGPQREAGIAPDGVDDAPVNVDSPPVAPDSPPI
FT                   EVSGAPVKREPAEGERPPAEGEEADMEGGSASAAAEGSKVPDPGDGAPAAGAAPASPAA
FT                   GAAPSVPASPAAGAAPEAPAEGAAPATPDSPASGAAPAAPDAPAAGAAPAAPAAPAARA
FT                   APAVPAARAASAAPAARAAPAARAASASRAVPDYGARPKIGFLRPPSPEIQAADPPTPQ
FT                   PPRAYAWRGRSERCCERYDDEISVSSDSGDESDDGTFGCRRWFLSRRNRRRRKPRRNLL
FT                   RNFLVQAFGGCFCGSESPQSGGSVGPKVKKVPLAEKRRQTRKESIEKRAQKRAEKRRSK
FT                   LIEKQLQNEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSN
FT                   SDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDF
FT                   PPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCR
FT                   VLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIRED
FT                   NQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYT
FT                   TPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFND
FT                   CRDIIQRMHLRQYELL"
FT   mRNA            33191..34885
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-021"
FT                   /product="GNAS complex locus"
FT   CDS             33191..34885
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-021"
FT                   /standard_name="OTTSUSP00000000980"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Tr:Q6R0H6.1 Tr:Q8BIR3.1 Tr:Q924W1.1
FT                   Tr:Q9Z213.1"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU1"
FT                   /protein_id="CAN13151.1"
FT                   /translation="METTVHPLRKPCPSRSSSPAWGASGLPRSTLETPLGPVQALRPPA
FT                   QRSWSPEPSGRPYQAWEATALRQKKLCPLSLSSLPREAAANLSCRSQTLLQEAQVRGSL
FT                   ELLPRSPELSDLQTQASEEAAALPLRRICHVSLMEQPLGTTAHLLGSPELSHKSTAVAT
FT                   ARSRRSRSRVRSSSLPPRTSPPSGSQAAAAAHLERLSDLLHTSQATAPQWRSPDPSAKL
FT                   ASPPMGSTTLPSTWTAPQSRLTARPSRSPEPPLRESRRRERDPQPREKKPTWKEDQPPL
FT                   PQREAKSPIPGMEPRLPGQPLPLQPPGQPLPSLPLQPQEQPLRLQPKGQPRPPLIVQPL
FT                   GQPLPPRMLLPPGQRQPPQPLLPPEQPQLFLPPGQPQPLLPPGQPQPPGPLLPPGPSLT
FT                   TEPDPRSVSLDPPAPRSRLPTRLLRSLLARMPGGAGLSAAANATTMKSRSAATAETNPT
FT                   MGPSDVAAGSCPGETAAAESPGATCSATSSSRLSEAASADLRAPSPEAQSAPRSRRFPW
FT                   RRSADKHARKASRSAPRSARRRDAASSSRSNSRTRRWATCVRTACCF"
FT   CDS             join(<33991..34885,72212..72284,
FT                   complement(CR956646.4:162730..162787),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155805..155951))
FT                   /codon_start=1
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-018"
FT                   /standard_name="OTTSUSP00000000951"
FT                   /product="GNAS complex locus"
FT                   /db_xref="GOA:A5GFU2"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU2"
FT                   /protein_id="CAN13152.1"
FT                   /translation="EGEEADMEGGSASAAAEGSKVPDPGDGAPAAGAAPASPAAGAAPS
FT                   VPASPAAGAAPEAPAEGAAPATPDSPASGAAPAAPDAPAAGAAPAAPAAPAARAAPAVP
FT                   AARAASAAPAARAAPAARAASASRAVPDYGARPKIGFLRPPSPEIQAADPPTPQPPRAY
FT                   AWRGRSERCCERYDDEISVSSDSGDESDDGTFGCRRWFLSRRNRRRRKPRRNLLRNFLV
FT                   QAFGGCFCGSESPQSGGSVGPKVKKVPLAEKRRQTRKESIEKRAQKRAEKRRSKLIEKQ
FT                   LQNEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEA
FT                   IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRA
FT                   CYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFH
FT                   MFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNN
FT                   RWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAK
FT                   YFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL"
FT   mRNA            join(<33991..34885,72212..72284,
FT                   complement(CR956646.4:162730..162787),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-018"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:AF116268.1"
FT   mRNA            join(33991..34885,35106..35225,35713..35779,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:165455..165980))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-019"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:AJ224867.1"
FT   CDS             join(<34450..34885,72212..72284,
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:<156608..156668))
FT                   /codon_start=1
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-016"
FT                   /standard_name="OTTSUSP00000000949"
FT                   /product="GNAS complex locus"
FT                   /db_xref="GOA:A5GFU3"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU3"
FT                   /protein_id="CAN13153.1"
FT                   /translation="PPTPQPPRAYAWRGRSERCCERYDDEISVSSDSGDESDDGTFGCR
FT                   RWFLSRRNRRRRKPRRNLLRNFLVQAFGGCFCGSESPQSGGSVGPKVKKVPLAEKRRQT
FT                   RKESIEKRAQKRAEKRRSKLIEKQLQNEKMGYMCTHRLLLLGAGESGKSTIVKQMRILH
FT                   VNGFNGDEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVP
FT                   DFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDL
FT                   LRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMV
FT                   IREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK"
FT   mRNA            join(<34450..34885,72212..72284,
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:<156608..156668))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-016"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:BW985201.1"
FT                   /note="match: cDNAs: Em:AF124384.1 Em:AF125259.1"
FT   mRNA            join(64228..64310,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156866..156941))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-007"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:CJ028883.1"
FT   mRNA            join(65722..65985,72212..72290,
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-005"
FT                   /product="GNAS complex locus"
FT                   /note="match: cDNAs: Em:CR590357.1"
FT   mRNA            join(65790..65985,72212..72285,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-004"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:BP464246.1 Em:CJ017689.1
FT                   Em:CJ035650.1"
FT                   /note="match: cDNAs: Em:CR593409.1 Em:CR604909.1
FT                   Em:CR606529.1 Em:CR611320.1 Em:CR621928.1 Em:X56009.1"
FT   mRNA            join(65791..65985,66162..66186,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-009"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:CB312907.1 Em:CB706994.1"
FT   mRNA            join(65797..65985,72212..72284,
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156846..156941))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-006"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:AU296649.2 Em:BP464671.1
FT                   Em:CJ032951.1 Em:CJ034525.1"
FT   mRNA            join(65863..66186,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:165455..165980))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-008"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:CO879670.1"
FT   misc_feature    67666..68230
FT                   /note="Single clone region. Sequence generated from a
FT                   transposon library derived from a single pUC clone."
FT   mRNA            join(68000..68526,72212..72284,
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-002"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:AJ665290.1 Em:BP157020.1
FT                   Em:BP160341.1 Em:DV224164.1"
FT                   /note="match: cDNAs: Em:BC034446.1 Em:BC089157.1
FT                   Em:CR600603.1"
FT   mRNA            join(68085..68526,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-001"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:AJ660151.1 Em:AJ951860.1
FT                   Em:BP158766.1 Em:BP171148.1 Em:BP171149.1 Em:BP172090.1
FT                   Em:BP436832.1 Em:BP464490.1 Em:BP464491.1 Em:BW965858.1
FT                   Em:BW976704.1 Em:BW977138.1 Em:BW979119.1 Em:BW983413.1
FT                   Em:BX666295.1 Em:CJ019890.1 Em:CJ024113.1 Em:DN351306.1"
FT                   /note="match: cDNAs: Em:AF487552.1 Em:BC080816.1
FT                   Em:BC102905.1 Em:CR615348.1 Em:CR620225.1 Em:Z12168.1"
FT   mRNA            join(68085..68526,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162787),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155413..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-012"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:CF111191.1"
FT   mRNA            join(68093..68526,72212..72284,
FT                   complement(CR956646.4:162730..162787),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156551..156668),
FT                   complement(CR956646.4:<155913..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-011"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:AJ681231.1 Em:BP143589.1
FT                   Em:BP459083.1 Em:BW976887.1 Em:BW980319.1 Em:CJ002444.1
FT                   Em:CJ003363.1 Em:CJ019315.1 Em:DT831734.1"
FT                   /note="match: cDNAs: Em:AF184151.1"
FT   mRNA            join(68148..68526,72212..72284,
FT                   complement(CR956646.4:165455..165980))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-010"
FT                   /product="GNAS complex locus"
FT                   /note="match: ESTs: Em:BM659521.1 Em:CN157332.1
FT                   Em:CN159280.1 Em:DN111794.1 Em:DN112153.1"
FT   CDS             join(68388..68526,72212..72284,
FT                   complement(CR956646.4:162730..162787),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156551..156668),
FT                   complement(CR956646.4:<155913..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-011"
FT                   /standard_name="OTTSUSP00000000947"
FT                   /product="GNAS complex locus"
FT                   /db_xref="GOA:A5GFU4"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU4"
FT                   /protein_id="CAN13154.1"
FT                   /translation="MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLL
FT                   LGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVE
FT                   LANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQY
FT                   FLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQ
FT                   CFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQD
FT                   LLAEKVLAGKSKIEDYFPEFARYTRISTASGDGRHYC"
FT   CDS             join(68388..68526,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155805..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-001"
FT                   /standard_name="OTTSUSP00000000779"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Sw:P04896 Sw:P63091 Sw:P63092
FT                   Sw:P63094 Tr:Q3TWS9"
FT                   /db_xref="GOA:A5GFU5"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU5"
FT                   /protein_id="CAN13155.1"
FT                   /translation="MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLL
FT                   LGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIE
FT                   TIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACY
FT                   ERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMF
FT                   DVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRW
FT                   LRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYF
FT                   IRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL"
FT   CDS             join(68388..68526,72212..72284,
FT                   complement(CR956646.4:162730..162784),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155805..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-002"
FT                   /standard_name="OTTSUSP00000000780"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Sw:P24799 Tr:Q6NVN4 Tr:Q6P413"
FT                   /db_xref="GOA:A5GFU6"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU6"
FT                   /protein_id="CAN13156.1"
FT                   /translation="MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLL
FT                   LGAGESGKSTIVKQMRILHVNGFNGDEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
FT                   ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYF
FT                   LDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQC
FT                   FNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDL
FT                   LAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDG
FT                   RHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL"
FT   CDS             join(68388..68526,72212..72284,
FT                   complement(CR956646.4:166933..166977),
FT                   complement(CR956646.4:162730..162787),
FT                   complement(CR956646.4:162524..162643),
FT                   complement(CR956646.4:160404..160501),
FT                   complement(CR956646.4:157439..157493),
FT                   complement(CR956646.4:157230..157303),
FT                   complement(CR956646.4:157053..157111),
FT                   complement(CR956646.4:156821..156941),
FT                   complement(CR956646.4:156538..156668),
FT                   complement(CR956646.4:156232..156299),
FT                   complement(CR956646.4:155805..155951))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-012"
FT                   /standard_name="OTTSUSP00000000948"
FT                   /product="GNAS complex locus"
FT                   /note="match: proteins: Sw:P63092"
FT                   /db_xref="GOA:A5GFU7"
FT                   /db_xref="InterPro:IPR000367"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU7"
FT                   /protein_id="CAN13157.1"
FT                   /translation="MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLL
FT                   LGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAI
FT                   ETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRAC
FT                   YERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHM
FT                   FDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNR
FT                   WLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKY
FT                   FIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL"
FT   CDS             join(68388..68526,72212..72284,
FT                   complement(CR956646.4:165965..165980))
FT                   /gene="GNAS"
FT                   /locus_tag="CH242-247L10.1-010"
FT                   /standard_name="OTTSUSP00000000982"
FT                   /product="GNAS complex locus"
FT                   /db_xref="GOA:A5GFU8"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GFU8"
FT                   /protein_id="CAN13158.1"
FT                   /translation="MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLL
FT                   LGAGESGKSTIVKQMRILHVNGFNGEIYSP"
FT   misc_feature    68602..68675
FT                   /note="Single clone region"
FT   misc_feature    68752..68866
FT                   /note="Single clone region. Sequence generated from a
FT                   transposon library derived from a single pUC clone."
FT   misc_feature    71062
FT                   /note="Clone_left_end: CH242-247L10"
XX
SQ   Sequence 73061 BP; 15610 A; 20902 C; 20205 G; 16344 T; 0 other;
     ggtaattcat cactgccaat aagccaatat cgatacatta ttgttaactg agctccaggg        60
     gttaatctgg tctcactagt tgttttttta tttctttttt tctttttagg gctgcacccg       120
     tggcacatgg aggttcccag gctaggggtc tgatcagagc tgtcacagca acatgggatc       180
     tgagccatgt ctgcgaccta taccccagct catggcaacg cccggctcct taacccactg       240
     agcgaggcca gggatcgaac cctccctcat cctcgtggat actcgtcggg tttgtttccg       300
     ctgccccacg aggggaactc catctcactt gtgttcgagg acctttctgg ggagtgctag       360
     caggtgttct gcagggtgcc cctggcgtct gggtcacggg cacggaggaa gcccagcaca       420
     tgcgggcccc ctcactgcgt ccgttcaggt ccaagctctc agcacgaccg ggcagtcgtg       480
     gttcggggcc atgacctcta ttctccgcct ttccaccctt gaccctggga gcaggtcccc       540
     acgtgctgcc gacgtcaggg tgtggaagtt acagtcctgc cttgagggag catctgtggg       600
     aggctttgta gctcctgact tcagtggctc atggatgttt attctaaatg tggggttatg       660
     atcccctatt tcctgggtag tcatattgtg gggctccagg ctcatcccac agacctcgtc       720
     ccagcccagg aataagctct ttttgcaagg aacctggttc cttttatcgg gaaatggtgt       780
     taggaaccaa aatctgagtg tggggtgtgc ttatcacgac ggggtgtcat tgcttctcag       840
     agctgtggcg agagccagga aacacataca ctagccactg tacataaact gctccaggac       900
     cccccgtcag gtgtgacgtt aagctaaaca ccctcaattc caggaccctg gaagggcagt       960
     ctctttacag ctcagctgcc ctggggcatt agagtccggg tcaggttcaa acggggtaac      1020
     aggagatgtg ctgaattttt cttttcttcc tgccaagcag gtgaaggtaa aatttatgta      1080
     agctaatagt gcctcaggag ttctcagccg gggtgaactg cccttgggaa gacactgggc      1140
     agcacctgga gacaattttg ggggtgacaa ctggtggcat ctcatggtgg gggggcagag      1200
     atgctgctca acaccctgca gtgcccaaga cggccccacg gcagagaatg gtccagcccc      1260
     aaatgtcagc attgctaaag atggagaagc ctcaggcaca agatacaaag gggagggaac      1320
     acttgagggg gcccccactt aaaatcctga cacttttaaa aattctcata aaggtgctta      1380
     atagaaggga tgcattacat tctcatcata ttctaatcct ttatttaaaa aaatccaaac      1440
     tatagctgat ttatagtatt gtgttggtct cacacgttca gcttcagatt cttttccatt      1500
     acaggctatt acaaagtgtt gagtacagtt ccctgtgcta tgcagcagct ccttgttgtg      1560
     tatctatttt gtgcgtagcg gcaggtagct gtcaatccca tgctccccat tcctcccccg      1620
     ccccccccag gtaaccctac attttctcct atgcctagga gtccatttgt tttgtaaata      1680
     aattcatttg catttttttt tttttaagat tccacataga ggtgacagta tatatttatc      1740
     ttcatctggc ttacttggta taatctctag atccatccat cttgctgcaa atggcattat      1800
     gtattttttt ttttttttgg ctgagttata tggtgctgtg tgtatgtacc acatctttat      1860
     ccattcacct gttgatggac atttagcttg attctatgtc ttggctgttg tgaatagtgc      1920
     tgcagtgaac attatgtgcc tgtatctttt taaattgtgg ttttgtccag atatacgcct      1980
     agggccggaa ttgctggatc ctatggtcgt cctacatcta gttttctggg gaatctccat      2040
     actgtcttcc gtcgtggttg taccaactta cattcccccc aacagaggag gagggttccc      2100
     ttttctccac atcctctcca gcagttacta tttatagact tttggtgacg gccggtgtga      2160
     ggtgaaacct cactgtggac ttgacctgca tgtcgctgat cattagagac acgagacgcc      2220
     ttcgcacgtg cctgcggcct ctctgcgtca ttgtcttctc tggagaatgt ctacttaggt      2280
     cttccgccca cgttttgatg gggttgtttg tttttacgat cctgagttgt gtgggcagac      2340
     tgtagatttt ggaaattaag cccgtgtcag ccacatggtt tgcaactaca ttctactttg      2400
     tagatggtct ttccgccttg ttcatgcata atgcgttttg tctccctctc ccacttcact      2460
     ttcctacaga atttatattt ccaatatact acgtaatacc agtttctttt tccgtttttt      2520
     ctttttaggg ctgaacctgt ggcgtatgga agtccccagg ctagagggtg gatgggagct      2580
     gcagctgctg ccctacacca cagccacagg atccgtaacc cactgagcaa ggccagggat      2640
     ggaacccgcg tcctcatgga caccagtcag gcttcttccc gctaagccca cgtaatcctg      2700
     ttcctcgttg aggcttcctc ttcccaccag agcatagtct gcgtggaagg gtgctggcct      2760
     cgctcgtgca ctgaggcagc ccagccgagc atgggccttg tgcccgctgg tggggcgggg      2820
     gaggggaagc ttcgagaagg aaagtcggcc tttgtgagga tggtggcagt ttccctggga      2880
     cccaaggggc ggctacaggt gggaatgggt ggcaggtgta ttacaggaca gaggccaggg      2940
     ctgcagccag tgtgcagctg tgagatgtgg gctgaaagga gaaaagcctt ggagcaggcg      3000
     atctcgggtg ttggggagca cttggaagag aaggcaggga tgggggcggc agggccgagg      3060
     acccgtctct cacacggttc cagtcgagga ctggtttccc cagctgcggg catggcctgg      3120
     gagccacagc ctcatctgca gtccctctct tggcctttct cagggccctt ggccagcctg      3180
     tgctgctccc ctggagcctt ttctgctctg ggggcaccca ggcctggctg gcacaactcc      3240
     tggggccggc agaggggctc ccccccccgc gccacacaca caaagccacc ctgtgggtgt      3300
     gagagggcgg cgggtcctcc ggccagggat gccgcaccaa ctacacgtcc ttgctgtgat      3360
     gggggccggc gccggtctct ccgagggacc ccaagtgaag aactcacttg cgctaatggc      3420
     caggagtccc acccctgcct ctactcagca ccttctgggg acaccccctg cctgtgccca      3480
     gggcgccccg agaatcgtca ggacgccacc ccgcatgtca acatgcctct cccttggctg      3540
     cctcttttca tggtctcagg tggctgcgtc tttctgcctg tccatccact cctctgccca      3600
     cccatccacg caccaggcca gtcatgccgt gaacacctcc tctgctctga gtgtactctg      3660
     gggttgtgtg tggcggggag ccgggcactg ggagggtggc ccgcagccct gtgctgtgac      3720
     aagtgccacg gaggaagaga gcaaaccacc cgagggaagt ggcagtgggg acccgacttg      3780
     gtctcgggtg ggggcacacg tgaaggggag acgagcccag atgcccgcaa gcccgacgga      3840
     cggaggacgg acacagagag agacacccac ttactccttc cacacacatt tattaggcac      3900
     ctactgggca ccacacgtgg agacagaggc tggagaatgt cacagtgtgc acggcggccc      3960
     agccatcacc cggtgggcag cgaacaagca tcccacgaag gggcggggcg ggggctgcag      4020
     acgctcaagg ccgaggtggg gtgggcgtgt tccaggcggt ggggagacac tggaggccgg      4080
     agcagcagga cgacggacgg ggttttcgcc tccgtgccca gtggccgcca cgggccggag      4140
     gagcgggggg ggggcctccg tgggggagca gcagacgatg tcgttgggcc ggcctttccg      4200
     actccccacg ccctgcctcc tgaccacaca gcctgtgggc gcagctctcc tcagagcctt      4260
     caggaaagcc tccgcccaac cctctgaatc cagcacaaca ggattggggg gggccctccg      4320
     gaagggtcct tcatggtcac tgcccacagg gctgtacctg ccgcccctcc cagccgaacc      4380
     ccacgggggg cccagggcag acacccgcag ccccctctgc accccgaggt gtcatgcaat      4440
     cacacacccg ccgcccccag gcaagcatgc acctcggacg ctgcctccac cagcccgctt      4500
     ccctcccggt tcaaaggcag cggcgttcac tttggagaaa gggcctttga acgtggctgg      4560
     acagggcctt gcagcgagct cagggcacgt ggaaaagcct cgcctctgtc cagcctcatg      4620
     cacgacacca gcctcgacac tgcacttctg aaggttctgc tgccccagac ttgaggggcc      4680
     tgggagaaaa gctgtgagcc gtggcctccc tgcagctgcg gggacactgc ctggtcctga      4740
     acaaaagctg cacattgaaa agggcgggca gctccctccc acacaaagca caaggctgcc      4800
     tcttggtggt cacccctcct ggtcctgggt cctgggtcct gccccgctgg cgggcctcca      4860
     cgacaggtcc acgccactga ccgtggagat gctaggctga tgggactgga cctcctgccc      4920
     gagaacattc gctgcggcct aaagaagcgt gagaagactg cgaatgcagc cagggctgca      4980
     ggaggaagcc ttgggcggcc ctgccctcca ggagctggaa ggccacagac cccagcagcc      5040
     agcgcacgct cggggctacc tcggcccggg tcaccatggc tgtcgggctt gttcattatg      5100
     cagcggtgca gggttcgctc tatgctcttc tgctgttact ttatttttat ttttaaacag      5160
     atctcagctg atgcggcttg gcagggaact gtgcagtaaa tcctcggtct cagggagctg      5220
     caggccgagg ggtggccacc aggaactgat caggccgcct taaagaagcc ccgtggtgaa      5280
     ctcccggaca ctgagaccag gtattcctga gaggcacctt gctggggctt cattcaaagc      5340
     cagacatgac cccttgagca tgataatgtg agaaaaaggg aatgcgtacg tgtatgtgtg      5400
     actgggtcac cttgctgtgc agtagaaaag tgacaggaca ctgtagatca gctataatgg      5460
     aaaaaataaa agccattacg aactagggaa aaaaaacaac aacaaaaaaa ccaaagctag      5520
     acgtgacccc cctctcaggg attgagagct aatgcaacag cagaaggccg aggacggctt      5580
     ggcgctgagg gggagagggc acgccttact tccccagact ttgttcgtaa aactattttc      5640
     ttagcaaacc ttcccttcgg agagcacggc tagactccca tcaagaagag gccgaagcat      5700
     taagattccg ggtcagggag gcggcattac tgaggctctg cggtgccaca cggagtagtg      5760
     tcagcgcttc aaaggggaca cggctgtggc tggctccagg gacacttgaa agcagaaagg      5820
     cttgggtgga aagaaagaca aaaaggggga aaggttaaca ggaccaacgg cccccgcctc      5880
     ccccctcccg aggtcacact cagatggacc ttccacgcat gtctctttca cctgccaaaa      5940
     cagccctcgg tgcagctgct actcacaggc ctctttggac tgttgtctgg cgttaacgta      6000
     agagagaaac agtcacggct ttgaatctgt ggcctctttt cagatggaga gcaggctgca      6060
     atggcagggg ttgggtcgag ctctccaagg cctttctgtc cccgtcaccc aaccacccgc      6120
     tcagaggtaa cagcatcagg gcatcggggc ctgcagccag gcaagggcac agcacgagga      6180
     tcaagcttag aggagcttct ctggaacctt ccagttggcc agaggaagga gttggggagc      6240
     tccgtggtgc tcctgcctat cccgtggagc aggccggggt gggggggacc ccaccgtgca      6300
     gcctcgctcg tgacagatga cagagctgcg gagaccaccc cctctgcacc caggcctcac      6360
     acgcacaagg gaacccacgc gggtcacgtc acttacctgt ggccacaagg ctggttccgt      6420
     gaacaggtcc aagaggtgtc cagggtgggc ggggggccag aggagccccc accccaagga      6480
     gtctcctgag aaaggggtgc caccggcatc ggtcctgcag ctgtgccaag gctcgagccc      6540
     cgggaatgtc aaccatccaa gtaggacgct gggaggggct ccagcgggag cccgggggtg      6600
     tccaggagac cccttcacgt gaacccacag cccccgctga ccccgggcct gtgattccca      6660
     ctgggggtgg agaagcggcc ccaggcactg ctcctctcca gggtccaaac ccccagaaaa      6720
     accggtgaca ccgtccacag ggatgaagat gagcggccct gcccgaggga ggcgccgctg      6780
     gaggtcaggt cgccgcacac actgctctgc ccaccactcg gccatcaccc cagctgagac      6840
     agcctcccta ccacgtgggc accaggccag aaggacccag atctgaggcc aggctgagcc      6900
     ccaaagggct gcagaagggt ccacagtacc aggggccctt ccacactgtc gagaacaggg      6960
     ccgcagagga gaagccacgg ccagctctgc ccgtgccagg gcccttcccc agcttggaac      7020
     ctggcaggct cctgactcag cccaagacca cctccgaccc cgcctggagc ccctcgcccc      7080
     aggcagcggc actcgaaggc agtggtttgg aaggtaggct ctggagcccg acccggcacc      7140
     tgggctcgga tctgggcaca gcactcgcca gcggggcagc ctctctgggc ctcagcttcc      7200
     cggcagggcc gctgtagaga ccgggtggtg aatgcagtcc ttcctgtctg ggacggggtg      7260
     gcaccacgag acacagcaag taagagggac caacaaacca ggaaggctcc ttggcgccca      7320
     gatcacgtgc ggcaggcggt gcaggaccag cccccccagt gctgctccca ccctgagtgc      7380
     tgctcctacg gccggagcct cggttctcct aagccttcga ggagcggccc tgaaggcccc      7440
     gccagagtca cagctgtcct gggtccttcc caggggcctg gacgcgtggg agaggaattg      7500
     agatcgcaga ggacaaggag gcaattctgc agagggagag gaattgactc aagggcccct      7560
     gagaaccccc ccacagccct ccctccttcc cctgggctga agggccacgc ccggcttcgg      7620
     gagctgccct ggcctcctcg gctgccatca ccacggctga gaggccgaga cacggagagg      7680
     ctggaggtgc caccctaact gctctcactc tgctgttcag gctgtgaaga ggccgcaggg      7740
     agaaaactgg gccttcccac tggtctcctg ggcccagccg aggccctggt gaaggctcgc      7800
     tgccctcttc cctgcccccc aggccgggcc acccagagaa cgcccacgag cccaggtctc      7860
     ccggcccaat gtcatggcaa agtcaaggag gccccggcca gcagcccaga ggctcattcc      7920
     aaaggccctc gttcctcgtg ggataataat agctccactt tgctgggtgg agggcacgtg      7980
     caaatgcctc cagaggccag gccttgctcg gccaggagtg acggggccag gtggcggcgc      8040
     ggggacggcg ggtccatgaa tcaccaacag ggggcggccg cccctcagct tcaggggccc      8100
     tggggacagc gggccccagc cgacgagagg ctcccttagg ccagaagtca agtctccagg      8160
     ctcaggactc agcgtcggcg gtggtcctta agtcagacct gacgaaaacg agatctgtgc      8220
     gggtgagaca accgtctccg ggggggctcg ggcctggggg ccgctcccaa gcgccattcg      8280
     ggatgcaggt ggtcacaggt tagtctgggc cgtgaacaac agcggcggcg accaggcatc      8340
     gacctccggg ggcctggtcc ttcctgggga gggtactggc cagccgggcg cgtgagcagt      8400
     gatggggggc acaggggaca ggggtgctga tgacagcggc cctgaggcgg gcgcgcggcg      8460
     ctgtctgaca cgggacctgg actggaccgc aggctgcacc ccgtgcgctc ctctgggccg      8520
     ggtctcagcc ctgccgaccc cagacgccag accctccttg gcgtgcccct gcccccagca      8580
     cctgctcggt cctcacctgg ccctcggccc acccgccggc gccgaccgct catcagatgc      8640
     cccccctgct acctctgcgc tgaacccgac atctgggcct cttcccagac gctaatcccg      8700
     cccagctctc caactgcatg gagcctggcg gagcggtgtc ctccaaatcc cccggcccct      8760
     ctacccgccg ccaaccgggc ttccatttgt cccgggacat ttaaaaatat ccgcccagcc      8820
     ttggcataga gaacccaatc ccccagttgt ttgaatgcca gccccccatt cggcccgcat      8880
     gtgcctccgc ctccagtaac agcgtaagct gaccccgagc tcggggccgc ccaaccctct      8940
     gcccaccccc gcccccctga aggccgcccc ctcgccaacg gtgttggcag ctcgagccca      9000
     ttcccgaccc tacaaggaga agacgggcgc ggggcaggga cacggaccac gtgcccagag      9060
     tatggtgcga tgtcgccaca gctgtcccac tctccccggc tcccggcccc agcgggcccc      9120
     acggccctgc tattaataca gcgcccgggg gccccgcagc tggccacggc caaatctttc      9180
     cacagacagt gacaactgac atcacacgtt cttttaaaga gaccgtggct gaaatctgcc      9240
     tggtcactgg aaacgtctcc ctttcgcgtg gggcaccgcc aacgatcctt tcgggggctg      9300
     ttaagggcac ctgcccgatg ggtggagacc tcaggagacg gggctcacag gctactttcc      9360
     cgccggggtc cccaggtctg tgccgtaatc aggcttcgtg gagaagaggc ggggagagca      9420
     ggtccgcgac cccagcgtgc cctcctccag gcggaggaga cagcggcgtg gacggacccc      9480
     agggagctcg ggaagcgctg gggcgagagg acatgtttgc tgggatttag gtgttttaaa      9540
     ggacacgtgg agaaaggctg gggctcagag gaaagcggcg cacaggggct ggtgctaccg      9600
     cagccctgcc agggccctgg gctcaccccc acctcgacgt gcttagaaat ctccataaca      9660
     acacgtttaa aaacatacac gtggacacga atattcagca aaagtttgct gagggcccag      9720
     cctcgcgctc gccagttcct ctagacccta gtggtttgca cgaacggaag gagcgcagag      9780
     tggggagtgc ccagcaggaa cggcgtggag tcgggagtgc ccagcaggaa tggcgtggcc      9840
     tggacaccat ctcctcggcc tgctccccac acgcccgagg ctccccaaaa catcccgctt      9900
     ttaggcttag gacttaggat cactgttgcc ggcgccggaa ccctcgggcc aagctggaaa      9960
     gcgcagtggg aaacgtcgcc ggctagacga gacggccccg aacccccaag gtgcccccgc     10020
     agaggggaca aggaggggca ccctgggtca tcagacgctc cctgagaatg ccaccttagc     10080
     tcatcagcac gcgctggctc agtcctgcct gctcctgccc tttgcgaaaa gcggatcctg     10140
     ccgcccgtgt gaatccctac ttccagacac aggctcttgg ctggcctttt ctggcagcca     10200
     atcaagaaca gagagcaccg ctccctgcac ccaatccccg gaaaagcccc gcaggagcgg     10260
     ccaggccagg gcccgggccg gggcgggcgt cctgcgaggc gcctgggctc cgtgtcctcc     10320
     ccttggatgc ggctgcgcgg aggccaaggg cgcagggtga ggcctccccg ataagtctgt     10380
     ttcttggctg cgtctgcaaa ccaaaacatg tgaggtgccg gcagatgtca tggtaaaggc     10440
     agcacaagac gactgcatct gtcgatttat tattaggagg caaatgtcat ggaaaaaaaa     10500
     tacgccccaa gtaattcagt cctgcccaaa gtcaacagct gcagctggtt ggagccagaa     10560
     tccttcctac cgcacctcgg cggacagggg ccttcctgcg tcctggggtc agagtcccat     10620
     ttgtcccctc ggagggcaaa gtccacaggc gagggacacc cccaggctcc cagccttcct     10680
     ggggtgcatc ttcctgggtg gggggtggag accccttggc aggtgtgtgg ggaagacgga     10740
     gctgggccag atggcctccg aggtgcgttt cgcgagctac acaccgatct cggcagctat     10800
     ctaaaaaata ctcagccaga agccaagtga tattggtata atttcccttt aaaaccaaac     10860
     tcatttccat aaaaaaagca agtcggttta aaggaaagcg ttaagtggtt aggacggggt     10920
     ggggctgggg cgaaactcct gaaggaagaa caggagtaac tgaagctgga gcaaaaatga     10980
     tctcgctgtt tctaaaagac ggtggaattt ttttcgaact gtgaaggtac ttttgagctc     11040
     agaaagttct cagtacgttc tctgtctaaa atcggctgtt tcctgcgccg gggagccccc     11100
     ccccccaggg caccgtctcc cctccagtgc cgcccgcccc cccagctgct gctggaagca     11160
     aagcccccag gcacagggtc gcggggccca gccctccagt caaatgggaa agcttactcc     11220
     ttcccttgag cttccgcagc agcgacctca ggaagaaaca gcgtccccct gcgagtgggc     11280
     aggtcaccca acccaacggg cgctctcgcg agcagacttg ctcttaccgc agcgacgtcc     11340
     actggaagga aacgtggccg tgggagttag cgccttgtaa acacgttaaa aataatgtta     11400
     actctactgg ctccctcacg gatgggcctg cagcgccgca ttgctagcaa cagtggcaga     11460
     cgaaggaaga gccgggatgc ccacgcgtgg ccggggagtc cccgtgcgcc tctcatcccg     11520
     gaatccaccc cccgccacta gtgctgcctt tcgcgctcaa aactcttccg gctggaggac     11580
     aaatcctaca aaccccaagt tacccaccag gagggactcg tctgtgccag cagggagcgg     11640
     ggtgggggca gggcagggcc tcgatctcaa aggctgggag cggtcttgaa actgcggccc     11700
     ctccaacgtt aaactctcca gatccgggat tagggcagga ggggacccct caggttcaaa     11760
     cgagcaagtg aagaggtcag ctctcctcag agcactgcca agcgagaccc caaacctgca     11820
     ggagcggcct gaacttgcat gtgtctaaaa gagctcagct tggagttccc gttgtggcac     11880
     agaaacaatg aacctcacta gcacccctga ggacgcaggt tcgatccctg gccttgctca     11940
     gtgggttaag gatctctaag gatcgggcgt tgctgtggct gtggcgtagg ccgacggctg     12000
     tagctctaat tccacctctg gcctgggaat cagagggtgt ggcctacaaa gacaaacagt     12060
     gaaaaaggaa aaatgaaaga gctcagttcc ctgcgtgaag aaccgaaaga tggacaagag     12120
     tggcggtgcc tccaacacta aaccagagtt gccacgtggc gctgcggccc cactcctggg     12180
     cttccaccag cgattcctca ttcagagaca cacgcgccgc aacgttcaca gcagtcctct     12240
     ctacagcggc caggacgcgg aagcgacttg aatgtccgtc ggcagaggag ccacaagagg     12300
     acgggctaca cgaggggcca ctgagagaca gcacccaatt tgcccgacgg ctcctccctg     12360
     aaaacctctg acgcggcgga aacccgaccg tgctcatctc acctcgggtg gcaaaggccc     12420
     ctcccccttt ctacaaactt cccgcagcct ccacgcggca aactccacgc ggcgtttgcc     12480
     gcctcgtaaa ccgcccagtc ccaaaggcag caggatgcga gaagacaggc atcacaagcc     12540
     acgccatccc tccaaccaca cagcaaacag cctgggtaga acggaaaaag gagccgttcg     12600
     caagggcaac aaaggcgcca aatccctggg acgcccaggg gcacagagtc ccgcgtcaaa     12660
     ctccgcatgt gacatagggg accttgacaa agaaaacgca agtccttaac gggaaaaagt     12720
     gaaacgcaaa cacatgaaga gaccccacac tcctggctga ggactaaaca cagagaaaaa     12780
     gatgcgattt cccacggtaa cttataggtt gagtgcgatt ccagtcgagg catcaccaag     12840
     gtcatcccag aacttgctaa ggacgaatct tggactctgc aggaaaaaat acacaggcca     12900
     aaccctcagg ggtctggccg cagcagatct taaaacagag catgagcaag tggtccctac     12960
     ggctgtaaac cgttaacact gaggagagag gtcgcaaatt agccaacggc aaactgcgga     13020
     gggatcaact ggccaccgac gagggccgag agacggtttt taaaaccttc ttctcgcaac     13080
     tgtgcacagg aagtttcaga ttttttttta ataattaagc aacgtcagaa aaatttcaaa     13140
     gtgacaaaca tgaagatttc tcgacaatct aaaaagagct ttctaatccc tgcgcgtttt     13200
     tccagggcca cctccagccc ccagctgctc agcatccaca gcaccgtttg gaatcagatt     13260
     ccccttgctc ttgggttgag cgccagcgtg ggggggggga ggcgctggca gctggtgcca     13320
     aagaatcttc tgggctccct cgtcagggcc ccgggtcccc ccccacaccc aggaggccca     13380
     cctggaggcc cacgcagatc tcctgccagg cttggcttcc tgaccacatg gattgttctc     13440
     aaggcctcat ttgctgcaaa cccgtcagac ctctgtgatt tggaaaaaca aaagtctttc     13500
     ttggtcttcc gtcttttctg agcagtgaag tgctgggagg gaaggaattt ctagacccgc     13560
     aaagggaaag gctcccaatt tacaatgact tttggccaaa aaaaccagaa aaaatcccaa     13620
     accagatggc aggccagagg tcatgaccaa cttagaatga gttttccaag agttcccctt     13680
     gtggctcagc aggttaaaaa actggctggt acccacagga tgcaggtctg gtccccagtc     13740
     tcgcttagta gttaaggatc tggagctgcc gtggctgtgg tgcaggccgg cagctccgat     13800
     ctgactgacc tctagcctgg gaaatctcat acgccacaca caggtgcagc ccacagaaaa     13860
     aagaaaaaaa gatgagtttt catttctgat ttgaaaagac ttgttctttt attctaattt     13920
     catggggttt ttgggttttt ttttctgttt tgtgtgtgtg tgtgtgtttc tttttttaag     13980
     gccacacctg caccatatag aagttcctgg gccagaggct gaatccaaac cacaggtaca     14040
     gcaataccag atccttaacc cactgtgctg ggcaggggat caaacccgcg cctccacagt     14100
     gacctgagcg actgcagtcg ggtcttaccc cgttgcacca tggcaggaac tccaacattt     14160
     tctttacctt gggatgtgtg tgtctgacct ggggctgccg ggacccggat catcctggca     14220
     ctgttgtcaa cctgtccgtc atctggccca acatctcagg gccccgatgc tcagggggga     14280
     agaggaggag tggggggctg ccgccggaag caggcagcaa gctgcctgtg gactggccca     14340
     gagcccccac aaccccttgc ctggctggcg ggggccacag cccctcaccc ctgtgcgggc     14400
     aggtgggccc ttccctgcct gcttcttgga aaaaccaggc tgagtgcaaa taacaaacaa     14460
     atacctcagc accctcttca gcccgaagca gagcggccgt gagaggctga gtccccatta     14520
     tccgggcgaa ctgattacag agcccagagt catttgcctg cagataattg ccgcaatccc     14580
     gcccttggct ctgcacatac aggaaccgtc tccatctccc cgagcctcgg tgactggacg     14640
     tgtgaaattg gtctgatcat cccgtgaagg gcctgagctg aaaggatggc tgagcgcccg     14700
     ccggaaccat gacacgggcg agaccctctg tccggactcg cgctgagctg ccccccgccg     14760
     agtctggagg gtgagtcagc ccctcagcag agcagagaaa aacaacttgg aggctctcat     14820
     tcagtgctgg cggctggagg gcagcaaggt gggacgagca ggcgagctgg acagaattga     14880
     ggccaggcac ccggggatgc gccggacagc cgagtgggcc agggccatca gcagtgctcc     14940
     cgccacagcc caccagctac gtgggggctg cagggtggag ggggtgctgg agaacagccc     15000
     accttggctg caggcagctt cagacactgg cgtctcccca tttctccagg acaagccagg     15060
     cccatggcca gggtccagaa tgtgacccag agtgccaggg tggggctgag gaagggcagt     15120
     gctggcatga ggaggacccg aaggcccagg cctgcactca gcctgcacgg gggcttccca     15180
     ctgcccctct tgtggcaaaa gcggcaggca ggcaggtgga cgtgggatgg cgggagaacc     15240
     tcgacagagc ccagagccag gggagaggcg cgcccggcag ctccaggcag aagaggggtt     15300
     cactcctaac acggcctccc tttcaggatg aagggcacag agcgctgcac tcccgacagg     15360
     ggcctggaga gagcccagtc atgccagaaa gatggttatt ccccctgctg tttgctcctg     15420
     gctctagatg gcacgtcccc aaaatcacaa aatgaggagc ttaggcacaa aatgaggagc     15480
     ttaggcctgc tggtgggagc cagaggatcc cagcatggcc tgagaaatga gccaaatgct     15540
     tgtgtactgc acccagagcg ctttgcgggg gctgggggag ggcgcggacg ccaaattctc     15600
     agcagggttg agcctttccg gctgattgcc acagcgagga gtggggagca cttgagactc     15660
     cctgaattca tttctaccca aaggaaagtt tgaaaagctc tccatctcca aaagtaatct     15720
     tttccaatga ttgtccaaaa actaagctca agagggctgt gcccacccgc ctggcagagc     15780
     agaacccgtc ttctacctca tcctggaaaa catcttggtg tcgaagggac ccgtgacaat     15840
     agcctggcca tccttcggag agctcacacg agttccggct cccttagagg gaccagagca     15900
     gggctttgca cacagtaggt gcgcgggaac agctccctaa cgagcggtgt gcagtgagct     15960
     tcagcatcag gctgggtgaa aacccacctc tttcagaaaa ccaccagatg ccctctcccc     16020
     gcgagggtac caccgctgct tctctgctcg gggcccaccg gcagtccgct ctgtaccagt     16080
     tggggcattt cacatcgagc cacccgctgt gggacggcgg gtcggtcact tctccattgc     16140
     ctccatctcc ccacgatgcc tggaaggggg tcttggtccc cgaagtgaca gtgtgtgatt     16200
     gctaaataac caatttcatt ttaaatttcc cagacagctc agggaaggga agcaaagagc     16260
     cccgatatca ttaatagaca gacttgacta atttcttcgc ttcagccagc aagctgcaga     16320
     gccctgggcc agttacaaag gctccgtcgc cgccggccac tggctccctc gcatggagct     16380
     gtttgctcgt gtcctgaaac cgctacccaa acattccttc ctgccgctga gccaatggca     16440
     ctttcaaacg cttccgagac agaagcagag tcagaggagc acgcggcccc ctccagggcc     16500
     ccggatggac acagcatccg actcgaaaag aacctggggg gcgtggagtt ccaatcccac     16560
     ccagctcgag agtcccacgc aaaacatccc caacacgtgg tcatctgtcc tttgagggga     16620
     cgccgccagt gacagccgct ccagcacagc ggcctgcctg tcagaaaaac gcttcctggg     16680
     gctgagccaa accccacccg ttgtaactgc ctcccagggg ttctactgtg gccccctcga     16740
     gccacataaa ataaaataca tcctcatgcc tcttccacag gacaatcctt tcagggctga     16800
     aggcaggatt cttcacaatt tatcccaatc agaaccttaa ggaactggga acggcaggtg     16860
     ccggcgcagc tggtggagga gccccccccc ccacccggcg gggccacagg agatcggggt     16920
     ccacgctttg tttaccgcag acccacagag cccctggctc ctccgcccgc tcacaacccg     16980
     agggcgtcca cccccacgtg ctcctttttg gaattccctg agcagccagc gcttcgaaag     17040
     tcacgcccgg gatgcgtttt aaagagcgtt ttctgcacag agccgcgcgc gtgcggccat     17100
     ggcactaagt gcaagatggg acagtgtttc agcgcagtcc tcctgccccc ggagcctgcg     17160
     tccaacgtcc agcgtacacc aggatgtatc tgtaactata catgaccggg ctctaaacac     17220
     agtgctttat taaatgttca tttgctgatg agcatgcatc ctgcaaagca agtgccttac     17280
     taatgcagaa tctagtccaa aaatatgtat tatgtaatgc acattttttt aataatgcag     17340
     gcaatcgcgg tgtatctgta tgagcggatc agctctgggc cgccatctcc gtcacagccg     17400
     taaagcactc ctgaaaaatg aagttctttc ttccgtaccc taaagaatca ggatccccct     17460
     cgttgctgac agctggcatt tgtctccact gaaagggcat tcagcagcac ccacatattc     17520
     ctgctatttc ccgatgagcc ctaaaaatca cttgaatgat gtctttatgc tccacacact     17580
     gtcggtggag ctgtgccatt gaaagaaaca caggatccgt gagagcagaa ccattacaca     17640
     cgcaccccct cggctgaggc taagagatca ggatttgaga cctactgctc tgaaggtcct     17700
     gggtcccgca gtaagagcca ggcaatgact gtagccatcc aggcacttgt gctaataaaa     17760
     ccctctccgt ctctctagaa aatgttaagg agggagaaac aactagaaat caggcatttg     17820
     tgcatttaag aggtttgcca aatcaatgcc actttattag accaatcagc attttaatgc     17880
     tacgaactaa ctcgaagaat acaagatgca agacagacac agccaagaag ccaggtcagg     17940
     aacattccag accatccacg gccaggacac agaaacaaaa cctcagccca tcaaaaacag     18000
     ctgcgagaac cttaataagg tcttaactct gggcttgaca gctttaaggc aggcctggtg     18060
     ctgaaaggcc tgcgggcgag tcccgccatg ctgaggaaca gctgtgggtg caggatgcgt     18120
     tgggcaccag gaagcagccc caggaaggga cgcctggggg cccaccccag aagggaacgc     18180
     agaacggtaa aacatcatgc ttctccaagt gcccccacct tgaatcaaca gacaagaaaa     18240
     cccaaaccta cctgtcccac ctgtgaagcc tcgttgatac ctccatggat tccaggaaga     18300
     tggtttcacc tggggacttg tcaccaaaag ggacacgccg cattttaacc aggagagcat     18360
     gcacgaccca gaacagctgg aatccccaca ctgcctgagc tccatccttt cctgcacacg     18420
     gaccctccag ggatcccccc tgcaggacac agagctcact tgcttgtcca gggctgagaa     18480
     agaggttacc agcttcctta ggggttcaac acgtgatctg ggggtgccta gctgtcccct     18540
     aaccctaatg cccaggtcga tccaataata ttctcccgta gaatgcaggc gggattaacg     18600
     gccatggtgg gtaaggaggg agacgggttt catgctctca ttaatcgcac atacatccta     18660
     aatagcctct cctttctctt cttcccactc tacctctggc acttagaaca gagcttggca     18720
     tgtcctaggt actcaatatt tgttgaacga actaaactcg ctgaaaatct ttatggaaag     18780
     agctttgagc cgacagcgag gtctccttga tagcggatca ccctggagcg cccccaaggg     18840
     gcggaaaatt gcgtgcaccc acagaaagac tccccttaac tagcggttct agctagctga     18900
     gtccttcagc acgagttccc ggctagagct ccaggtggtc caccaatggg tttgggggtc     18960
     accacccacc tccgtagggc cccttctaaa ggaaggcgct ttttacccct gaggcaatga     19020
     gccgcttggg accgccgggg gcgggggggg ggggtggttt tttccggaac cttctcaggt     19080
     tacagtcact ataccagatc tgccaaaggt ggtttcacga ttaacgattg cctggggtta     19140
     ccatctttaa actattaagc ccttggaaaa agcccggaac cgcatcttta atacagacgc     19200
     tcgttcctcc tgaatatctg cagttgcgcc atctgctttt ttgccgcttt gggcttggat     19260
     catttcatca agaacccagg agaagctggg gaggggtctg gagcccacgg agaaccccgg     19320
     cccagctgcg caagtactct aacctgtggc tagctcacgc gctcctgagc tccttggccc     19380
     ctgccaggcc ccccgcccct cgcacggccc agatcctctc atacaaggtt ccctcctgcc     19440
     acctgccggc ccacgagagt ctgcgcctca gcctcggcgc cgccgcgcag ctcgcgggag     19500
     acgcccccgc ctccttactg cacatgcccg gctgaagtcc gggcgcgcaa ctttgcagaa     19560
     cctctccgcc cgacactcct cgcctcagtc tcctctttcc tctcccaggc gagaggacca     19620
     gcggaggcac ctctcctgag tcttaggctg cggagtctaa gactgagaga gaggagcccc     19680
     ggaggagact gactttttct tcccttctcc catccctcct ttttgctcag aggccagcag     19740
     aggcgcggag ctttagaaag ttgagaggtt aggaaggtag gggcttcctt tttttctcct     19800
     cccgccgagg tggggctggg acctccggac ccggcttctt acctcgcaag gagcaccttt     19860
     gtcggctcca gcagccgacg cgcttcggag ctgctctctg cagagccaga gggtgggtcg     19920
     gcttcgccgt gtgtgcgtga gaatggatcg caggtcccga gctcagcagg ggcgccgagc     19980
     tcgccacact tacagcgatc tgtgcccacc cataggccgc cgggcagcca ccgcgctcct     20040
     ctggctctcc tgctccatcg cgctcctccg cgcccttgcc acctccagcg cccgcgccca     20100
     gcagcgcgcg gctgcccagc gccggagctt ccttaacgcc catcatcgct ccgccgcccc     20160
     ggtattcccc cagccccctg aatccgacca ggagcaggag gaggcagacc tcgaactctc     20220
     cctccccgag tgcctagagt acgaggaaga gttcgactac gagtctgaga ccgagaccga     20280
     gtccgaaatc gagtccgaga ccgactccga gaccgagcct gagaccgccc ccaccactga     20340
     gcccgagacc gagcccgaga ccgagcccga ggacgagcgt ggccccgtgc tgcccaagcg     20400
     ccccagcttc gcccaatctc tcaccgagcg tctcaacgct ctgaggttgc agagccccga     20460
     cgcctccccg agtcgtgcgc agcccagcac tcaggagtct gagagccccc gggaagggga     20520
     ggagcccaag cctgagcccg aggacaagga tccgaggggc cccgaagagt ctgaggagcc     20580
     aaaggcagag gagaagaagc agcagcgccg ctgcaagcca aagaagccca cccgccgcga     20640
     cccgtccccg gagtcccctt ccaagagggg acccatcccc atccggcgtc actaatggag     20700
     gacgcgcccc agattctcct tgttttcttt gacccaggtt ggttgcccac ggctaaactg     20760
     gggagtctgg ggtcggtgcg ggagcgggaa cggcgggaag gagggaggga gaaggaaagg     20820
     caggttggaa ggaaggtggg aagagagtgg gctcagctag ccagcccggg aggctggggg     20880
     ccggggtgag ttgggaaggg ctccccaaat ctcccccagg gcgccggcag gcgcccaggt     20940
     ggcccaaggc ttgtcggacc gcggggcgcg ctccttgcgc cccgctggag acagcctgag     21000
     gtctccgagc tggtgtccaa gacgcgcgac tggaccccgg gtgcgcccca ggtttcgagc     21060
     tgcacgccca aaagacaagg gtaagtcact cgttttacgc actttcttcc ctttcttccc     21120
     tcctagagaa attggtttca aaccagttgg ccttggcggg tgccagaaac gtggttcgga     21180
     ggtgcccgca ccaactttcc gaaagtgaga gccgccgcgc tgcagcgaca ctgttgcaat     21240
     gcgagaaaag taaccagatt ggcattgggc gagaactccg gagaccgctg gctccgggga     21300
     aaggcgcgcg cgcaagggct taggacgccc ggagcctgga gcccaggtcc agtggctgcc     21360
     aatttggggc cgcgggacct cggcgccagt gtcccccgcg gctgtgagcc agtcttggcc     21420
     gccaccgcct gtttccgggc gctcgccggg ccagagaccg tggcaaagag ccgtgcgcac     21480
     ctgcccgcgc gccccagagc gaacctctcc gagccggccg gcggctctcc gtgagtcacc     21540
     cgtgcttgga aggcaagcag aggaggtacc ggagtcttgg gaggtgccca acgggctacc     21600
     ggggtcggca gcgcggactt ggtcccgtcg gggcatcgcc aaccttttgg cgcagctggt     21660
     ctggcggcgg ggctgagtgc agcttgtccg gagagggtcc cgggctgttt gcgcgagagc     21720
     ctgaggatgt gagagagggg ctaagaggtc agcgaggtga ttgctagcgg aaaggtaaag     21780
     cggaacaagg aacgggatgg agagggagtc gcgtctatct tcagggaagc cctacgacgc     21840
     gtcccgaaag agagccgcac cggccgagct cgggcaaagg tgccggagcc gacgcaggtc     21900
     cttcggcgcc gttgagagcg ggcaggggcc ggtgccttcg gcagcctcgg ggaggggaag     21960
     ggaggcggcg cacaccggcc attttcagct gggctcccgt ggagctaagt ttggaatctg     22020
     tgacctggag gtgaaactgc cccggcgttg ggagcacaaa cgcggccgca atctggtaac     22080
     gcatcttcgg tgcgcatagt gtgcctttct cgccaatcct gggggagaag accgattagt     22140
     gaaatgtatg cacaaaacct cacccgactt ggaaattgat cttttggtga tgcgcgcgcg     22200
     tctcgttttt gccacggttt gagctcttct gatgagaatg tttgcggggt aaagtgaagc     22260
     gttttgagac ctgaaaagac gggtcaggtt cttagtcgcc agaaggaaca caggttaaag     22320
     ggtcttcctt ccaggtcagc taggagaggc gtggcggcgt cccggaactt aagttatgct     22380
     gggctgcggc gctgactaac gactgttgga tgcggttctg gtgttggccg gtaaatgccg     22440
     ggaagggggc ttccctgggc agcggcggat gtgtccagag ctctggagcc tgcgggggac     22500
     tggtcaaagg gtccggcgtg cggggtcttt ggctcaaaag cggcaccctg ccttaagctt     22560
     tggctccccg aagccgacat ttctacttag tgtcaaaaca gcgatgctgt gctcccgtcc     22620
     gtggcatata aatgttctgg ctttttctct ggtgatgtct tagcagactg aggtcaccca     22680
     ggaaaatgcc ccccccgggg gggggtgaac aggcaaaagc agccaggggg ccgttggcat     22740
     taccggcgtg cttttcggcg tgcttttcag tgtgggggct gccctcgcag gcgggggggg     22800
     gggggggggg gggggggaga cagtttccct gcagggctcg gcggcgttgt attagagaaa     22860
     ttagcatgtt gccttgtagc aggatgaata aacaagtctt taagaaagtc ctcagtgccc     22920
     agcccgcagc tcgccgcgcc ctagtcctgg gctgtttctt taaacagagg cttgcgtatg     22980
     gcggagctgg ctttcttaac taagcaatat accaggttag ttgtcggcgg gagggtcccc     23040
     cgtctaggaa cgcacagttg gccatctttc agacactcct ccacaaacta ccggatacta     23100
     aaaacctgtt acccacacac gccctccccc actcagcggc cctcccccac ctctctccct     23160
     ccctcctggt tgcagggtgc cagagtcccc agggagctta caaaaccact gaggaatata     23220
     ccaaacccct agagtgcctg ggacccaccc tgggagaggg gattttgccc cacagaccct     23280
     gcaagtcaca acaacaacag cagcagcagc agcaactcct ttcacccaag ccctgggtgg     23340
     ttagttgcct tttccagagg catctctggc aagttcccca gcattcccaa ctcgctagtc     23400
     ttcctactag tcctttgtct ctcccaggag cactggggag ttagcatttg aatgggctta     23460
     acttgctcct gcaatttagg caatcgtctc caaaaaagca gaccctactg ttgaccacag     23520
     aggtgaatta acagccagtt acaatgtttc aaatggagag agaaagagga agaggaggag     23580
     aataaagcta gttaaattgt atgtgccagt attcccgact ttgccacatt tctcacttgg     23640
     cttaatagaa atttgctttt tcttggacaa aagggcactt ttaattttgc gctgaaaatc     23700
     ttgcagcaaa catggtgtgg tgtcaacaat ctggcatggg tttgacaaac aaaactttta     23760
     atttatgttt atcaattcaa ggattgggaa ttttcaagct tggaattgtt ttaagatgat     23820
     ggctctttaa ggtactagaa atcccccccc ccccccacaa ttgcttacaa tcctttactc     23880
     tttagccctc atttttagca gctgtgatag gttttactgc ggaagaaagc tgaaatttca     23940
     gtgttggtaa aaaaaggttt ctaataataa taataataac aacaacaacc tgcctagatt     24000
     ttacttgtct gtattatcat tgctcttcat gcaaagggaa gctattgaga ggaaacggag     24060
     cagaaagcat ggtatttgga aaaataggtc tcggaacaga aaggttacct attaacaaaa     24120
     aacaaatgac tagaatcaga tgaagcttcc agagggagtg atgtcatatg ccagctgaag     24180
     tgctgcccgt ctatctctta aaaactgccc aaccagaggg ggtgagactc tcaaattaca     24240
     tcttcaatcc ccaggttcca gaatgagggg tgggattctt tgtcctaccc ttcggggtct     24300
     gacatttatg atgctgtttt ctaactcctg accccccagg aatgggggtc aggagctaag     24360
     ggtcaggccc agtgccctcg gtctcagttt cttcacgtgg aaaatgaagc agctgaagag     24420
     atggtcccag catcactctc tgctgcaaat ccctgcaggt tgagtcgctc cagaagccca     24480
     gagctgccca atctgactct attaatgact ttaatgctaa tggagccccc cctagatttt     24540
     taaacgttga taaaataaaa gcaccagtta tgaagaaatc tgttttgcgt tgctctaatt     24600
     tgattttctc aaatctggtt ttgacttggg gacaaaaatg gtttagaggc aagttagtaa     24660
     taagtaaata cataaataaa taagaaggca ggttagagaa tagagaattc cgctgtatcc     24720
     tattactaac tcgaggggag aaatggcatt cttaacagca gataagtggt gtttgtctta     24780
     ggtgtgctgt ttccccacct cctctcccgg atctcaatgc agagccagcc tggccctgcg     24840
     ctgcagctag agatgccgct gccggcggct ttgggggaga gcagactgat agccccgctg     24900
     gctgcttagc tgaccacagg tgttgactgt attatttaag tgtcctgatt aggttagacc     24960
     tgaaaaaacg gctcagaggc tgcagttagg atcaactggg ttttgttttt ccgtcatcac     25020
     tccctcccag gagcttcttc aggcattttt ttcttaatcg gtccctccca tgcaatggtg     25080
     atgtcacaga tagggcagca tactgtgtac ctgtttctct actgagggac ctgctaacag     25140
     ctaagattcc ccccccacac tccttacaaa ccaattttgc ttctgttgcg aagccatgaa     25200
     ataaagaaaa ctttttttcc cttaaaaaac aaaaacaaaa cttttatgtc agatgattta     25260
     ccatctcatt tttgttttct atttgaacct ttggggggct acatattaca aggctatata     25320
     tatatatata tatatatata tagtgacttt ttttaaactg atgtttgttt tctcttttct     25380
     aagatgtcat tttttccctc gaacccctct ctggtagcca cgctggtgct agggcccagg     25440
     taattcacat ggccgagagg tcagagcaca cggtctaggg acttagtcct cccaaggcca     25500
     agagtgcagt gtggggccac catcccctct tgacagctct cagccaggag aggcggggac     25560
     atcggagagg agcaggtgcc atggcacccc ccccaacccc ctgttcctgg ggagaactgg     25620
     gaggctgcct tcctagcctc ccatgtggac gtggcctgtt tctatcccat gggcttattt     25680
     tagggtgagc agttgcgggt taatggggtt ggggggaacc tgccatcaga aaggccagag     25740
     gaagaccagg cttcccggag agagggtaga cagtggctgt tacatggggg gcaatgtgag     25800
     gatgacagac ggaaaataag gtgtgggggg atcacgggga agacagacag atgtcggggt     25860
     ggaaacacct gaccagagcc aagtgcctct agacgcgagg ctggaggagc aaggagagct     25920
     ggggagaaca gcctcagggg agcctccccg gccgtctttg atatctggtg gcagcagggg     25980
     cagctcagct ttaggaagag cgttttccca gccaaggatg gcggtggacg gccactaatg     26040
     gggacctcag attagtcgcc cctaatgtcg ctttcctctg agagtctctt acaggcctgg     26100
     cccagacgtt tcaatttcac aggtgcagca gagctgacat acccatatct caactgtttc     26160
     aaccaaagat ttaaaagcca ggcaatcttg ctttatatat ttcgaattct aagtcttgga     26220
     atccggttca aggacagtcc cgaatcccag acttgagggg tgagaggggc acagagccaa     26280
     ggactgcccc cagatgagga agccaagtcc ccgcctccac tccaccccct acctccgccc     26340
     caggcaagag ctggcttctg agtgccctgg cttatgttgc cgtctcaatt agatttcatt     26400
     aggaaaattc gctctgggta attgaggctg tgcacgaagg tgaaatagac cattcccctt     26460
     aaattcaaat caagttgcca agaagccccc agggtgcctg gaatttccac cgcgaattac     26520
     cgaaattgta aacagagcct ccactaaagc caaatttatc ttccgggact ccctcctgcc     26580
     gccccagccc ccctccccac tctacccccc tcccccgcca gtccccttcc cagggggcac     26640
     tgttcttctc tggactggcc cttgcagttc tctgctgcat catcagccag gtgccgagag     26700
     atgtctggac ccaccgtaca atcaccggtg gtcagacgca gtctggtgtc tggctgcagc     26760
     agacctgagc agcgcttgca ggatgagggc cacccaggac agccagtgag ctgaacgggg     26820
     gcgggggtgg ggtggggtgc tgaattcgtg gtggaaaccc ttggcctctg gggctccagc     26880
     cggagccctt tcatcggagc aggtcaaggc tcttcctgtc tggttgccac tgtcttttac     26940
     catcagccct gcctgccctc ctaaccctca gccctgtgag gtgttttccc ggccattggc     27000
     atttgcgtga aagagcctgg tcgcgcagac cctgctgcag acagcggtag gctgctgccg     27060
     cctgcacccc ccgccacccc gcccagaggc tggtggagga gatgctggaa ggggaaaccc     27120
     aggcgcgcaa gtcctaattg aacagtaatt aattgaacag cttcagaatc ttattgctcc     27180
     tccatcagca ctcagaaaac agttgtgggg ggggatgaga aacgtcatca ttgccagaat     27240
     tctctttcct gggccctcct ctccctgctt ttgccttttc ctcacaacgg gcgcactgac     27300
     tgtcctcatt tgaaagtaac ccactgacaa gcagtggcac acgggggctg cagagaaggc     27360
     tcttctgcaa actgccccca ggccagcctc ccccgccccc agaggtgcca ccacccaggg     27420
     aggatggtat cctggtttcc ctggtttccg tccctttttt ctggcctggc tccctccctc     27480
     tcagagcctc ttgcacttgc tttctctttc ttgcatacag ggatgaacta agaaagcaag     27540
     ctgacaggcg ggcagctcct tacaatctgg ccgggcccgt gcctttggca gggagtgaga     27600
     atccccaggc ctaagtcccc tgacgacggc tggctgggtc tgatgtgtgc tggcgtggaa     27660
     gcatcactac agcccttaag acgtagttgg ggaagcccag ggagtcacgt ccctacaggt     27720
     ggcccaggta ctgacggctg ttgagagtca acagtgaaga aataccttct tcccgttcag     27780
     ggtcacctgt ttacacaaag ccagctgact gctacctgtg gcacctgggc catctggttg     27840
     gaacaggctg cccttcctta gacatgcagc atttaactga aacaggacta gcgtttccca     27900
     ttcctttctt catggatcaa gggcagaaaa tccattgttt gacgcagctg agtagataga     27960
     tacagttttc aagaaacctt cacctggatt ttgacggcca gggccctccc cccccccccc     28020
     cccgacacat catctcactg ctgcgcccgt ggggacttca tcttcacccc agctcagtcg     28080
     tcgtcttcat gggtgtgtga acccatgaac caactttcct tctgccttct tgctctttcc     28140
     tgtagaatat ttacctcttt ccctgataga aatccatcca gcactggaaa tctatgccta     28200
     agggactttg ctattattaa attaggatga cagatcctaa aaactgggcc ttggtgaggt     28260
     taggtcccag ctaagctgcc cactgccatc cagccctggc cgtctctatc caggtcaagg     28320
     ccacatttct gtcttagcca gcaagacggc cagccccgag gggcctggcc agacagcccc     28380
     acccatgaag gtggccccca gtcaacccac cagctgatca ctctcagctc ttaccatacc     28440
     agctcctggg gccaggctgc ccggctgcct ttcgggacag tcagctcttc aaacatttgg     28500
     ccacacttct ggggtctttc aagtctcacg gtggagtttc agctctgact cccccacttg     28560
     cccaaatgat ttggggtttt cagattctgg tagccagtcc cttcagaaaa ataagagtgg     28620
     acaaaaaggg gaacgctgga gttaagcgct ggaatttttt tttttcctgg tcctagttca     28680
     tctttaaatt gaggtgattc ctactcaagt ctaagggtgc tttctcagcc cactgaagtg     28740
     gtttcagttg ggggcgattt tgcgtcccag aggacatttg gcaaaatctt gagacatttt     28800
     tggttgctac aaccaaggga atgctactgg catctagtgg gtagtggcca gggggcatgg     28860
     gagaatcccc acagcacaga accacctgcc ccaactgtca gaaaccacca tccaatttag     28920
     aaatgctgac caattctcaa tctgccccca ccctgtgtac ctgcccccac tggtctctcc     28980
     cgcagcatac cccccctttt cctctccagg gctccaggtg tttcagattc tatcaccagg     29040
     tagatctctc cccttgcagg tttactctgc tctagggatt tcatatccag ataaggatac     29100
     tgtcattttg agggtggggt cttcaccttt tcttctaaac ttcagtccca tcctcctaat     29160
     agactgtaaa aatctccacc catctgccag gtctaaaacc aaactggctc tgccaccgtg     29220
     cccgcgtctc cccagattgg ccccaacttc cccatcccgt gcttgtccgt cggatcttct     29280
     aggtgccaaa cgttggctcc cccgcccctt gtgcctagcg cagaagttgc tgggggtctt     29340
     ttgggacctc ttccttcagc ccgcctgctt gcttcactgc atgtggtccc ctctgcctta     29400
     aaggtcatga ccagccacgg gctcctttgt tctcaccacc ctccacccgg cctcaacctg     29460
     tcctgaaatt aacctcaaac ctcacgtgca ggaccaggaa gaacaacaac gaaaaccaag     29520
     ccaacagacc tactccattt cctaccaaaa tagccttaaa ctgcctgccc cgacacccca     29580
     cgcggtcctc agagagctcc tctccaattt gtctcgcctt tctcccccac ggctcctcca     29640
     agccggccaa ggcggcctgc tctctttacc cagccatgtg ccgagtttgc tgctcttgga     29700
     tctttgtttg ctggtaggcc ctcgtctccc gtccccaccc ctgcttctgt tcacagcctg     29760
     gatgtctctc cctctgagga ggcccatcgg aaactgcatt ttccccaacc aggtccccca     29820
     cctggggggc tcttctttca tttttaggtg gcttttcctc cacgagagag gcctgctccc     29880
     tgcccggtct gtattccgtc cacgcatgtg ctctcctggc aaacaaccag gatgccagag     29940
     ggcgtgcggg aggaaggggc cctgcaggct cgtgggcatg cggaacggag gccccgctcc     30000
     cctccctgga ggaacgccgc tttgggaaag ggcgggagtg agctgggctg cgcgcggggc     30060
     ctagcggagg ctgaccgtct ctctgggccc catcacggcc tcccggggcc tccaaacccc     30120
     gacatccact gaccttccac ttcggcaggg ctcggcatcc ccgggacctc aactgcttat     30180
     ccatctgggg ctgctcctct gcatcggggc agcgcgcccc cctcgcctcg gggtctgggc     30240
     cctctacctc cgggcccgcc tcgcctcgcc tcgccccgcc ccggcggcgc atccctgtgt     30300
     taggtgggtt tgcccaccgc catcagcgag agcaagggct ggctcccgag agcccccacc     30360
     tcgcctttcg gccctcggga cttggggcgc caggaagcgt gaccccacgg cgcccaccgg     30420
     cctcgtggca tcccaggcct ggccgccata cgcccgccca ccgaccgctc caacccaccc     30480
     cagcctcaca acctcttagg gcgttccaac gcggcgcccc ctattggacc tcccactcat     30540
     atccggtttc cggtccggcg ccccctgctc attcgccagg cagctttgat tggcgtgacc     30600
     ccggcccaat ggctgaccca gtgctggggt ctgaggagag tgagttgaca gttgcgaccc     30660
     aggtagccca ttcagtggat gccgcaatgg ctgagccttt acgcgtgggg gtagttgtcc     30720
     aaagtttgaa ccaaagttct ttgttggcac ttgaaagggt atcgacccgt agagctgaga     30780
     cgatacacct ttgggggctt ccaaacgtta cccggggtcc gactttgtca gatttcttct     30840
     gcgcagcgcg gccgcgagca tggtcgatgc gggggcagtg atgcgctgtg gccgtggccc     30900
     ccttgttcta agagggatgc gttcgattta ccaatattgg agcgtgcgtg catacgtggt     30960
     tcgcccgcct gcagctcgta gatacagcga tccaggcggt gcgcgccgct tgccgcttgc     31020
     cgcagcccac tccgtgcagc gctcgtcctg ccacctctcc ccaccccaag gccaggcgac     31080
     cacctccctc ctgcctagct gccttgcacc taaaagtggc tcacgggtcc atgtcaccca     31140
     ctggcgagac agaactgatg cccgttcctg ggtgttacgt gaaacgcaag cagaaatttt     31200
     tcgcggggct caaatccctc tgtagacccc aaacccaaag cagtatatat gcacgccccc     31260
     aacccaccca gatgatgagg gcatgtatcc ccaccagctc tgagcccacc atgccctacg     31320
     gcaacaggag cgcagccaga cgtctgccgg atctctcgcc ggacttaatg ccgccgtggc     31380
     ggctcaagca ttggaaaagt aaagcagctg ctgtgggaga ccataggaag aggagaggga     31440
     ctgaaagggg gcagaacggg gctggagagg ggctgaagag aagctagagg aactgtccga     31500
     ccaaccccgc agccggtgcc cgaggcaggg agcggcgcgc cgcggctgca gctgccggct     31560
     cggcacggtg tgtatcgttg ggttcggtgc gcacggggtt gttcaatctc cgagaccacc     31620
     ctaaaccagc cataaatttc gagtaaaatt ccatttaacc tttccccccg aacggtagga     31680
     ccccccagca ctctggggcc tgcactctct ggggtccctg tgtgcgtcct gcgccccccg     31740
     ttccgtgccg cggcaggtac cgcttagaga atttccgtga tgcgtgcgcg agaccctctt     31800
     atccccctgt atttctcatc atccccataa acaggaaaga accctgcctg cgctgccctt     31860
     ggctactgcg gagaccccag aatgtgatga ggatggggga catttaagtg ttttttagga     31920
     gccagcctcg gcaagccggc aaacaaaagc taccgaaacg actaaacggt ggaaagtaac     31980
     ccaacacgtt ttaaaaacaa actgcgtgct cacacgctgc agccccttgc ccctcgcctc     32040
     ctttctgctc cgccggtggg ctcacgacca cctgtcgcat ccctgcgcgc tcctgcaccc     32100
     ccttcccccg cgcccaaagc cttgcgctcc agacttgagg ctttaagatt ggaggcagtc     32160
     cagggctggg gggctgcggc tcaggggttc tggggtaatt tggggttacg aaacactcct     32220
     gcagtccccc cctccccccg aggagagtct gttgggtctg ggagggaggg tttcagctcc     32280
     tgcgctcgag cagccagggg cccacgtctt gcgtcacgtg tccctcaacg caagagagct     32340
     ctctggccag gggagaagag aggagaaaga ctccaaatca gtcagggaga ggactggaag     32400
     gagccaaaac gtccctgcga agcctgcgct catcagaccc cttacccaaa gtccggggct     32460
     cccggcgccg ggagcaggct accggagcca ccttggcacc gcggccggcg tcctctggtg     32520
     gcggagaaag agcactacga gcgactttcg gaccgaatcg gcgcgctcct ctgatccaaa     32580
     caggcggggc tggcctggag ctaagagaaa gagataagag tggacaaggc aggccaaggt     32640
     ggggtgtgtg tgtgtgtgtg ccaggggcag cctgagagga taaaaagtgg ccaagaagga     32700
     gccaagactc aatgagcaac aatagaattg cttctgccac cgtggagggg ttgatgccct     32760
     gaacccccag acctcagagg ggtggaaagt gaggttggag accttcctca ctggcacttt     32820
     gattttttta gaaaaaattt ttttcaccct agttcggttg ggtgctccgt tttacggggc     32880
     cccaagttta ttttaagaag ccgccaccgt gttatgggcg tgcgcaactg cctcgacggc     32940
     aataatatgt caggacaacg caatagcccc cctgaacacg gggagcagcc cgagcaacca     33000
     cccttggagg ccccaggggc agctgcctcc ggtgctggga ctggcacagc cgaagagatg     33060
     gagaccgaac cgcctcacag cgagcccatc cccatcaaga ctgaaggcga ggccagtgga     33120
     cccccagaag tctcccggcc caacctccaa agcctcggcc aagccatcaa ggaagccgga     33180
     gctggagacc atggagacta cagtccaccc cctgaggaag ccatgccctt cgaggtcgag     33240
     cagtccggct tggggggctt ctggcctgcc caggagcacc ctggagacac ccctggggcc     33300
     ggtgcaggcc ttgagacctc cagcccagcg atcatggagc ccagagcctt cagggagacc     33360
     ataccaagcc tgggaagcta cagccctccg ccagaagaag ctatgccctt tgagtttgag     33420
     cagcctgccc agggaggcag cagccaacct ctcttgcagg tctcagacct tgctccagga     33480
     ggcccaggtg cgggggtctt tagagctcct ccccaggagc cccgagctct cagacctgca     33540
     aacgcaggct tcagaagagg ctgcagccct ccccctgagg aggatatgcc atgtgagttt     33600
     gatggagcag cctttgggga cgacagccca cctcctgggc tcccccgagc tctcccacaa     33660
     atcgacggca gtggcgacag ccagatcgcg ccggtcgcgg tcccgagtga ggtcctcctc     33720
     gctcccgccg cgaacgagcc ccccctctgg atcccaggca gcggcggcag cccatctcga     33780
     gaggctgtca gacctcctcc acacttcgca ggcgacagcc ccccaatgga gatctccgga     33840
     ccccagcgcg aagctggcat cgcccccgat ggggtcgacg acgctcccgt caacgtggac     33900
     agccccccag tcgcgcctga cagcccgccc atcgaggtct ccggagcccc cgttaagaga     33960
     gagccggcgg agggagagag acccccagcc gagggagaag aagccgacat ggaaggagga     34020
     tcagcctccg ctgccgcaga gggaagcaaa gtccccgatc ccggggatgg agccccggct     34080
     gccggggcag cccctgcctc tccagccgcc ggggcagccc cttccgtccc tgcctctcca     34140
     gccgcaggag cagcccctga ggctccagcc gaaggggcag ccccggccac ccctgatagt     34200
     ccagcctctg gggcagcccc tgccgccccg gatgctcctg ccgccggggc agcgccagcc     34260
     gccccagccg ctcctgccgc ccgagcagcc ccagctgttc ctgccgcccg ggcagcctca     34320
     gccgctcctg ccgcccgggc agccccagcc gcccgggccg cttctgcctc ccgggccgtc     34380
     cctgactacg gagcccgacc caagatcggt ttccttagac cccccagccc cgagatccag     34440
     gctgccgacc cgcctactcc gcagcctcct cgcgcgtatg cctggcgggg caggtctgag     34500
     cgctgctgcg aacgctacga cgatgaaatc tcggtcagca gcgacagcgg agacgaatcc     34560
     gacgatggga ccttcggatg tcgccgctgg ttcctgtcca ggcgaaaccg ccgccgccga     34620
     aagccccggc gcaacttgct ccgcaacttc ctcgtccagg ctttcggagg ctgcttctgc     34680
     ggatctgaga gcccccagtc cggaggctca gtcggcccca aggtcaagaa ggttcccctg     34740
     gcggagaagc gcagacaaac acgcaaggaa agcatcgaga agcgcgccca gaagcgcgcg     34800
     gagaagagac gcagcaagct catcgagaag caactccaga acgagaagat gggctacatg     34860
     tgtacgcacc gcctgctgct tctaggtaat gcggcggact ctgcccgtgg agagcagggc     34920
     cgcccgggcg ccccgggagc gggtggccgg gctgccgggt gggacccggg gcctggccgc     34980
     gggaggagtg gatctgggca aaggcgggaa gagcctgcta gaaagttcca gtgaagggcc     35040
     ccaacttagc cccaggaacg ggagggtcct gggtgggctc gggtggcgaa gtatatgccc     35100
     tttaggggga aaagtggtgc cctacaacac tgagggtcgt ttccagctgg acaaaccagg     35160
     gccagcgatc gtaagacggc gccgagtcgt ggggtggggg acggcaagaa aggcggggga     35220
     ttcaggtgag ccaggaactg gaggggaggg ttgtggggtt gctcaggcta ggctggctgg     35280
     ggccgtggtg gtgggttggg gtcgctgggg aaggcgcgtc cccgcctcgc ctggcacggc     35340
     cgcttggacc cagacagctt gttgttggtg tgtgtcggtg tccatattgt gtccgcctgt     35400
     gcatgacatg ctaaagtgtt cgccagttcc catccctggc accccaatca cccgccgact     35460
     gtgtatttgt accggggagt gggctgtctt gtgttgtgcg ccattgcgcg gtcgaaaact     35520
     ttgcgtgttc gcaacactcc gggggtacct gtgcgctggc gctctgcagc ggcagcgtga     35580
     aaactgcgga gaaggtagcg ggcgatgttg gggccactgg ccgggtgggg ggagggggcc     35640
     gcctccggcc ggcctccata acctgttttc tgtctgtctc tctctttctc tcttttttcc     35700
     ccttgcgcta agcgtttcct cacttctcat tcgttcgcca aaccctcccg ccttttcggt     35760
     tgaaaaacca gacactcagg tatctggggc gtccggggct gtgcgcataa attcggtatt     35820
     ctgcacacac ttggcacacc tggggggggt ggaggatgga gggaggagga ggaaaaaaac     35880
     aacaacccac ttaacctgct gcaggcaagt ctggatccca aaccacgcgg ggccgcttcc     35940
     gggggcgggg tgggcgtggc tatggttaaa aaatatgaaa tcatttcttt cctagggaag     36000
     agcctgaggt aagtcaatca tttacacgtt tacagaataa atacagtagg aggggcttga     36060
     tttcaaaaga gaggggtcat ggcttgggag cgaacgccca tcctgtcttt gcaatgcaat     36120
     taaaataaaa ctttttaaaa aatgtttcca gtgtatttta aatgtgtgga caaaatatga     36180
     gaaaactgtg agacctgtcg atgttcacat gcgaattttt tcaagcagct ttagctgggg     36240
     gcaaagaggc tgaaggtaag cttcctctgc atatgggttt gggagacaaa aacaggaata     36300
     accccattgg aagggtccct gtgggggccc tggccctgcc cctccttctc tgtgcacccc     36360
     tgccaccttc caggggcccc tcccctcccc aggaccctcc tcccgggtct cgcagccctt     36420
     ccccggcccc gcccaattcc ccccgccccc ctcccctaga ctctccgtag ctcaaacctg     36480
     gggcttgact cccgttcatc acagcagcca ttagcagtgg tctctgtggc ttaagtgaaa     36540
     agttcaaaag tgaaagttca ccctctccat ttcttgattg tcaaagatct ttcaagggat     36600
     ttcaagatga gtgtttttaa ggctatgcta catctgtttg caaaatgttt tatactgcgt     36660
     gatgccttgt gtttctgacc ttatggacat agtcgtatgc tattgtgatg tgtgcctctc     36720
     atgaatcaca gttttaaacg tgacggtcat tttctttatg cccacccagg gtagtgatga     36780
     caacatcagt tccccgagaa catacagaag ggaggtagct gcacgtgtcg tatgtcctga     36840
     ctgccgtaaa ggcacagagc ctcacatgac aacgtgctgt tttcctgcag acaactgatt     36900
     tttgcgctaa cagttccatt tcaatattct aagcatagct ctgggaagcc aacctgtgac     36960
     gggggtgggg ggcacaattg gggacagaca ggagagccaa gtgcaccatg tgcccttgac     37020
     ccttaattgg cccccttaga tgctggggcc tcggttgcct cacttgtgaa gtggagcttt     37080
     ggagcaaatc ctcacgagct tcccctttgc tccgtgtggt gaagctctct tctggggggt     37140
     tggggtgggg ctggggagca cagtccactt aaatcagggc tggaggctta taccatagat     37200
     gatgcagcac caaccccaca gctggggttg agccttcaga atatcggaag ttccccttgc     37260
     ttatccttgt tccgtatcca ggggggaaac tccccagaat taaaggacat tcgctggggc     37320
     cactctgccg tcatcctggc tctgcgccca ggtcaggccc gtttgggtgc agtgcagtcc     37380
     tgcagactga accctgggcc ctgcctagcg cgaaccgggg ttcagagagc cagcgtgcct     37440
     gctgaggcag tgctgactgt tgagccaggc tactccctga caaggtctcc cttagccaaa     37500
     gtgacaagag aggtgccccc ctcccccgag gtctgcattc ctgactgggg agggggagag     37560
     gaggacactt aggagaaggc ttttcactaa catttaattc ctaacatcca aagcagcgca     37620
     tccgtatatg gacgcagccc tgagagtgta gatccaagac catcctttga catggtccga     37680
     attcgtggca agcagactca tctgttgctt taaaaatgtg tgtgtgtgtg tgtgttcatg     37740
     tctctatacc ctctccattg gtgttgccca tacggcttaa ccacaggaca gggcatcttc     37800
     aaaaggaaaa agataaattg gcagaaatag ataaatcgat agatgaccag tggcatggct     37860
     acagttctgg aagagctaaa aagttgaagc ctttttctta acactgccca ataacagact     37920
     tatttctgcc ttcctattgt cttcttggat aattttggtg gcttcaacat atttgggaaa     37980
     cctcatctgg gtgagagcct tggttttgta aagaacggaa gggactgcta gttagaattt     38040
     cttagcacct gctgcatgta ttgcaggcgt gcaggcaaat gctatctaca ataatggcta     38100
     ttctgccatg accccttatt tatactgtga atctcaatta attgtatgat aatttattta     38160
     tgctaccagg tacaaccttg ctgcagccat ctcatcctgc tggtgccccg tttttctttt     38220
     ctttttttcg gtttagccat tttgccacct tcaaaatgcc tccacggagt tggtgggttc     38280
     agtgggaagg gcatggctta tcaggcccca cacctcttct ttgcctttaa aaatccaatt     38340
     tcctataggc tgtttctcca aaaaaatgtt ttcctataca gccaagttaa ttttgataat     38400
     ttgcctacat ggcatgtact atggaaaact ggcacaaagc ccccgaaagt ggggtttgtc     38460
     ccttttttgt atgttcctgc cgcccccacc cccagcttga aaggggggag cctcagagtt     38520
     cttaggaacc tgcaggagta gtgggtatac acagtgatgg cacgtgctgc ttgtcttttt     38580
     aaaagccttt tcatctagtt gcctttgtcc tttgcttcag ccttgggcca taaaaatatc     38640
     atggggcccc catttcatag gcaaataaac caaaagctca gagatgaaat gtcagggcct     38700
     ttagctcaaa ggctgcaaaa gggaccccaa gtttctaatt cagatactac agtgcccccc     38760
     ccccaaatgg ggcaaggagt catagagcat agtttcaata taaggcatga tcatgatagg     38820
     tgttctgtat gttcttaaaa tcccttgtca gatgacaggt gtccagtctt ctgcttccag     38880
     aattatcgcc agagccagac agctccctgg ttataaatgt ccattgcgtg tccatgaaac     38940
     tcatgcctcc tcatttctgg atacctgtca ttgctgtggc ccagattgag tttccacatc     39000
     tgcttcaact catctgccaa cactgcagcc ttagtttgtt tgtgggactt tttcttttct     39060
     ttttttttaa tgcaggtttt cttgacagtc ttttgaagac ctcctgatag tgtttttctg     39120
     cagggtcaga agcttttctc tctattcagg tgtccactac aagggtaatt taaaaacacc     39180
     gttgactttg tgcccagctc ccctccattt ttagcattag actctaatag atgctagaat     39240
     ctcctggcct ggatctaatg actctattaa aataactctt gctcaataat aattcttcat     39300
     agcgattatt ttttttaaag tactccttcc ttttagtcag ggccaattcc ttctccgtga     39360
     gagttgttgc ataaccttaa agaatcacct ttgactttta tcagagaaag ttggtcttaa     39420
     gcaaaaaaaa aaaagacaaa aaaaaaacca aatttttttt agagaagggg ctctatttga     39480
     aagtctccag accagccctg tgtcttcttt atacacccag tttccccacc agataaaact     39540
     tagcccccac ccccaccccc agcaaaacgg tggctttcca cattccttga cttttccggg     39600
     gctcagcaaa tggaaagtgg ttcctacccc tgtccatttc tttccccggg ggccacggtg     39660
     gggtttgtgc cccctcccca gggtttttcc tggggttcct cttggaatgt ggaatgaaca     39720
     tgccggtagg tccatttcaa aaatcggatt ccccaggaag ggcagctgtt ttgcaaaaga     39780
     gaaagggcag ggccaatcga tggcccaggg ttcccaccaa caattaaaag agtgagtaga     39840
     ggaggagggc aggcgcatgg gccaggccag ggatctcgct tcggccccgg tgcccacccc     39900
     attccggccc cctgaacgcc cccctcagtg gatgtctctg aattagactg aaaggctctt     39960
     tggccttcac attccctttc tggcctgtgg ccacctgggc ctaagctcct catcccttcg     40020
     gggggcgaga gaaagatggg cccgcgtctc tgtctctggg cttctgctga agcatccgca     40080
     ggtccagagc gacaggaact gagatgggcg cgtggcgtgg gggtgggcca aggggactga     40140
     ccgggagagg gaggggcatg tccagaagag tcagaggagg atgtgccaat cccttaatct     40200
     ctctaaaatg gggggcaagg taccagaagg gaccttaccc cgccccctgg aaatcgagag     40260
     acccctttaa cgcagggcct ggcaccgata aatgctgctc cttttgatga ggaatttgct     40320
     tttcttcccg gactttcctc tcccaacgag ggggtcttgt ctgttttcgt gtgtgtgttg     40380
     ctgtcttcgg tggcgctgtt ttgtttgccg tgttccccgt gagccgggcg acggacggcg     40440
     cggcctaggc acccattctg tttctctgtc tcagcatttc agaagccact ctttggcccc     40500
     gttttgtgcc tcaggatcaa cccgagccgt agaccgcgga caccttgcca catgtgtgag     40560
     cgtgtggatc cctgctgggt gagcggcccg acgcggaggg gccttctttg tggtttttaa     40620
     cttgtcctga gaaagggtca cccgtcccct ctgccgccgc cgctgccgcc tcctcctcct     40680
     cctccttgcg tgacggcccc tttctgtaaa tccgctcgct cctgcgatgg agcctgggga     40740
     cctgagcaca ggtcgctctg tgcttgtgcc acatgcaaaa aacaaaacca agcttgtctc     40800
     tagttttgcc tcccgacagc cagatggtga cgcgggccag ccacggggga cggcgaggag     40860
     gagacctcca agaaccaggt agggaacacc tcgcaacagc cacgttggac gtttcatgac     40920
     gggggggggg tcccgtgctc agccccacgg aggatgcggg gtctccaggg aggggcgccc     40980
     ggctcccggc gcgatgcctg gaggaggttt ccgcaggcgg tgccgggggc tgtcaccagg     41040
     gcgtcgggta actgatcggt aactgatcgg tgatgaaaat gaagggcgtg tgcctgtcgc     41100
     acttacttag agggaagaat cccacggggc ctcgcagggt aatttgtgaa accccaggag     41160
     aattcccgag cgtgctgcct cgcggagctc tgcccacaga acgtgaacgc cggcgctcgc     41220
     tccgtgtctc ttaatgattc agtttggggc gaggagagag gtagcaaggc agcaattgcc     41280
     atcccatccc gaatgtgctg tgactcagtc ggggcttccg aagttgtcac acttacgtgg     41340
     tgtgtgggac actgcgagca cttaaacttc ctttcatgag ccgggaccgc ggaggaaggt     41400
     gtctggcccc cactttccag ggcgccggcc gtcgagctcc gtgtatccag gagcctctcc     41460
     cctccggcca aagaccatgc tacctccctc ctctttgctc cctgaaggcc tctgccttgc     41520
     ctcaaactga ccgcgagtcc gcacacggct gtgaaggtat ttcttgcagg cagcctccat     41580
     tcaggtaagt tcgcagccgt ggggtgtttt tggacatgaa agcgtaattc gtaagagaag     41640
     gcgcaagaac tcaaagcagg cctcgtggtg gcccctggcg accaggtccc ctgtcttagc     41700
     tactgttcct cccagcaacc ccgaccttgg ggaccacagg cctgggcctc agtttcttta     41760
     ggaaacgtag cccattggcc cctttcagaa agaaggcaac cccacctgtt gagagtaggc     41820
     ggtggcactt gggaagtgtg gagctcagac gcaccctttt aagagatgcc acgtgcttct     41880
     cggtggttct gtaaggtaac gcctgcgttt tgtggcctcc gtgggctgct aacatcatag     41940
     aaagtgtcca tcttaattcc ttatagccgt tccctgtctg ggtcttttag gactccaaga     42000
     tgcttcatca acttactcct aaaatcagac ccgtcattca ggggtccttc tgcccactgc     42060
     ccccacaaag aggaatttta ttcatgactg cttctggagg ggcccagaga tagctgctat     42120
     tccaggtggc cactagatgg tgagatgaca caggcagaag aaaggtgtca catccacagg     42180
     aaaaaacgag agaggaaggg aagagccctc agaggcagag cagggtcccc tccaccttta     42240
     ccccccccag tcccgcccct gcccccagac aaagcctgga tttaatggcc cccaggcgtc     42300
     cgtcaaacct agccttttat tgttaagctg tgacttttcc ctgttgagtc tgggctgggg     42360
     ttttagcatc tccggggggc tctgtctaac cagggggacc gtaactccta cccactggat     42420
     gccaggaaca cacacaccca cagcccccca tcctcccacc ccacccacca ctgccacata     42480
     cacacacagt gtgacagctg aaatgccagt cattgccagt ggcttctggg aggtggggtt     42540
     gggtagatgt caccccgagt tgagaaccgc caccctaaca ttatcaacag ccaattctgg     42600
     gggaggtgca gaccgttcct gctgttgctt gaacacctta aaagttatcc tcagagagac     42660
     ggtttactag caacccgcca gaaatggtga ttgcggtgtt ggtgcttcct ggtagaaatc     42720
     attcccaaaa tctctgaaaa gaagggacct aggagctccc tggtggctca gtgggttaag     42780
     gaaccagcgt cgtcactgct gtggcgcagg ttccacccct ggcctgggaa cttccacacg     42840
     ccgtgggtgt ggccagacaa agaaaaggaa gtgactagaa ggtcaccaga tgaccctaag     42900
     tagacgagaa aagggaattc gtccagggaa gtaaatgatg aattggccca agactgagat     42960
     taaccgagtc gggcctggag ccaaccagtg ggctcagtga accagggctt gcctagatct     43020
     taaccctcag acgatcacgt ccgccactca ggggtccttt gggggccttg gtccacggca     43080
     ggcagggtct tggccttgtc tgccgtgcac tgtagagaag ggggggccaa gatgacaagg     43140
     accagcacta atcatcgttg ttatattacc attattgttg ctcattagtg ctgtcattgg     43200
     tgctggcact cgttatccca tggctctggg gcggctgggg ccccactgtg cctgtgtccc     43260
     cccgacacaa gtgggacctg tcattggtag tgtgtgccca ccacccacag ggtgtggggc     43320
     ctgccagggg cgtcctctcc gtcccaggcc ctcagggaac cagcccatag catagaggtc     43380
     ccccccgcct tggagcactt gaagtttcag ggcaggaagt gacgcagtgg ggcgggtagg     43440
     ggggccgtgg aaggaatgcc actgaatgac tatgctgaga aaggcaaaac tgatccttta     43500
     actttgtggt acagcagaaa tgttcacagc cctgcgaatg agctgtactt caatgcaact     43560
     tcgaaagatc ttttagaaat aaaacatcct tgtgtcaata cataacccag ggccatttcc     43620
     cggtcaagag agttgcactt ggttttcaat acgatggcca agccctccac gcccccaccc     43680
     cctatgctgg gacagattct ataaccagta tcttggaata atgacaatag gaatacacga     43740
     ttttattttt aaatagtggc cgagtccccc agtttgtacc tatccagcct ctcccccagg     43800
     taacccttct gggagcagac agttgcttcc ttcttatatt ttgagccgca gatatttgca     43860
     tttttgccct cttctgatct tctagtagag ctttcagatg ttactgatgc atcagagaat     43920
     tcattttttt ggacgaaagg tttttttttc cccttagaga ccttggaatt tgtggtcttt     43980
     tcacttaact gcaaagtcta gaaggaaaaa aacaaaacaa aaccctactc tccacgccag     44040
     acagctgtat gaatttagac ttttgctttt actgtcaaga ttacttcagg gtggagcctg     44100
     atcggtaatt tgataaatta tatattggac atgttcagtt gaaaatgcca ttttttaaaa     44160
     taggttccaa gtttagttaa gcaaagtgcc tccaaagatc ttattgcaga gtcctcaaaa     44220
     cgacacacgg catgtttttt gagtgttgat tttgactttt tgcctgagac caagtgcaac     44280
     atcttttcaa ggaaatgctt agaaggctcc ggccagaacc caaaaacaaa tggccagatg     44340
     tcaggggaaa aaatttttaa agttgggttg ccagcaaacg aatagctatt cctatttaaa     44400
     cacgtaagtg atttcatttc ttcctttttt caccactcga agggaagcat attagaccct     44460
     tctgttttgc caacaactag ccagggctgg ttttaagatg gacacttgaa ggaggttccc     44520
     ctttccaaat aagagtctcc agacgttttt ctggcgggac ccggtcaccc cacagcaccc     44580
     acaggaaatc cttatccttg ggcggtttgg gttctagtgg gagcctctgg tgaccactgc     44640
     ctgtaatttt tccaagtggc tctgattggg gagggggtgg gcagaggagc cctagcttct     44700
     ctgggggggc accaggatgg tggacagaga tcactgggta atattagagg gttctcatgc     44760
     ctgggacctt ggttgattcc catgctctag tcaaggagtc cgtgcatttg ccaagtgaca     44820
     cccagaaaag gccaaatttt gattctggaa attcctgaca agggtccatg ttgtgataac     44880
     tctgccaggg tcaggggaag ggcttcagtg tggtgggtgg tcccagagac agccggggag     44940
     cgggggtccc ctcggtgctc agctttaggc accaagaggt ccaatcccaa accccacatc     45000
     cttgcagacg tcttgtcctg aggctcaagt ccacagtggc agaggtctct cctctcttct     45060
     tctggcccta aacccttgac tccccggaga cagtgtctga cgccccaaca ccgggggaca     45120
     cccttccttc tgccaggaac aaggcaggag tttaggaagc tgggatcccg acagaggcca     45180
     ccagggctgc cttccactga gagagggtgc cgtccccttc cccgcagagg tccgcccagc     45240
     tcagaaacgg ggaagccgag accagcctct caaggaattc cctcatttct ttcttgattt     45300
     ctcttttctt tctgcacctc tctttctcct gagatttaaa aaaaaaataa gattcttatg     45360
     gggagggggt ggtctgagca agaaatcttt tttttttttt ttttaatagg gaaagacatg     45420
     aaaaccccaa ctctgtaggc ccaggaagca gacactaaaa taaagcaagg ctgctccaga     45480
     ctggctggca gatggcgctc ggcttttact gttgagagcc tggcttttca aaattccctg     45540
     tgagcgggcg gaaggcacag ctccccaagc cccctccgct gatcctcctt cccagggacc     45600
     cagccccgcc cccaaggccc agggccagct ttaaaggttt tccagttgaa caatggatat     45660
     cggaggacag atcctgtcac ttggaactag tggctctgtg agaccctagc cagggcagaa     45720
     aacacactat cagagtgacc tctgcctccc cagcccgcct gcgtgccctg ggccttccgg     45780
     gaaccagttc tggggccttg ggcaaatcct ttatcttctg ggtccctgct ttccccatct     45840
     gaaaagtgag gggtgtgtcc ttctcactgt aaaacttctt cgagtctctc ctaaaaagtt     45900
     tgactagaac aggtatgcca aacaccccct ccctgacgcc cgccagcccc gcagacacac     45960
     actctgccct ttcaagttgc cttccaaaat ggcagattgc acaggaaact ccaggcctcg     46020
     ctcttgcccc tggattcata attaataatt tctgggtacc catcacagaa gaatctttgc     46080
     aggaagcaga ggagtgtggg acttttttct caccccaatc gagagctaga aaagaactcc     46140
     agatgtgggc agaggtccct ttttccatca gggaaaccca gggagccttc ctggaggagg     46200
     tggcatttga gacagtatgg gaggatgcag ggaaatgagg gaataggatt tggggtggat     46260
     gtgcgatgct gtctcagaac atactggctg agggggactc cttatcgctt tttcatccat     46320
     gagcacgtcg ttggggtttg agggtctcgg agatggcagg gctagttctc attttccccc     46380
     ctctaccgcc ccccccccaa cctctcaggg ctgcaaaacc cctgtgtgct aaggagcatg     46440
     cttactagga agagtcttcc cagctaagtt gggacccctg tcctccatcc caggcctgac     46500
     cctggacttg ggggaaggtc acttctgcct tgttgaggcc aagtctccag gggaggggag     46560
     gttgcctctg atggcggctg gggccaggtt cctcggttcc aaagagaaca ggcatccttg     46620
     ccactccccc gccccgcagc agctgtaaaa tcatgagctc atctgttcga gaagggcctc     46680
     gagaactcct gccagggcct cccgagtccc ttccgtcatg ggaacgtatc cgttcccagt     46740
     gaaacctgcc cgccgtgccc atccttagac gcgtcccctg ctctctttct ttcatagttg     46800
     aaaaatcaaa ggacctgata aaatacatca acgtcgggca aaagttttcc cccttctgcc     46860
     atgaaaatcc tcttctttaa gttaacaaac tttattccca cattcttcgc ctacacgccg     46920
     catcttctgg ggcgtctaga aagctttcct taccttcgtg ctcgtcaccc cccccccacg     46980
     tgcagcccac cccttggcca ggatgcaggg gcgccaggac tctgggtggg gggcgcgggg     47040
     aaggcagggc aggtgggctc ccccgtgtcc ggcccctttt ctgggccgta gagcgcctcc     47100
     cccaccagag gtcagcagag agcgtggaat gcctgggaag ctcgcaggaa gtgggatcac     47160
     ttggaatttt ctagatgaaa tgttaggaag cgcaagggaa aaaagccgca ggtttttgcg     47220
     gggagggggg cggatctcgg ggttggggtc tcaaactgtg ctgggtgcca gggagcttgg     47280
     ctttcacacc cagcctgcca ttctgggctt gggggcctgt gcatttggtg ggtgtctttg     47340
     cccggttctc ccccctccac gacacacacg cctttttcct tctgggggcc atgcccgctc     47400
     agctcagtct ccccgcccca aggccccccg gtgccaggcc agccccttcc ccttccctcg     47460
     gcgctgggaa cccgcacccc atactctccc cggccccttt ccctttttct tccagaagtt     47520
     gtacttattg ttaaaatgac attctaatat tccaggaaat cccccacccc gcccttatcc     47580
     tgtccgggtt ttctatctcc ttatctcccc ctgtcctctg cccagatgta tggatgtctc     47640
     taaagaggat gcgacccgcg ggcaccactc catctcgagc cccccctgcc gcactgactt     47700
     ccttagcgct tttcccacgt tgcgcattgt gtcctttcgg ggccggtgtc cttgctcagc     47760
     ccttctgccc gggttgcgca gggggcaaag ggacccgctg cctttgtctt tcctcccctg     47820
     cacgtttgcg aacccccctg aggttaaaaa gcagctctcg ccagcctgtt ctttcctgga     47880
     gagagagagg tgccaaagga aggggagaga gaggggaaca caggagtgaa ataaaaagtt     47940
     tgacagagag agaagggaga gcgaaaaaag cgccgttagt aaactgggct ctgaacccag     48000
     gaacccaaga cggctgcctg tcctctagga acttagcttc tggaagggaa gcgatctgat     48060
     caggttgcaa gtcattgaag ctgcaccagg cagagctgga gagaggccag ggccagcggc     48120
     cagcgcagct gaggggccag gctggctggg acctggccga ggagggctgg ggaggcaggc     48180
     ccaggagtcc agggcgggag ggggcatcca ccccactgcc cgtgctgtcc cctgtgggtc     48240
     ccaggagtgc agggtaggac gagcaaaggg ggaggctgca agttgggggc cagcaccaag     48300
     gcccctgccc cccctcccca cggtcccctg agctctgacc gctgcctgct tgcccagtgg     48360
     gccctttctt gctcccccaa atgttcctct ccacattcta aaatgatggt tccatttttt     48420
     attttatatt ttattttttg acggagtcct ccgccccctt ctagcacaaa ctcgacgttc     48480
     tgagtgtctc tgcaagcctt accccgccga gtggttgggt tgtaagaaat ctggccccct     48540
     ggggaccttt ttggcttcaa gaaaaagagc ccatctttgt gagttctttg gtttggtggc     48600
     tcctcacaac cagacaagct aaatctgaag ggtgaaagca aactccctgt gcggtaggca     48660
     cacatcttag atgcggagga aatccttagc cgtttacagg ttgcttgtcc tcgagaactt     48720
     ggctccggct agacccagta tcagcattgt gtgctttttt tttttttctt tctttttttt     48780
     ttttttcctt ccttcctccc ttcctcttct tccttcccca cacttttgaa aaacaagttt     48840
     tattctcctg ggtatgttca ttagagagag acaattctag tcagtgagga ggggggctgg     48900
     ggattctgca ggagacaaga ttgattgctg agggcttggg agggggggcg cccagtgcac     48960
     gttataccca aatcactcag gctgtttaaa aaaaaaaaaa aaagtgcaac aggagagcag     49020
     atttcggctt cctggcgttc gtggggaaaa tattccgtca gctgcctctg tgtcctgtgc     49080
     tttattcatt agctcaagtg aaaaaacaaa gtcttgtcct aatttgtggg actgggaccc     49140
     cattctcgca agttgggcct ttaagggggg aaaacaaaca gcacagctca cggaggcagg     49200
     agacgtttgc tgcgttgacc gtgatgcagt ttgttctcaa gggttaactt ccctctacca     49260
     ggaaaagttg acacttttcc caagcccccc cccccccagt tagaaatgtg tcactaattg     49320
     attggagcta aatttgcatt gcgttagacc cagcaaaatg gccgattagg ggcccatgag     49380
     ggaaaaacaa ttgctgtcct aagagccagg gaaggggact cacccccaat gtgcttatta     49440
     actgggcctt ctgtgacctt ttggaattgc tgggggacag ggggtcctgg ctggccttca     49500
     gaaagaaaga aaggatgagt ttgggggaag cgtttaatgg gaattgggca gaaaatgaca     49560
     tgcttaaatg agagaaatca tggttccaca tgaaaacagt tgtcacaaat taatttttcc     49620
     aatttttgac tcttggcaga gctgaggttt acctcatgcg tagatggtgt ccagcttggc     49680
     aaagagcatg ggatgctgcc cagttcttgg tgcatctgta cccattttcc ctcactgata     49740
     ggtggtttcc taattgaggg gttcaggtgg atgtcaaaat ggctttgttt cccttttgcc     49800
     tttctagtag catctcttaa cgtgcagcag ccacctgtgc gtctgccagg cctctcagaa     49860
     ggatgagatc cttgccgggt cggtgagtct gccttcgtcg aggcattttc atttattcat     49920
     tcattcactc agtgtacacg gattgagcgc ctaatatgtg cccttcccca cggggaagac     49980
     gagggcataa gacactgctg ctccctttgg tgggttttat agggaagttt aagacagtgg     50040
     gtggtctcca ccgggtgact aaatagggac tagacttggg agctcagacg ggacggaacc     50100
     atcatcaaaa aacagacctc agcagcctcc caacacgcct ctggcccagt cgagcaaacc     50160
     aaatcggggg ttttgtagaa gcgtcgcgtc ccggtaacga gactgcagaa aacccaggga     50220
     tctgccgggg agaacccagg ggctgtgtcg agacaggctc acccgctggg actccctcgc     50280
     agccccgacg gagcctctgc gggcgcaggg cgcccaccag gccttctcgg gaggcgctgg     50340
     cggaggctcg ctgggttccg aggctgggct ggcccgcgga gggaccaggg tcttccaggg     50400
     cggaaattcc tcctgggggt ggcccccaac gtgtccaccc aaactgaggg tcctctctct     50460
     gtacgtagga tttgtgcgaa ggatgggatg ggaaaatgct gtctgtagtt tgcagtcagg     50520
     gctcctgatg tactgtggag gcttccgtct tagctctggc cttccctcca tcttggtttc     50580
     catcctccct cttagatcct ggccttccct ccatcttagt ttccgtcctc catcttaggt     50640
     cctggccttc cctccatctt ggtttccatc ctccctctta ggtcctggcc tgccctccat     50700
     cttggtttcc atcctccctc ttaggtcctg gccttccctc catcttggtt tccatcctcc     50760
     atcttagctc ctggccttcc ctccatcttg gtttccatcc tccatcttag atcctggcct     50820
     tccctccatc ttggtttcca tcctccctct taggtcctgg cctgccctcc atcttggttt     50880
     ccatcctccc tcttaggtcc tggccttccc ttcatcttag tttccctcct ccctcttaga     50940
     tcctggcctt cccttcatct tagtttctgt cctccatctt aggtcctggc ctgccctcca     51000
     tcttagtttc catcctccct cttagatcct ggccttccct ccatcttagt ttacgtcctc     51060
     catcttaggt cctggccttc cctccatctt agtttccatc ctccatctta gatcctggcc     51120
     tgccctccat cttagtttca gtcctccatc ttaggtcctg gtctgccctc catcttagtt     51180
     tccatcctcc atcttagatc ctggcctgcc ccccatctta gtttccatcc tccatcttag     51240
     gtcctggcct tccctccatc ttagtttcca tcctccctct taggtcctgg ccttccctcc     51300
     atcttagttt ccatcctcca tctatagctc ctggccttcc ctccaccttg gttctaggcc     51360
     tccctcttag gtcctggcct tccctccatc taagtttccc tcctccctct tagatcctgg     51420
     ccttcccttc atcttagttt ctgtcctcca tcttaggtcc tggcctgccc tccatcttag     51480
     tttccatcct ccctcttaga tcctggcctt ccctccatct tagtttacgt cctccatctt     51540
     aggtcctggc cttccctcca tcttagtttc catcctccat cttagatcct ggcctgccct     51600
     ccatcttagt ttccgtcctc cctcttaggt cctggtctgc cctccatctt agtttccatc     51660
     ctccatctta gatcctggcc tgccccccat cttagtttcc atcctccatc ttaggtcctg     51720
     gccttccctc catcttagtt tccatcctcc atcttaggtc ctggccttcc ctccatctta     51780
     gtttccatcc tccatcttag gtcctggcct gccctccatc ttagtttccg tcctccatct     51840
     taggtcctgg cctgccctcc atcttagttt ccatcctcca tcttaggtcc tggcctgccc     51900
     tccatcttag tttccatcct ccatcttagg tcctggcctg ccctccatct tggtttccat     51960
     cctccctctt agatcctggc cttccctcca tcttagtttc cgtcctctgt cttggatccg     52020
     agctgccccc ggtcttagat cctgagccct gagccttttt ttctaatgca aatagagata     52080
     gtcgatattc aagtagtgta attaattccc cgtcgtggtg gagagaaaat tgccctttag     52140
     ctgcagaact gaatccccag ctttccagtc gcctctccct ggccctcggg agccgcctcc     52200
     tcggggctcg gcatccgacg ggcgactcta gaaagtccgt gagtcccaga cgggttggga     52260
     gggtctgggg tcggccaccg acgagggcgc ctccgtgacg ccgcgctcag aggcggggac     52320
     tggctctcgg cccccgcggg tcccggcggc ggcgcgggtg cggccttccc accgtcctca     52380
     cctgagcggc gagggagacc cattttcagg acgagaagtg gagcttgttt acccactcag     52440
     agaagtgcgt ttgccaagtc actttatcac agaggctgcc tctgtaaacg aattagttct     52500
     gtgcgattgc ctccctccgc cagccccagg ccctcccgag tccggacccc tgtgtccgat     52560
     gccttgaaag cgacggccgt cctggggaag tgatttgaaa gccgtggggc cacgaggcgc     52620
     aggaaattgc gccgaccccc gccgggcggc cgcagggtcc ccgacccggg acctggggcc     52680
     gggcacctcc gagagggggt ctggccaggc ctcctcacct ccctgcaggt ggctgtgttc     52740
     tgttcactta atcccattag ctggcagcgg ctgtggggct ccccttaagg gacatttgca     52800
     ttttaataaa gggctctctg aggccagagg ctgagagggc cccattttta atagtgcagc     52860
     agcattctaa ccagaagcgc tgggggggac cgggaggggg ctctgggcag tcggcccccc     52920
     cgccccctga gcccgggacc ccccaccccc caggtaccga tgggcagcgg tggcggcagc     52980
     ggcgggaggg ggccccggtg gcagagtcag gtccagatcg aagcttcggt gcctgactca     53040
     ctccggctca ggccggtaat aacaagcccc gcgtttttct ccatcgtcca ctgctctgac     53100
     acacagaata gtcaggaaat aaaagatctg agtcctatac agctgctttg ctttcttgaa     53160
     aaaaggagga aaaaaaaaag tcgggggtgg tggggagaag agagcaagga ggcatgaggc     53220
     caggccggca aataatgaag cagcagagcc cagcttgttg ctggcttgtt acataaacag     53280
     ccccaccgtc ccgcgtcgca gcccaaggag aaagtggtgc ttagtgatac ttgggttggc     53340
     ttcacacctg agcttggagt tactcagagg tgcattaaca actaatgatt caattgaggg     53400
     aggcctggat tgccattcgg agttgccaga tattagcata cccttctgga aacccggaag     53460
     cctgccaatt acactcccca gtgaaactct aaaggggcct ttccaagatg catgatattt     53520
     aggaagagga aattaagcta attttgaaag ctcctgacat gtttccttaa aatcgaacta     53580
     gttgaaggct gggatgaata ttatgaattg ttcacatgat gcgtgtttga atagatgtca     53640
     tggattccaa gggcacagct cagaacgact cagggcctgg gttcctttcc tttttgtttt     53700
     tggtctctcc ccccccccac cgcacttttt ctcctgaagc acaaacacag tctctacctg     53760
     aaagggcctc tgcagaacgt tgtctggtag caaacaggac agagccacgt tctcccaaga     53820
     ggagacgagg tgccatggcc aggaccgggg agagagccct gggccctgcg tggcggccac     53880
     aggcgggagt gtcacccagg ggctcgcagc cctcgggggg gggggggggc ttttaattat     53940
     gcgtgtaagt tccagctttc tttccaacac aaacacgcag gccggcgagg acattaaata     54000
     tgcagccggg ctttccctct gagcgaggcc ggcgcttgga tttttatctt cccaggtcca     54060
     gaacctgttt acttccttcc aagcggcttc ctcctgcccc ttagataagt cagcgggagg     54120
     atcgacctcc agacgttgct gaattcgcga cccctgacag tgactgggaa cgggcagcct     54180
     ggcgtgggtg gagcagcggt gatgcagcct tttgccgcag gaggagaggg ctccgcgcga     54240
     cccgggccct gggccctcgc tgctgccgca gaggccagct ccccagacac ccatccctcc     54300
     ccaccttccc cagcttaggc tcctgcttag caccctccgc ttccagccac cgtttccatc     54360
     cccagagggc ctgcgttcag gcagagaaag gaccacttgc gcaggtggga ggagagggaa     54420
     gcagagggtc atttcagctg cggcaaaaat cagccatttt ccctgacagc actttaatta     54480
     taatgaaaga acaagatgtt tttcggtttg tacggaggag gcttgaggtg ggggggaagg     54540
     gggctctgaa agaggagacg gatggtagct tatggagctt ggcttcggag caggctgtca     54600
     ccgcgggtga cagatacact tagggaggga gccaagcccc ctccccgcgc aggggcacca     54660
     gtgctgcggg tccagtgctg ctgcttgtag ggggcgtggg ggggcgagcc cagaatagga     54720
     agagtccata aggcaggact caggcagctg ctgggtgcag gccgaggggg agtccagctt     54780
     gcgttctgct ccaccggctt tgaaggcagc cgagaggttt tcggtgctcg tgcgtgtcat     54840
     tgctgacaat gggggtgggt tgttgttttt ttttcaagtc aggtgcttgg ttcaaatgga     54900
     tgttcaagga cctcgcagct gcagaggagg ccagagcgag ccctgcaggc ctggggctgc     54960
     tgtgatgaag gcaggggcag tgtcttagcg acgggaagag agctggagag gcagatgtgg     55020
     tcggctgcgt tcagcccagg cgagagtcag gcacagggcc cggtttccct tccacttccc     55080
     cgggctcgtc tgtcatccca gccttgacct taggcactga gcctacagga agccgcccct     55140
     ctggccccat gagttgaaca gcccctgaag gcggccctgg gattcaggct ggcagcgtta     55200
     ggagaaaaat aaaggtggat tctacagtca cagctgagag cagccttagc tcctgggatt     55260
     gggggatgtg agcaagagag cagccttagc tcctgggatt gggggatgtg agcaagagag     55320
     cagcaacatg cacccaggga tccccacggg tcgccagggc tggaggggca gaggcggggg     55380
     aggcaaaagg cacagaagat gcatgatctg ccgccctcag ctccactgtc cgttgcaggg     55440
     ctctctcctg ccctggaaac gccgagagcc ggctgcctga gagcctctgg cccagaggcc     55500
     cccagacaag ggaggtgggc tcaacctgct catctcggtg gcagcttttg tgtagctcag     55560
     tgacccaacg tctctgttaa aaatgacgtc gcagctgaga ggttcacgca gccttgcagg     55620
     aaaacaccca ggggcactgc tctccccctg cccacggagg ctccctgtgt ggcaagttct     55680
     gccacacagc ccgcgatttc tccggggtcc cctgccctcg ttgtcacacg gctagggaca     55740
     cctcaggggc gggtgattat gaatgggcag tgggtaatga aacagcaggg acttggggct     55800
     ttgtgggagg tgagtgatgg gcgggtacga gtgaaaccac tttgtttcct gcgtttgccg     55860
     agaggcttcg cagcacaatg cagcatccgc aggatctgat gggggggcag tggtcctggg     55920
     acgggagggc ggtcctgcgg ggccaccgag atggctccct tctctaggac aactgcagtg     55980
     tccccatctg agcccagccg caaggcagat gctttatcta gacgcagggc gactctgtgt     56040
     gtctgctgca gagaaggagg gaccatgatg gtgctggttt cggtggaccg gtggaagagg     56100
     aaacatgagg ggaaaaaacc ttccccgttt tcccttctct gcttgaacaa caatatgagg     56160
     ggctggcagt taggtcggga aggagaaaga ggcaggagca gcatcgtaac ttaggactga     56220
     aggggctctg tgctgtttta gagggatttt cgtttggaag gaaaaaaaaa aaagacaaat     56280
     aagacacaga cgcttttgct gagtctgggg ggtcacagcc gcccgcgtta ggaggctgta     56340
     ttttttcagc gtcggcatca ggaaagtgag gcgtctgtcc tctctccgaa ataaagaggc     56400
     gctttgagag ccaggaggag ggtcgttgtc ctgtctgagg ccgtggtctc atttttcacg     56460
     tcagaattaa cactggttaa gatgagatgg cttcttaact cagaccattt acattttaca     56520
     gagtgcgaaa aaagagggct ccaagcccct gtctggcggc agcaaagcca aataaatagg     56580
     aacgacacga ccttttaaaa aacccattct taatgccatg gcttcgctct ggcagatttt     56640
     gagtccttta gcccaacctg aaaacctcgg attttcgtgg ctggccaaag ggaccgcttc     56700
     ctactgtggc ggggctcttt cgtcccccac agattcctct tctgctgacc tttctgactt     56760
     gagtttttat cttcttgaca ccgaggcatc caatccatgt ggtcaaaagt tcaatcttga     56820
     aaaaagcatc tggttctttt gtccacagat aggcagtctg tctgacatgg ggagtcagct     56880
     catccaccca cctgccctga ccccccatgc agccccagca ccgtgggtca cctcttaggc     56940
     atctgagggg acaggcctgt gctccaaggg gttgggggtg gggggcggac gaaggtactg     57000
     ggccctctgg ctctccctgc cgtggccgcg actggagcgc gctgcagcgg ggcggtgggg     57060
     acggggagca agccggtcct tacgggcagg tgcagggaag gagaggcctg cagaggggaa     57120
     tccgcctgcc tcggccctcc gcagcgtcct tgtcaggctc gggaccgggc aggtgcctgc     57180
     agccatctta gaagggagag ggggctgaag ccacctgccc tccttttgtc ctcggctgta     57240
     accagtgagg agtaaggatg tgaagaggtg cttttgtagg aaaaggagaa aaaaaaaaaa     57300
     aaaggaggga ggcatgattt gcttcttttt gaaaaatccc ctcccggtcc ctttccctcg     57360
     cagagaccag agtttctacc aatgcccgat caatgtcacg tctctgaagg gagagcgtga     57420
     ccgctgggtg accgcataga cgcatcaggt gttgggagga aggctgaggc agggtcccct     57480
     tattataaat tagggtgcct tttgtttgtt tctgtggggt tttcgtgctg ctagtaacat     57540
     ttttttggta gttttgcaga cattacacat atatttttcc ctcagtatct cttctacttg     57600
     gcatccattt tttagaaact acatgtttgc tgtagagttc tagtcttgag ttttctcttc     57660
     tctaattctt gctctttttt atctttgacc aagggccccc cctctgcctt ccgcaccctc     57720
     agtacgtcta ggggacgggt ggttctgtca ggttgaggaa gaccttgatt gaacacctga     57780
     aagactctgc aaggtgaatg acctgtagaa gtttcacatc taagatgaaa acagtaggtg     57840
     tccttgggat catactgctt aggccacagt ctggtgtttt ggtttttgtt ttcacatttt     57900
     gcatctaacc aactcctggg gcctctttga aatgatgtgt ttagactagt tactgattca     57960
     attaatagat gtgtttagac tagttactga ttgaattaat agaaaaccag ttaagaagtt     58020
     cacttttaag gccgagagtg actttcaatt accctgctct ggggcgcccc catgaggcgt     58080
     gtgctcaaaa taacacatga taggaacttg agatctagtt tttctagact ttgagatgct     58140
     tctaatggtt atgagtaagt agagtctcca tttcatttgc agattagatg tctttgggtc     58200
     cgactctgct ttataccagt gtcccttgaa ggttctttca cagcaaggct gttcgaagga     58260
     gccaattatg aaaaaatcct ggtactctgg tctttgcaga gtaaggaagc aggaaacctc     58320
     ctgctgcttc aaggtggtcg atgccttccg gtatcatttt agtgagaagc atcctcatgg     58380
     gaaccagccc cccaaatggg agatgcgtca cctctggagg gggttctctg tccatcagcc     58440
     gatggcacca tcttgccaga agatagggac ccggggtctt tgcggttggt gggacggact     58500
     gaggagagat tcgtctgggc tcctccttcc tcccctctgc agaccgggac accctgtgac     58560
     gctttgctca ggcccgtctt tggcatctca gaggtgcccg cgcaccggcc gatgcgacac     58620
     cagagctccc agggttggtt tgttctatag cttcactggc cgtcctccac agctgtcaga     58680
     gcccctcaaa aatcggctcc tttcattgag cacctgctga tttctcacct gggttcggag     58740
     gaaggggctt tgcgctgtga ctcccagacc taaggacttc atgccgtgcc cacgtgaagg     58800
     gctggttttc tagagttttt ccttcttagt gttaggtcac tgcaaccctg ggataaaaat     58860
     aggtctaatt agtatttaca gattagactg catttctagc tttgtgccac ttcctttcat     58920
     aataccaatt ttggtgacac atttcctaga atcccaggct ggcttcgatt gctaaaatcc     58980
     tccaagagcc gattattgga cagatccgtt tgcccgaaaa cccagagggg tttggtcctg     59040
     atcggacctc ttggttcccc tgtgccttgt cctctgcctt ctgaggttgg tcctgatttt     59100
     cttgttttct gttcgggaag aggtgactcc attctccccc aaggccgacc tttttgagga     59160
     ccggctgggc acatgtggtc ttctgaggcg aaaggccctt tcctgcctgg ctccagggtc     59220
     cccgccaatt aatgggggga agggggattg agttaggcat cacaattcca gccaagctgg     59280
     gcatccatgg agtacacctg tcacttgagc cggtgtccaa aaatccagcc ctgagggtca     59340
     caactggagc gttatttcgg catgagcaat tcagtattta atgttcctta gaaaaataaa     59400
     tccttccaag cagctactgt tcacctgtta acccttagcg gatttcatag aaggagggat     59460
     gaggtgtcat ccgtaatttt cttggccagc agccctcgct ttccgatccc gtctttaaaa     59520
     aaccgtttct tgtgtaacgg agaacagggg ctgccaagac cgcatccgcg tattctgtct     59580
     tttcatttca tttctctttt cacctgcaga gtacatagcc tttgtactca ttggcattct     59640
     gtgtcttttc tcttttcctg gtagcttctc tgagccctgc catggttggc aagtctaaat     59700
     ttacaattag gtgggggggg ggggttccat cgtgagtcag atcttctctt tttatgtaaa     59760
     tggcccgcaa agcgacacac atttcaaagt tgtcctccca atagcagacc ccttctgtca     59820
     cctgggcctt cataaatgaa ttgtccatct gcaattactc cacgtagcac acatcgtttg     59880
     aaagctgagt tgtctgtctg ccttgccttc taaaaggaat tggctatatt taggttttca     59940
     agcaagcctt ctttgtgttc tttgtaaagt cagcgacatt ctttcgattt ttttggtgta     60000
     attagcacaa aaggagccgt aatctgagaa ggtagtagag actttggcgg ctgagagaca     60060
     ggaatgtcca agaaagcggc aggaatgttc tagaaagcag gcagaggcgg cttttccagt     60120
     tctgggcggc aggcagggac cccaggctgt ggctcatgaa aacatcccct tttcgtcccc     60180
     cagactgact gcaaacgcct gatgctttgg ctggaccgct cttccttcct cataatttcc     60240
     agaggtcagc agagacttta gaaagccaca gtgccatcta ggctccgccg agttgcgtgg     60300
     gcttttgtgc caggctgggg agactgctgt gaatgccacc aggcccctcg gtaaactgcc     60360
     cagggagagg ctgaggggca gcctctgagc tccccggcaa acactggatt ttgaccaaat     60420
     agaggctaca tggaaactgg ggggccctta tgtgcagcca tgtgcaaagg aggaggcctc     60480
     tctgggggcc aggtctttgt gcccccgccg cccccccaaa ccagaaactc agggaggaaa     60540
     gtggagcaaa ctgtaattac acgttcgtca atttcaattt cagtgtgtgt gggccaaaca     60600
     caaaaacgat gaaaaggtac cgacatttct gggtacgtga aacgtgtgac taatgattgt     60660
     cacattaatt gcttaattcc gggttgacca acagcaaatg ggagtgggtt tggagtgggt     60720
     ttagacaggg ggcttcagcc aggaaggcaa gtgacaccca cagcccggtc agagcctcac     60780
     ttgtccagaa cggaggccag cacctcatcg caagcctgtc gagctgaaag tggtcagccg     60840
     ctggtggttg gtggggaagt aaaggaaaaa cgccccaaga ggtaaacatt gtatttagcc     60900
     gtcccctcct gcgtatgtcg gtacacacaa agcagcattt aacgagagga aatgtattcc     60960
     ctggttcgtc cacagtgctt agctctctca actctcaatt acacggggct caatttgaag     61020
     cattgagtgc cacgggaaaa agcaagatct ttaaaatcag cccaagaaga gggcttcgtt     61080
     tctcggcaga ggtcccgaca ggactgcagc actctcgaga tttcacccac ttgctctgtg     61140
     ttttggtttt tcctgttggt actggtttag gaagatgttg gatcaaaatg tgatttagac     61200
     acggcatctt gtaaattaac agtaagcgga cccacaccta tttttaagtc gtcctccctg     61260
     catgagctcc ccccaccccc atcctgtagg cgtttccatc ctcgaggcca aatgaaaact     61320
     cctaagcaac gggtttccgt tacctgcgtc ctcatgaagt ccccctccct cccaagggaa     61380
     cttagagata ttttagcaga gggatgttcc cgttcctcct gtagagggta acactctccc     61440
     gtcttttttt tccttttcct ttcccagtga ctgtcgccac taagtggttc tgttggcctc     61500
     cagttgatgt caggaagccc ccaatccaag tggtgcattt agactctttt cggggctcgt     61560
     gtgtgtatca cgttgtttag gtttaagggg gttttcttgc tgtttttcaa ggaccagagt     61620
     tacgctctat tgtattgctt cctcctctta aggtagagca tggctttgtt aaagtccctc     61680
     cggctccctc tggggctcct gcggctgtcc taagaaaggc gctaatggcc tcaggcacgg     61740
     ggcacccagg ggaccgggag gttcctctct cccgaggggt ctgcccatca gagccaggga     61800
     agatccagaa aggccccaaa gcccccagcc acctcccttt gtacaccagg gtttgaggat     61860
     gtttgatggg tgtctcaaag ccactggctc aggaaattgg gtccccacgc gatggccact     61920
     ggctcccacg tgttggttgg attagagtag gttctgaatt aaacatggat tatctttgaa     61980
     tgggcaggtg caaattcaat cagggagttt catggggcca tggagtttgt tccttaatcg     62040
     cgagccttct gaacggcgtc ttccgaagcc gaacaccgtg tctcgttttg aatgcaagtt     62100
     cagggttact ttgtgttatg acacctagtg aatatgacaa gataaaagat gctctcggta     62160
     attaggtttc taagaacttt atggtcctca gtgatagaac cttcttagca gggattaact     62220
     gggactagga gaaggctctt tagaatacct gctttcggca gctgtacagc ataggccccg     62280
     ggtcacactc acttgcaaaa atgactccag taattctagt cagagtgcga aatgtgcttt     62340
     aaagacagag tgcaccactg aggggctgtg acgttatcat tacaacctga cagctaagtg     62400
     ttctgtttca gtggcaacct atttgccacg tcctcggtta ttaaaataat attttccctg     62460
     ggctcttgga gaattatatt ttctcgggaa tctcacagtg accccatcta gtgaaaggct     62520
     gagaagaaca ccttgtccaa aaacccaatg actatgtcag gtgcaagaat gttttctaga     62580
     gtctaagctg cagcaagccc acggcttcca gcagacgagg cacgttcact cagacaggag     62640
     ggtgcacggg agccaaggaa cacccccccg taacggtgac cacggcgttg caagcctgcc     62700
     gtggaatcca tccactgttg tgaactgcgc actgctggaa aggtctggcg ctaggccgtc     62760
     cctgggtcta gcgtggggca ccgtatgtag ccgaggcgta tcactaggtg acctggtgtt     62820
     tccgggtagg ggtgtgctac tgtcccaacc tgctggcttc gacatgaagc gagtcacctg     62880
     gagctgggga cccgtgccct ccctaggcat ttggcacccg ggaccttctg gccccgtgcc     62940
     cctctctgga gcttggaatt tccacgactt ccatctctcc ccgagccaaa tgagaggccc     63000
     cttccactgg aaaactctct gggtctagac tgttccaaga ataatgctaa tggattgcac     63060
     gactctcaaa gcataaacca ccgtgcactt aaaatggtaa caacctatta aaataaatta     63120
     ctaattcata tgaaaaggtc acgcatggtg gcctccaaac ctgacttttt ttttttttta     63180
     aactaaaact tttaaggtcc gggtaggtca aatgctagac cgaaaactgt agacggtatc     63240
     agctccccac gccaattaag taaactctca tctttcactt tgtgtcgggt gaaaacagaa     63300
     agcccagcag accacaaacg agcttgtgtt tcagagctct tagtgtcatc tgcttacctg     63360
     taaacccttg cttccacctg ctggcgttat ttacaacgta aatgctttat ttgtccattg     63420
     gtggttggtc ataataaaat ataggtgaaa cctacgctga aacaaaaaaa aagatttttt     63480
     tttttttttt aaatttttta aggacggcct gccagcttag aagtggaaat gactgaagcc     63540
     tggccttgct ttatacaata gtcctgattg tgcctttgcc tggactgggt gtcagcatat     63600
     gacatgggac agcttcaccc ctttcaaagt tcaggtgtga tgtttgtcta aaagggggga     63660
     gacggtgacc caactcaggg atttccaaat aaggagactc ttcattatat ttactgcagt     63720
     aacgtgtagc tcctggcata agtatcaggg ctgcgttggt tactatttac cttgttcctc     63780
     ttaaatacaa tgtatttgca ctttgccaca tgagaagcag gaaggaagat gcttttgaac     63840
     aaatggagcg taacaaaaat ttctggcctg ttcctcctcc tcctgcgtct tcaccatatt     63900
     tttttaaaaa atgacaatcc attagtccaa ttcaaccaag aggtttttat ttaatataca     63960
     aagacataaa agcctgggcc ctcttttcaa gtatttttct aatctagccg gtgaatgatt     64020
     gagtcctgat ccctgcaaac agctatggac tcacaggtgg tgagacctca ccatcagagt     64080
     agcttgcggg aacgttcggt caatcgggtt gatgttttat cggcttttgt ttaggggaac     64140
     agtagttcct tcgcgcttcc gtcaagggaa ggtgtatttt cgtgtggaag gtgaggccac     64200
     atccgaagtg ggattgagac ctggctcatg cgggtgcgag cagggtaggg caggcaggac     64260
     aactttccag cagagttgga gaaagttggc ggggccccca gtcgggcgag gtaacagctg     64320
     caggttctga gggtctggcc tgcggatttt gcttcctgtt ctcaattcca agtgttctcc     64380
     ggcgactttg aattgccctc cgccgtcttt cagatgcgta cagagagggc ttgcagaagg     64440
     tgtgcctgat ggggccgaga aaaatactgg gcgacacccc cacatctgct gcacctcttc     64500
     ctacgcggag ttgagcagac tggggaaagg gggggtttca gcggtcccct ggaacggtta     64560
     acggcgtctt tccattttca aagactctaa agcgatacag acggcttcct caaggccccc     64620
     gaaggaagct gtcaccccag ggccttaggt gtctttgctg tgtttccctt tgcagacaga     64680
     tttcctcctc tgcgttttca tcccccaaac ttccgaagtc tcacggactg tatctaagtc     64740
     caaaaaagtt agttgggaga gttcccggtt actttgtagc ggggggtcgg ccgccagggg     64800
     cagtggctgt gtctccggtc catggccagg cgcctccgac tcacctgggc acaaggtggg     64860
     ccgcacttgc actgagtgaa tgaatgaatg aagggcaccc gagcagacac ccgcctagct     64920
     taagggggct cagccaaggc ctcagccaag gtcccaggaa gagtgagcgg ccgccgcgtc     64980
     ctggagagcg cggcccgctt ctccacccag tgcgccctgc cgcatcctcg tgtgggacga     65040
     gggagcgggc ctcttggctt gcgacttggg ttcagagttt taaacagctc tccggcacat     65100
     tcgaggtcaa taaactactt ttccatctgt tgcagagctc cccgcgcccg gccgcagaac     65160
     agcgggaccc ctggcccagc acctctcccg cccgggagga ctccggggcg ccgctccgca     65220
     gcgctgctca ccgctggcct ctcccgcccg ccgccggcgc ccgcctcgct gggcagcgct     65280
     acttttgcgc gcacattgca ccgccggcca gccgatctgg cgcgcgattc gttgggctcg     65340
     ccgacaccta cctccgccgc gggcacgcgc cgccgccgcc gccgccgccg ggagggaggg     65400
     gtgggtggcc gccgccgcgc gcgctaaccg ggaagctgga ggtaaggagg cgcgcagcag     65460
     gggtaagcgc cgccgtcgca cactttgcac gccgcccagg gctacaccac tcgccgaaaa     65520
     ttgggaggca ggtctgggag gcggggtccg gcgcccaccg cctcgggcgc cccgcagccc     65580
     ccggcccccg caccgcccgc gcccctcgac cacccccttg cgacccccac tccggcctgc     65640
     acccctaggg tgcgcggcgg cccgtttggg cgcgtccccg gcgggccgat ttttcggctt     65700
     ccccttcggt ttataggggc cgccgcggtg ggtcggtcct ctgaagaggc tggggcgtca     65760
     tcgggctggt gaggagcgct gctcgccggc ggggacactc agtcgcgtcg gcaccgcgga     65820
     gcgggctgcg tcaggtggct ggcccggcgc ggctcgctcg ctcgctcgct ggctctccgg     65880
     ctccaggctg cggcgccgcg gctggagcga acccctgtcc cggcgagggg cggcggcggg     65940
     cggccggcag gcactgcctt gcgtgtgagt gcacctcact cacatgtaag tccgggtgca     66000
     ccgtggcctc ccgcggaagt gcgagtcgcc cggcgcgggg caagagccgc ggggctggga     66060
     cggggcaggg gcgccccggc gctgccgccc tgcccgtgcc tcccgggcac cccccaattc     66120
     tctctctttt ctcttttctc ttctccattg gcatgcccaa gagcctaaac caaggagcgc     66180
     ctgagggtaa cagcaaactc gtgccatcgc gcctctgcac ttttctgttt tgagttgttt     66240
     gacatttctt ggtgcttttt gatttctcgc tgttgttggg tgctttttgg tttgttctcg     66300
     cccctttttc gtttgttcat cctttttggc gctaactctt aggcagccag cccgaagccc     66360
     ggcagccgcg ctctgcggcc ccgggacagc gcaggcgggg atcgcagccg actcccccga     66420
     cacggggcgc acggggtccg gccagcccga ggccgggggc aggcagggcg cccgggccag     66480
     gcgagagcca ggcaccccga ggtggccaag ccaccatgct gaagatggcc atgaagatca     66540
     aagctcgaat gtcggggagc gggaggaaga cggcggcggc tgcggccgag gttgctgccg     66600
     aagctgcggc ggtggctgca gcgctggccg agccccacgc gccgcagaag aaaggggacg     66660
     ccgagaagcc ccccaagaag ccggcgcgag acgcgccccc cgagaaagag aagttcctca     66720
     ccgaaaagga gcagcggaag atcgagaaga agctgctgga gcagaaaaga aaagaagaga     66780
     agaagaagga gaaggagagg aagaagttgg agaagatgca gaagacgaag aagaagaaga     66840
     agaaggtgcc cgaagccccg gaggaggccc gaggcccggg ggtcgccgcc gccgccgccg     66900
     ccgccgccgc cgagggcgcc gcggagggcg ccgacggggg cggcgtggac gccggcaccg     66960
     tgggcatgag taggatctgg gtcgagtggg aaacggactc ggactcgagc gacgaggacg     67020
     acgacgacga cgaggacgac gacgacgagg acgacgacga catctccgac gcctttccag     67080
     gcttcagggg cacctcgtgg gggtccgggc tgctcaagat cggcgggctg agctcccacc     67140
     tgccactcct ggccttcctc gtcttctccg tgcgcagccc cgcgtgggtg ctcgacttcc     67200
     tgctgcagaa gcgcccggag cagggccgcg gctgcggctt ctttttcggg gcgacctgct     67260
     gcttccgaat gttcctgggc tgcgccttct tctccttctt gggcggccgg gccaagcgca     67320
     gaggccgcgg gcgcaccggg gcctcgggtg ccttcggctc gggccatggc gcccggcgcc     67380
     gggggctcga cgagcggttc gtctagtcag accccccgcc ccctcccccg ccaccgccac     67440
     cagacaccac catcgctgtg tagtgtggag ttttattgag catttgtgtg tgtgtttgga     67500
     cacattttcc ttttcggttg ctctgtcctt tggttcgtgc tcgcctcgct ttttccacac     67560
     tccctgctct ctggctctct ctgtgtctct ctcttctttt cgaaaatttt cctaagtccg     67620
     ggctcgggct cgcgctccct ccccttccgc ccaccccggc ccctcggcgg cgcccgcggg     67680
     aggtgggggg ggggcctcgg cctcgggggc cgccgggcga cgcggcccgg ggggtggagc     67740
     gttggcgtcg tgcgaggggt cgtcaccggc tcggagacgc cccctctccc ccccgcggcc     67800
     ggccccgttt ggggcccgag ccaggggggt gagggggcgt ctcccaggcc tgtcccgtcc     67860
     cgggccgggc gcaggcggag ggacccccct ccccggatac cgggggggcg cctccctccg     67920
     ccagctcccg ccctccccgc cgccgcggcc gctgccgcgg ctgctcctca tccctcctcc     67980
     tcctcctcct tccacccccc tcgccgccgc cgcctcctcc tccccccgcc tccccccgcc     68040
     cgccgcggag ctttgggtcg gggcggcggc ggggccccgg ccgaggcaat aagagcggcg     68100
     gcggcggcag cggcggcagc agctcccgca gctcctgctc tggtccgcct cgccccgcgg     68160
     cggccatcag acccctcggc ttcggcgcga ggggccggga gccgcgcgct cccctcggtc     68220
     agaccgacac caccctcccc gcgcgctcct ccccgaggag ccgagcccgc gcccggcccg     68280
     cccgcccggc gctgccccgg ccctctcggc ccgcgtgagg ccgcccgcgc ccggccccgc     68340
     cgccgccgcc gcagcccggc cgcgccccgc gccccgccgc cgccgccatg ggctgtctcg     68400
     gaaacagtaa gaccgaggac cagcgcaacg aggagaaggc gcagcgcgag gccaacaaaa     68460
     agatcgagaa gcagctgcag aaggacaagc aggtctaccg ggccacgcac cgcctgctgc     68520
     tgctgggtaa gggcggggcg gggggcgccg gccccggccc ggcccggggg cccctcgggg     68580
     cgccccgcag gctgcgcgcg ccgagcccgc cccccgcccc gggcgcgcgc tcccgagccc     68640
     gccgcccgcc cgcgggttca gtctctgggg ggcgaggccg gaagggggac cccggggcgc     68700
     aatttggccg ggcgggggct caaaacgggg cggggggcct tggcgacgcg ggcgcgggtc     68760
     cccctccccc ggcccgccgc tctctgtctc tctttcgccc tccccctcgc tcttttctct     68820
     gtctcttttt ccgcgaggcc tacacgacgc caggggtttg ggtgcgtgtt ggggaggggg     68880
     aggggagtcc cacagggctc ccgagactgc gacaaaaaga gggtttcggg gacaggaaat     68940
     ggggtggcgg gcagagggag ggggacccgc ctccgtgggg tgtgtgattt gttgggagag     69000
     ggacagggag aaagaaagaa agaaaggggc tagtagagga gggggtgacg cggggggggg     69060
     gcgccgcagc gacagagggg gcctcgccga ggggagctgt ggcgggggaa gtggccgagg     69120
     agagtggggg gggggcgggt gacatcagcc cctcggaagg gaccggagtg gtaaaggtgg     69180
     tgcagcgagg gggagggggc gcgggcgagt cgtggcgccg gactgggggg gggcggggag     69240
     gagggagcgc ggcggccgct gggcgcgact tggtgcgttt cgggcaggac acactgtgtg     69300
     cgcggagcag acgtgtcccg ggccgtggaa ggaagaggag aatcaaataa aatgagcccg     69360
     aaaaaaaaaa acaaaaaaca aaaaacatgg agttagtacg ctaagtgccc agtgaagcca     69420
     aatgacacgt cattttacag tatgaccttt ttttcccctt ccagatatgc aggctttttg     69480
     aaaagcaaag aagagaatta attgtagcag ctgctgcccc ccccccgcag cagcgccccc     69540
     ccataaacca ttaacacaca cacacacaca cacacatttt cctgttagtc ggccacattg     69600
     agagtgcttt gttgaaaaaa aaaaaaaaaa gacattcaca aatcagaact ggaaaatgac     69660
     atttgtctgg aaatggcttc ttggtctgga aatggcgtgg tttttctgtc cttttcaagg     69720
     tgggaggggg gcttgagagc gctttaagga aaaagacttt tcccaggtgg aaggagatga     69780
     gaatacatta attagttgtt tgtcaagtga catttggttg tttggatttg ggtttttctc     69840
     ttttgattgc ggtttttcct ctctggccaa aaaaaaaaaa aaaaaaaaaa aaggcgtggt     69900
     aactataaag agagggccct ttcccccctt ttttcctcca aggtgctgct ttggaaaaaa     69960
     taagtaaaag aagcataaga gaaattgttg aaatgaccag aagaatcaca caagcattaa     70020
     ttagtatgga agttttccac ttccttggta atttggctga gttaatttgt gaatttgcta     70080
     ggttaagacc tagttcatgg tcgcatatca acaaaacagc ttgattgtaa agaataaaat     70140
     ataaaagggc tgtttttttt tctttgtggt ggagcagggt tggcttcttt tgatgggtca     70200
     cgtctttgtt ctcctgggtc caggttcatc taaagcagaa aattactaat taagtgaaaa     70260
     taagtctctt tggtgttgat gcatttgcaa tgacaataat taaatgatac atatgttgga     70320
     gtgttggcaa gacttctaaa ggtgggatta tgctgtgtga ctattaatat gcatatgatt     70380
     tgatttcaaa gtataagcct agaaaagtct agaatctttc ctaggcacac tagcttgcta     70440
     gttgaatact aatttcaacc aagtgtgatg ctaacggtac cttaaatctc aaacaccttt     70500
     gcacaatgtc tccagttaat ttgggactgt tgctctccac acaccttgca tcactgggct     70560
     aacctttccc caggtgtcct agcccttgtc aaagtagatt gacagcctct ggcgctgggg     70620
     tttactgccc aagccagtgt cacacatttg cactttaaaa tggtgattct cagcaaataa     70680
     tgccccccct ccccgaaaaa gaggaaacct aatgatgccc agaatcctct ttttaatcca     70740
     tcttaacttg acaccatgaa aatcaagtaa attacagcag ctcaaaagac cttgcagtcg     70800
     ttttttcctt ccaattctaa tttcataaat gtggaaactg aggcacaaac ctgtttgtgc     70860
     ctgtaaaaga ggtgctgcac atctgagcac ttgtgaaata ggaagattgg agattctgat     70920
     gaatactgtg tattctcttc atgggatctc ttaatagggc ctttaatatt ttaatttatg     70980
     agagttaggc tcattaagat acagtgtttg ctttgaaatc aatgtttctg tggaaactaa     71040
     ttttaacttt ttacagatat cgatcatagc cttgtgaaaa ggcaagagaa ggaggaatgc     71100
     tttgctctct gggcagtaaa ataaaacaat taataaaatt aaaagtggaa aaaaaggggg     71160
     ggggctaaaa acccaaacag gtttgtgtgg gaggagggga aaaaaaaatg gtcccctcag     71220
     gataatttgt tagcgttatc tatttgcaac tgagaaacta gcatcctcct tctaactggg     71280
     tgaaactgtt tgtttgtttg ttttacagaa aatacatgtt tttacaaatg aaaggtgatt     71340
     taaaatgggg gcacgtgctt ctctttgctc ttttagttga gaaaggtttg gaatctttgg     71400
     aaattaagtg gtttccagga atattcttcc ctgtgattaa aacatgctaa tatgggtgtt     71460
     ctcaagtgct gtatttaatg tttatgtttt tcgagatgac agaaaattga tgggttttat     71520
     gcccccccca ccatgtttgc tgtatccaga gagttcatct tcagaaagac aaagtttgca     71580
     ggaagggggg gtgaataata aaatgtgatt ttgttgggtt taggggttga cttttaagta     71640
     gcccccccct gcgggggggg ggagaaacct gcaaagaagc tgcgttcctg catccgtgtg     71700
     atcttctggg cattgtttgt gaatcctggg gtattttaac catgaaacgt ctgacaaaca     71760
     atgaattatg tggcttcata tcttaatgtg tacatttaac cagagaaggc tcatttcaaa     71820
     aatccagttt cacaatttca acttcaattt tctccccccc accccatgac aaaattgcgt     71880
     cattgtctct ttgccccttt gcccacccca ccaattttga aaccaccaaa agaaaaaaag     71940
     aaagggaaaa aacacctccg catagcaaaa cctttaattc ttgtttgttg ttctgatggt     72000
     gaaatactgc aggtcgacac aaagttggct gtttgtttcc tttgctcggc gtcgcggcaa     72060
     tgtcaaggaa aattgcaagt ctcttacttg gtttgctttt tgcgtgttgc ttctgtggag     72120
     aaaacagcag tcctctctct ctctctctct ctccctgccc aagtgtgtga catgcctcct     72180
     tcttaacctg agacttactt tcattttcta ggtgctggag aatctggtaa aagcaccatt     72240
     gtgaagcaga tgaggatcct gcatgttaat gggtttaatg gagagtaagt gtccaggctg     72300
     tgacaggcgg agttccacgt tgtatactaa cctttaggaa gtttaggtag ctgggggggg     72360
     gggggctgga cagcccatgt ccacttaatt ttttcacctt acatagagaa aatacaggga     72420
     agcgcccctg agggtccccc ccgctccacc ccgtcctttt cctctttggt gcaacaacaa     72480
     acagtaatag gaataataat acagcacccg tgttggcccc gtgacagggc tgcagcagca     72540
     ctgctggcag gttttggtgc agtgggtctc caaccgtggc tggcactggg cgcagccacc     72600
     ccctttgcct ggcgacgctg accactgcag cgacaacgcc cccccccccc ccccgcgcgc     72660
     ccccagcgga tttcagcgca atgcaccagt gcagcagggt ttcaactatt agggaaacaa     72720
     tgtttcaaaa atattctcac gttagacaag gtcggaaaag tccgccttta ttaattcctc     72780
     atgccctctc cccccctttg gaattaccag ggtcaaatca tagtttctct ttgtaaaaac     72840
     tgataatctc acctaaagaa aagaaaaagg agccctttta agttagctac ttccggccag     72900
     atcaaggggc atttttgcct ttgaaaagtc cttccaggcc tcttggtaca ggacaacgtg     72960
     acaatgccgc agtgagaata aagatgcaaa gagagggccg gtgtgcgggg cgtaaaggcc     73020
     tgggagcggg gtcctgctgg tcgtgaacgc agaccccagg g                         73061
//


spacer
spacer