spacer

EBI Dbfetch

ID   CR788299; SV 4; linear; genomic DNA; STD; VRT; 20644 BP.
XX
AC   CR788299;
XX
DT   20-SEP-2004 (Rel. 81, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 10)
XX
DE   Zebrafish DNA sequence from clone CH211-247G19 in linkage group 18 Contains
DE   the 3' end of the gene for a novel protein similar to vertebrate RAB and
DE   member of RAS oncogene family-like 2B (RABL2B).
XX
KW   HTG.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-20644
RA   Palmer S.;
RT   ;
RL   Submitted (12-JAN-2009) to the INSDC.
RL   Wellcome Trust Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK.
RL   E-mail enquiries: zfish-help@sanger.ac.uk Clone requests:
RL   http://www.sanger.ac.uk/Projects/D_rerio/faqs.shtml#dataeight
XX
DR   MD5; 5cb5326e91cee33f91d9e116fdfe6028.
DR   Ensembl-Gn; ENSDARG00000063321; danio_rerio.
DR   Ensembl-Tr; ENSDART00000092416; danio_rerio.
DR   RFAM; RF00001; 5S_rRNA.
XX
CC   -------------- Genome Center
CC   Center: Wellcome Trust Sanger Institute
CC   Center code: SC
CC   Web site: http://www.sanger.ac.uk
CC   Contact: zfish-help@sanger.ac.uk
CC   --------------
CC   
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats;
CC   all regions were covered by at least one subclone; and the assembly was
CC   confirmed by restriction digest, except on the rare occasion of the clone
CC   being a YAC.
CC   
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases:
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP;
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
CC   
CC   Clone-derived Zebrafish pUC subclones occasionally display inconsistency
CC   over the length of mononucleotide A/T runs and conserved TA repeats.
CC   Where this is found the longest good quality representation will be
CC   submitted.
CC   
CC   Any regions longer than 1kb tagged as misc-feature "unsure" are part of
CC   a tandem repeat of more than 10kb in length where it has not been possible
CC   to anchor the base differences between repeat copies.  The region has been
CC   built up based on the repeat element to match the total size of repeat
CC   indicated by restriction digest, but repeat copies may not be in the
CC   correct order and the usual finishing criteria may not apply.
CC   
CC   IMPORTANT: This sequence is not the entire insert of clone CH211-247G19. It
CC   may be shorter because we sequence overlapping sections only once, except
CC   for a short overlap.
CC   
CC   During sequence assembly data is compared from overlapping clones. Where
CC   differences are found these are annotated as variations together with a
CC   note of the overlapping clone name. Note that the variation annotation may
CC   not be found in the sequence submission corresponding to the overlapping
CC   clone, as we submit sequences with only a small overlap.
CC   
CC   The true left end of clone DKEY-238C7 is at 18645 in this sequence.
CC   The true right end of clone DKEYP-86F2 is at 2000 in this sequence.
CC   
CC   CH211-247G19 is from a CHORI-211 BAC library
CC   VECTOR: pTARBAC2.1
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..20644
FT                   /organism="Danio rerio"
FT                   /chromosome="18"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="CHORI-211"
FT                   /clone="CH211-247G19"
FT                   /db_xref="taxon:7955"
FT   misc_feature    2001..20644
FT                   /note="annotated region of clone"
FT   mRNA            join(BX571879.8:249412..249930,BX571879.8:250019..250048,
FT                   complement(16430..16509),complement(16226..16305),
FT                   complement(15009..15120),complement(14827..14924),
FT                   complement(11549..11632),complement(10843..11473))
FT                   /locus_tag="CH211-247G19.1-001"
FT                   /product="novel protein similar to vertebrate RAB, member
FT                   of RAS oncogene family-like 2B (RABL2B)"
FT                   /note="match: ESTs: Em:AL714256.1 Em:BM072032.1
FT                   Em:BM317012.1 Em:BQ479595.1 Em:BQ481244.1 Em:BU710333.1
FT                   Em:BU710334.1 Em:CK697156.1"
FT   polyA_site      complement(11014)
FT   polyA_site      complement(11020)
FT   polyA_site      complement(11022)
FT   regulatory      complement(11036..11041)
FT                   /regulatory_class="polyA_signal_sequence"
FT   CDS             join(BX571879.8:249830..249930,BX571879.8:250019..250048,
FT                   complement(16430..16509),complement(16226..16305),
FT                   complement(15009..15120),complement(14827..14924),
FT                   complement(11549..11632),complement(11399..11473))
FT                   /locus_tag="CH211-247G19.1-001"
FT                   /standard_name="OTTDARP00000012587"
FT                   /product="novel protein similar to vertebrate RAB, member
FT                   of RAS oncogene family-like 2B (RABL2B)"
FT                   /note="match: proteins: Sw:Q9UBK7 Sw:Q9UNT1 Tr:Q6DDK8
FT                   Tr:Q6GLK3 Tr:Q8K2P9 Tr:Q8WUI7 Tr:Q9D133"
FT                   /db_xref="GOA:Q1L8G2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1L8G2"
FT                   /db_xref="ZFIN:ZDB-GENE-060503-464"
FT                   /protein_id="CAK04760.1"
FT                   /translation="MDAGGNSDLDLDKYDSDEQVKIICLGDSAVGKSKLMERFLMDGYR
FT                   PQQLSTYALTLYKYTTTINGQTILVDFWDTAGQERFRSMHPSYYHKSHACVMVFDVQRK
FT                   ITYKNLTVWYKELREYRPEIPCLVVANKIDADMKVTQKSFNFAKKQGLPFYFVSAADGT
FT                   NVVKVFKDAIQMALSYKRNSSDFMDEVMRELENFDLENKEESSDKEETQEEKPSSA"
FT   misc_feature    16645
FT                   /note="Clone_left_end: DKEY-238C7"
XX
SQ   Sequence 20644 BP; 6569 A; 3618 C; 3928 G; 6529 T; 0 other;
     ctcagtttcc tttttattca atgaagaaga tgatgcactg acatagttat ttacattaga        60
     cctcacctat ggtattgttc tttattggag ggaatgcgac aatagagccg ccattttagt       120
     acagggtaga gcttccttga aatgaatgtg ggaacaaggt gcaatagagg actggccatt       180
     cagagccata gatatgtaaa cacatataca tatatctatg actgctaata tgagcttatg       240
     ggtggtatat ttagactcag ctgtgtagca ggtgtaatgt tcaattcacc cttatttcta       300
     tagcgctttt acattgtagt gtcaaagcag cttcacatat aagtactaat gaattgaaac       360
     tgtcagtcca gttttcaaag ttgaagctca gtttagttca gttcagtgtg gtgtaatttt       420
     cactgctgat agtccaaaca ctgaagagca aatccattga tgtgcatttc aacaagtccc       480
     aaatcaagca agccagtggc gacagtgaca aggaacaaac tttaccattt aacgaaagtg       540
     aaggaaaaaa ataaccttga gagaaaccaa gcttaattgg gcacgaccgt ttctcctctg       600
     gccaaacttc ctgtgcggag ctgcagtcta ggcgccagag gttatgtaaa tgggatctaa       660
     gaagcatcca gttgctgcat ctgctcacat actgagctca taatgcttta aagcatttaa       720
     tgcatttatg caaatagtct gtactcattt actctaaatg tgtacaagtg tcgacattca       780
     tttaggcaaa aactgcttaa aatccaattc aacagttctc attgcattta atccaatttc       840
     aaacaaccta cagatgtgta gctttttctt gtccggacta caaaagtgca ccaaaatctt       900
     tgatttgtgc tatctgtctg aacaaagcca atgcagaaca tcccataatt gattcttctt       960
     tttcattggc atgataaaca cccactaatc cctttgttcc aaattgtttt ttctttttgt      1020
     ttgtttgttt ccactttact ctctgcttct taccgctgca tcgttcatcc agaaaaaaaa      1080
     ggagggatgc tgtcgagaaa aggaagttca gttgcctttc agagtatttt tttaggagtg      1140
     gatgagcaga gtgggcgtgg cgggatcctc tctgtccacc gcctgccccc ttctggctga      1200
     gggacgtact acaactcgga gaatgtttaa ccaacactag tggctttttc ataatcagac      1260
     tcttactttg ggtttccaaa ggaaatatga cattagatag aatatctcaa tgtatttaaa      1320
     tagctttgaa aaatggagag agacagcaaa caggacggac cgtgtgaaac gcacccgtct      1380
     ctctccgtag atgatttatt ccaccaataa tttaatcatt tttaccaatt atatacatat      1440
     atatttgaca gaaaaaagta tatagatcta tgaatataac atttttgtca taaatataaa      1500
     agttatatat gatattatat atatataaag acaaaaaaca ctcttgaaga tgattttttg      1560
     atggttctcc ttttaagatg gactgtagca tgaagcgtta catccccata cggaatgatg      1620
     attgactggt ttgttcgatt tgcattgtac caccctctta ttttaatttc ttttggtgta      1680
     ttttcacaga acctggtctt ccatctttaa ttgaacatcc cacagtgggg tgtaaccgtg      1740
     tgttcacaat gagcccttca cacacacaaa aaaacacact tttgttattt agtttgtaat      1800
     ttttttcata taaagcaaaa aaaaaaatac agttacacgc tatcatgcac acaacaacgc      1860
     cagtttctta agcgaatttg acttgatctg aagtcttctt aatctggtaa taagaaattg      1920
     tgaataagaa actctgcaat aagtgtgtgt gtgtaaatga gtgtgtgtgc atgacagaac      1980
     cactgtggga cgagaagctt atctggatgg taacgactag gggtgtaacg gatcacggtt      2040
     gatccgtgat tcctccggat cacaacccac ggttcggaac atatgtgacc cgcatataat      2100
     actgtttttt tttaatatgt agattaatcc taaatttgat gttgcagaga tatcgtctct      2160
     tgcatcattc aaatcacacg tataaaagca tttaggcttt cctgtacaat ataatgatga      2220
     cgggagaagt tgtggtagat tattcaggat gtggtgggtt tcttaggtta ttaaaggtgt      2280
     tttctgttac tacttgttta gcctgcatta atgcattcag tgtacgctgc atgattaaac      2340
     attaaaagat cgggatctca acccccacgc aacataaatt ataaatgatg gtgatttgaa      2400
     tatgcttatt aatcctaatc gctgcatcca aatctgtttg aaaaatgtaa aaatcaagaa      2460
     agagattcag tctttagtct tttgagttat ttatgaagtt acaaacagtc aacagaagta      2520
     ctgggataac aatttatagt ttagaaaaaa acagattttt tggtaaagat taaaatcatt      2580
     gtcaaatgcg tttaactata cggtcaaaat gaaagtttta ggcagcaatt acattattta      2640
     accaataggt ggcgacaacc agccatcaaa aatatgccac tgaataattc ttcaaaaatg      2700
     atccatctag caatgaaaca tgaagattta tgagtgaata acgaataatt ttaaaaaatg      2760
     aggctaaaaa taaatatggt tgtacaagtt ataatgttag atttatacat ttagtgttat      2820
     cagcattatt tatcagtgtt attaacagta aatctttcac agttctaaat attttacctt      2880
     ttattttcat tcacctgatt atttcttcat tttattttta ataaaactac agattctaag      2940
     ttatacttgt taaaaacaaa agtgtcttgc agtactgttt ttgtaataaa tggaaagcaa      3000
     gttacatttg tctcctcccc taatccgaaa aatagtctga ttcatgagta aaaaagccac      3060
     aatgtgatcc cgaaccgtgc gatttgtgat ccgttacacc actagtaagg actggcgttc      3120
     gatatctcat aaagaaagca gaatctataa ttgtaaacgt gtccactgta tgttaacctg      3180
     ctgtaagcac tgaagcattt tgacatttgt ttatttgttt atttttattt atttattctc      3240
     ctcataggtg gattttgtag cttgtgtaat atgatgcgta gaagaagaat ttttactgat      3300
     tcatttagaa tgacgattat ttaaaagaag aagctgcgga caaaagattt catggaaaaa      3360
     caatcagtca aaaaagtgaa gaaaagcaga tcctgcagct gtatatatat atatggacaa      3420
     atgacttata aaaatatttg ctttttatat caatcacaag caatgtatat acgatagttt      3480
     tcatataaat ttttaaaaat ctgaaaaaat atatagatct atatatgaat gtttggcata      3540
     tatgcatagt taaccacctg tcgaaaaagg tgacgatttt actctttgta tggagttcgg      3600
     ggggtgattt gcacaaaaca aggtgctagc atttcaagcc attcattccc acctctccca      3660
     ttagggctca atgcatatat gacccgtttg catagttcaa atcacatgca aacgcaaaca      3720
     cagaggcgtt catttctgtt tgtgtaccat cagtcctgtt tttaatacct aacctgtgtg      3780
     tatgtgtgtg tgtgtgtcat aagcagactg tgacagcaga aagagttaac gctttacact      3840
     ggtcatctct ttccttgcat ttcaatcaga cgtacacaat cagccaagga cgatgaggtt      3900
     atgttgatga gaatgccaga aacactgtgt aggaaaaaac ccttacttaa aagcaacatt      3960
     gagtctgagt acatgccata tttctcttgt atatataaaa taacaataat aataagctgt      4020
     gagggaatga tgtacagaac gttcagataa acagatgtca ctcctttata ctcttagaaa      4080
     tatatctgtt aatgatccag cactggctca ttggaaacta ttatgaaacc acaaaaatgt      4140
     acgtcaacat tcgtacattt gactgcagtt aaagtgaaca ctgaatggag gcgtggcacc      4200
     aaaccccacc cataaactca accgtcattg gggataagca gattgtacaa aacgtgatcc      4260
     gatttcatgt gaattagcaa gttacaaatt gctgtgtgat tggctgctat gacaacaact      4320
     tttttcacac tactgaaatt tacaaggaaa ttgagtaagg gataaagtcc atccaggcgg      4380
     ttgtcatgca gaataaagct cgacaggctt atcgacagcc tgatgtaaat ggagcactgt      4440
     tgaaataggg tgaagggctt tgtttagcga aaacaaccac ctggatgtac tttatccctc      4500
     ttgttaaatg gcttcttgcc atgtttaaaa aatcgtgcaa attaaaaatt agacacaaaa      4560
     acattgttct gagtcataat tgtttgtttt ttattaaacg caaagctgac agaaacaaaa      4620
     acagataaat gtaggcatgg caccaaaccc cacccctaaa cccaaccatc attggggaat      4680
     aagcaaattg tactaattgt acgaatgaga ttgtacgatt tcataagaat cagccaataa      4740
     aacaaaaagt tatgaattgc agtgagacag cgctggtgcg atgacaataa cttttattga      4800
     ttttcacact actgaaattt acagggaaat taagtaaggg atgaagtaaa ttcaagcggt      4860
     tgttatcgca gaataaagct cagcaggctt atcagcagcc tgatgtgaac ggagcatagt      4920
     tatataagac tgaagaacgt cattttacga aaacaaccac ctagatgtac tttatcccac      4980
     ttattaaaag gcttcttgcc gcaaaataaa aaaatagaca caaaaacagt gttctgagtt      5040
     gttacagttt attcattttt tcattcagct gacagaaaca aaaacagata aatggaggca      5100
     tggcaccaaa ccccacccct aaacccaaca ctcattggag gatgtgcaaa tcatactaat      5160
     tagtattaca atttcataca aattagccat tgaatcaaaa gttatgaact gccgtgagat      5220
     attgttggta tgacggcaac aacttttatc gatttttaca ctagtgaaat tgagtaaggg      5280
     ataaagtaca tccaggcggt tgttatcgca aaataaactg gagcaatgta atataagact      5340
     gtagggcttt attttgcgaa aacgaccgcc tggatgtact ttatcccact tattaaatgg      5400
     cttcttacca caaaaaaata gacacaagac attattctga gttgtaatgg tttataaatt      5460
     tttttaataa tttgatgaca aaaacgaaaa ctgttgaatg gcttttaaaa aacactgtta      5520
     ggaaggtttt aggtcagtgg tctgtacgac aagccctgcc gccttgtgga catatacaag      5580
     aaggacgtgt atctgaaaca tacaacaaaa catacactaa gtaatgtatt tgagatatgt      5640
     gaaagtgtag actgtgccct ctagtggatt tgacatctga aacgtgcaat aaaacgtacc      5700
     cggagcaacg tattttacgt taaaaattta ggctaaggca tgtatttcca atgagcctgg      5760
     gttgcaatta acaattgttt gatgatatat ttgacaggac atttaattac gttttggaac      5820
     tgtaaaaagc aacttcgatc tctgcgttga caacgtctga tgccagtttg agcagtaagt      5880
     caaaaaaaaa aagttaaaca tttacaaact gacattataa gttttttgaa acaatttttc      5940
     tgggctggtc atataaattt tggtacaaaa acaggtatcg aggtgacatt ttaaggttta      6000
     tgctaatttt aaaacgggac tggcattata gagtaattaa attacacaga atgacaatgc      6060
     atagaggttg gattggacat tcaaattaat atatttaatt aagattaggg gtcataaata      6120
     aaagcaagga caatctaaac gtaagatagt gtaaatgtga ttttacaaag tctttattaa      6180
     cattatagag tatcatctaa catttaaagt cagtttttgt ttttttccgt gtgtgtgtgt      6240
     gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt      6300
     gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt gtgtgtgtgt      6360
     gtgtgtgtgt gtgtggattt ataaagaatt aattaaattt attatattaa aggtttgtta      6420
     ccaaagctta ataattcaaa aaagttttgt tggctttaaa attcttaatg aaaaaataat      6480
     aataattatg gttcatgata aaaaaatcaa gcgatacaaa ctgtttttaa aaataaataa      6540
     taataataaa aataattaga aaaatttatt ttagaattat ttctgaagga tgatgtcaca      6600
     ttgactagaa ggctgaagta atagcgctga agctttgaat cacaggaatg aattacattt      6660
     tactgtatta acaacattgg gtgtttccca gtactgggtt gcggctggaa gggcatctgc      6720
     tgcgtaaaat agttggcagt tcattccgct gaactaagcc aaagaaaaat gaatgaatga      6780
     ataaacattc tttctttgaa tgtcattaag attaaactaa gcatttttta aaatagacat      6840
     gacctatgac cttgtcataa tgatcggact gtacattaat cgcctcagca tggcatttac      6900
     tctgaccgat gtttattccc tcatcctaga taaagactag ttaactattt gtctgtgaga      6960
     aagctcattt agccgaccac cagagatcct gacctacaag ggcttgaatg aaggcgctaa      7020
     ggggccgttt ggagttgagg ccctaagata actgtgaact aattttactg cagacgagcc      7080
     ccgaagaata cacccacaga tcccttcatt ccacttcaga cttctatatg aaatcatcac      7140
     agaatttaga gatgacctat ttattttctc tattttccct tgctccatct catcctgacg      7200
     aacaaaagtg tgtgtgtgtg tgtgtatgtg tgtgttgtgg atgtggtccc actctggaga      7260
     cttggagctg catttctgag ccatatgtat cagtttcact cttctcatct tctgaaaact      7320
     caagctgtga ttttcgtttc gtacacatca ctttcatctt tgattttatg tcatatacat      7380
     gatgttatag ttgttctagc aggagatgaa aggacatgaa aaatgtgcca aaaagtaatt      7440
     acatttttta aagcatttct ttgaggtttg tagagaacta aacgctgtta aagcagcact      7500
     atggtgccac ctcctggaaa tcttgagact acagacatct ctttcttttc tgtttaccca      7560
     aatatatagg agtttatata cattctgttt ttatatttgc tatgatttgc aaaacctgga      7620
     ttccagtaaa ttagctttga cttgcacatt tggtggatgt tttggcccag atctctttgc      7680
     cctttacttt ttcccaatgt agcacagacg tctgcatatt tacccttgaa atgacaaatt      7740
     gcaaatgatt tctttgtaat tttactcaac caatggcagg acgaaacatg aaataaaaca      7800
     catcattcac atgactgcag tatgttctaa aggggttgtc catcttgttt tctgatcaac      7860
     aaaagcacaa taaaaatggc aagaaatgca gtatgcactg ctttaatgag cattgttttc      7920
     tggtgggttg atgtgttgct gatgaaggtt atttcactgt tcccctaaag ggatgtagtt      7980
     cacctaaaaa gtcagatatc attttctgtt tcttggtaaa cctgccactt tattaggtac      8040
     acctgtgcaa ctgcttgtta aggctaattt ctaatcagcc aatcacatgg ctgcaactca      8100
     atgcatttag acatgtagac atggtcaaga tgacctgctg cagttccaac tgagcatcag      8160
     aatggggaag aaaggtgata gaagtgactt taaaagtagc atggttgttg gtgccagact      8220
     ggctagtctg attatttcag aaactgctca tctactggga ttttcacaca caaccatctc      8280
     cagggattac agagaatggt ccgaaaaaga gaaatgtcca gtgagcggca gttctgtggg      8340
     cgcaaatgct ttgttgatgc cagaggtcag aggagaatag ccaaatgata gaaaggcaat      8400
     agtaactcaa ataaccactc gtaacaaccg aggtatgcag acgaacgtct ctgaacacac      8460
     aacacgtcca acctttagac ggatgggcta cagcagcaga agaccacacc gggtgccact      8520
     cctgtcagct aagaacagaa aactgaggct acaatttgca aaggctcacc aaaattggac      8580
     aatagaagat tggaaaaaag ttgccagctc ggatgagtct tgatttctgc tgcgacattc      8640
     agatggtaga gtcagaattt ggcgacaaca acatgaaagc atggatccat cctgccttgt      8700
     atcaagagtt caggctgctg gcgtaatggt gtgggggata ttttcttggc acattttaag      8760
     cccattagta tcaagtgagc attgtgtcaa tgccacagcc tacctgagta ttgttgctga      8820
     acatgtccat ccttttatga ccacaatgta cccatcttct gaaggctact tccagcagga      8880
     taacgcacca tgtcataaag cacaaatcat ctcagactgg tttcttgaac atgacaatga      8940
     gttcactgta ctcaaatggc ctccacagtt cccatatctc aatccaatag agcacctttg      9000
     ggatgtggtg gcgcgagaga ttagcataat ggatgtgcag ccgacaaatc tgcagcaact      9060
     gtgtgttgag gcagttctga aggcaaaagg ggatccaacc tgtaaggtgt acctaatata      9120
     gtggccggtg agtgactact ttttacagtg gtaatcctga cttacttaaa atataatttc      9180
     ttgctctgaa tctcctttgg aagtcattag cctaatcatt ttgctaatat atagaagata      9240
     ataccttatt tctctagttt ctctttcctt tacagagcac aatggttctt cagaatgtta      9300
     tttattcctt tttattttac atgtttgttg atgtatattt tcagtgtaaa acaatacatg      9360
     aactgacacc catatggcct cacgttctga gaaacgctgc ttctaatcaa tcattttagg      9420
     ccacaaaaat ctgagaaatc ctgggaaaat ttactagtat tgtagtcata aataaggatg      9480
     ttaactcaag gtttaccttt ccctttttta ccctaaataa attaggagct atcagaaaca      9540
     taaagaaagg taagtgtggg gtgaaaactt ttagtgattt gttattttgc tagtttgaaa      9600
     ctcttgaaaa gaatataatg aaatagctta gacaataaaa tgacatgaaa aaaattccgg      9660
     cctggttacc taagtaattt cagatgtttg atttctaaca taaattataa aaagtatgtt      9720
     ataattaaac ttaagtttta tattttttac attggagtgg ttgatatgtg acattaaaca      9780
     ctacttgtca tgcattgatg tatacaataa tagttacatg cagacctcat ttgtgctgtt      9840
     aattaataag tgatgcactg taaaatctgt ttatatattt ttttaatatg aatcacattc      9900
     tgttcacagt acaagatatt cgtgtatact acacaaaaac aacagaggtt ttagcaagat      9960
     tgttttccct aatctcaaga tatacacatt caagtgcaaa acaaagctgg ttccatttaa     10020
     actagcatgg atgtaaagtt cataaactgt ataaagcact tgtgcaaaac atcacaaaag     10080
     caaatagcct aattaaaaat tgtgatttct aaaggggatt cgaatgagat atcttctaga     10140
     caaacgatgg caagagaact gatgaaatgt aggctaaata tttctaaaaa catgcatttc     10200
     agcctttaca attaaacaac ccgacaaaaa cgatatttgt taaacatgaa ctaatacttt     10260
     acaatcgata acaaaggttg aaagatgttt tgatttggtt gtgatatgac agacatcctc     10320
     cacaggtttt aaggataaag agcgctgcac gtcccttcag aatctcagtt ataaaggtca     10380
     gtgtttgaaa gctgcacatt ctcaagtatg ttccagtcac gtgttctata acatccagac     10440
     aaacacgttc gtgtatgttt gtcacatcca gagaggattc gattggcaaa taagctaagc     10500
     gtctacgttt gtaactgacg gccattttgt ctttcgcaat tgtttaattt ttgcagagaa     10560
     attttactct caaattgaaa attattttat ttactcattc aagatgtgtt tttgtttctt     10620
     ctgtaacata tatattattt atcttttttg tcgaaaccat aactaggtga ctggaatgca     10680
     agtcaacgat tacaatagaa cacacaggac ggtttgctat gactgttata ttggtacaaa     10740
     cattatatgg tataatgttg ttaatcatgt ttattttctg cacagtactg atagtttatc     10800
     ttcttaaaac ttcaatataa caccaagatt cacaggtatg catttcattt tgtctgtatg     10860
     atttattttg tgttaattaa ctctaaaaat ctcctttaat gacaaaaaga aagaaaatat     10920
     ttaccttatt cttgaatgcc ctgagggcaa ataaatcttt ttttttcaca ttttcaactg     10980
     ttataataac aactacttcc aaatgtaatc aactacccat acaaaaatca agtactttat     11040
     tcatattggt gagcgtcaca gattgttact tgagcatttg ctgtaaaaca ttacactttg     11100
     tgagaaagtc tcataaatat ttatttccct ctgaaaacaa aataaaaatg taaaaacatg     11160
     ttaaattcgg cacaggaaac acttcacatt gcagagtctc tatagaggac tactttttac     11220
     taaatctgaa tgctgcacaa tttccatgaa atatcaaaaa tctgcagtgc accgagattt     11280
     cattctgatg tcagataatg ccacgtgtac attcacagga tcatattgtg ttgtgtctgc     11340
     tgaaagaaca accatgaact gaggacagac gatggtaaaa atgatgaaga tgatgaggtc     11400
     atgcagagct aggtttctcc tcctgcgttt cctctttatc tgatgattct tccttgttct     11460
     ctaaatcaaa gttctgcaga aacaagtgag taaaatcagt ggtatgtatt attttgagaa     11520
     gagtgtggtg tttagtgttt acgcgcacct ctagttccct catgacttca tccataaagt     11580
     cgctggagtt cctcttgtag gacagagcca tctgaatagc gtctttaaac acctgaggaa     11640
     cattacagag cagcagaaca caaggataaa atcttaattg tgaaacacat taaatagaag     11700
     tttaaaggta gactaagttt aagattgcta agtttaagct agtctggcac tgctttggaa     11760
     atgatataaa cacaaatgtg aatcaaaata gacattggaa tatacactca ccctgccact     11820
     ttattaggta cacctctcca actgctcatt aatgcaaatt tttaatcagc caatcacatg     11880
     gcagcaactt atgtagacat ggtcaagacg atctgctgca gatcaaagcg agcatcagaa     11940
     tcaggaagaa aggtgattta agtgactttg aacatggcat gattgttggt gccagacgga     12000
     atggtctgtg tatttcagta actgctgatc tactggggtt ttcacgcaca accatctcta     12060
     gggtttacag agaatggttc gaaaaagaga aagtatcaag tgagcttcag ttctgggggc     12120
     acaaatgccc tgttgatgcc agtggtcaga ggagaatggc cagactggtc caagctgata     12180
     gaaaggcaac agtaactcaa ataaccactt gctacaatcg aggtatgtag aagagcatct     12240
     ctgaatgcac aacacgtcca actttgagga ggatgggcta cagcggcaga gctgaggcta     12300
     caattcatac aggctcacca aaaatggata atagaagatt ggaaaaacat tgtctggtct     12360
     tatgagtctc gatttctgct gcgatattta aatagtaggg tcagaatttg gcatcaacat     12420
     cattgattca tcctggcttt tatcaacggt tcaggctggt ggcggtggtg taatggtgtg     12480
     ggggatattt tcttggcaca ctttgggccc attagtacaa attgagcatc gtgttattgc     12540
     cacagcctac ctgagtattg ttgctgacta tgtccatccc tttatgatca cagtgtatgc     12600
     atcttttgat ggctactcca gcaggataac tcaccatgtc ataaagcttg aatcatctca     12660
     gactggtttc ttgaacatga caatgagttc actgtactgt gcctccacag tcaccatgtc     12720
     tcaatccaat agagcacctt tgggatgtgg tagaacggga gatttgcatc ctggatgtgc     12780
     agccgacaaa tcagcagcaa ctgcgtgatg ctatcatgtc aatatggaca aaatctctga     12840
     ggaatatttc cagtaccttg ctgaatctat gccacaaaag attaaggcag ttctaaaggc     12900
     aaaagggtgt tcaacctggt actagtaagg tgtacctaat aaagtagcca gtgagtctat     12960
     ctatagaggc tgggatgact gtaagttgtt ttgtttgttt gttttgtaat aagaatgaat     13020
     gattaatgag cttataaatc tgctgtctac aaaaaaagaa gcaaaagaga aattgccctg     13080
     tttttttttt tctgtccaat aataaggttt aacatcagaa agctaagggg gaaagaaact     13140
     agcatgtagt acaattttta ttgtgtaata ataatagaat atttattttg tattagtatt     13200
     acttttttag taattacttt ttagatttat ttttttaaaa tgtgacgcat tacagggctc     13260
     gaaattaacc ttttttcttg gtagcaccga tgctcctaac tccaaaactt tagtcacatc     13320
     caccaaaaat tatgagcacc gttaccacaa gttttataat aacagattct attatatatt     13380
     aacactttaa atcaacaaat aaacaaaaat ctgcatgcgc tcaccggccc tgcacacact     13440
     gcttgacatg aattgcttat tagcaataac ggtcttttca tgagctgcaa tattagtttc     13500
     atctcagtga atgcatgctc tttagcaatg gtgaacgcca tgtcagtagc acgactgaaa     13560
     gcatcataat gaataaatga aggattaaat aacgttaaaa catctcatgc ttaaaatgtg     13620
     tagattcagt ggtaaacact gttaactgaa aactctgtca gaccggcttt acggtaaatg     13680
     gttttagtca ttttcatagt ggactttaac cactggaagt cttttatcca ctcttcgaaa     13740
     agtgtaaatg ctggattgac attcattagt tgtgccatta tttataagtt taggttgttt     13800
     ctaaaactaa atctgtcact gttgttttca ttctctcgta tcaagacctt tacattttca     13860
     cggctgtagc tccctgtcat cggaactgag tgattgacag ctgatattaa ccaatccatt     13920
     cgcgttctgt tctagagcag tgggccaata agaagagctt gatggcggag caagcattgc     13980
     gtgctttgtt tactgcagca agttgacatg tcaactgttt taaaccattc ctgagcgctg     14040
     cgtttgttgt ttttaggtac aaagatgcct aatgcgtgaa tgcctcctaa tgatgattcc     14100
     actactccat gttatactcc aattgcatgt ggtgaacgtt ttgctgtgaa aactggtcgc     14160
     atgacatcca attttatgca cttgcacaaa tgctcccaaa tatattttga ggtcgcgtag     14220
     atactatttc gggtgcattt tcgagccctg cataataatt ttagtaacat tattactctt     14280
     tgagttcaaa agtattaaag taataaataa taatagaaat tacaaccatg ttagacccta     14340
     aatacattaa cttttttttt aaatttctat aaatgtaatg taattcaact ttaagatagt     14400
     aataatgtgc acatttttgt aaagtttctt tagatcgata attattgtca aaagcgctat     14460
     acaataaaac ttgaataaat gtaaacaaac actactgata aaacttctgc tattcttttt     14520
     gacagcttat aatttacttt aacactaaaa acaaaactaa acagtattat actgaaaact     14580
     gccgatatgt gatgacataa actgaaaaga aagatgtaaa ggggagatgt atggacaata     14640
     cggatattaa tacaaacgtt ctgaatgcta ctgaatatgt ttacataaag atacatttat     14700
     tgggaatttc tataataata tatagctaaa ctatattcac aagtctgatt cgaattcatc     14760
     aaacttttca ttaattttta aattaagcat tataaaggca ttattcttcc tggtgttcat     14820
     cctcaccttt accacattgg ttccatcagc agcagataca aagtagaaag gcaggccttg     14880
     tttcttagcg aagttgaagc tcttctgcgt gaccttcatg tcagctttaa aacacatgaa     14940
     gaatagaaga taagacacat gcaaaccaca atgctcgtat tgtaatctcg ggtataaagc     15000
     acatttacca tcaatcttat tggccactac cagacacggg atctcgggcc ggtactcgcg     15060
     cagctcttta taccagacag tgagattctt atatgtgatt tttctctgca catcaaacac     15120
     ctgtagaaaa ataataataa aagataaatt cattgtaata gcttttttgt tttttaggaa     15180
     aatcattaat tgtaaacagt ttaatcaaac agttttggac aaacaaaaca aaaagaaaaa     15240
     aaaaagaaaa aatctgctac attctctcca gcaatcttca ttttgactca ataacatggt     15300
     gtagagtgca tgtgtgtttt gttattaatt aattagctac acaaattaat catacaaata     15360
     atacattttt atacattttt ataatttttt caattacacc aaattacatc tttagacaac     15420
     aaaattaatt cagctttatt tgtatagcgc ttttacaatg tagattgtgt caaagcagct     15480
     tcacataaat ggtcatagta actggaacag tgtggttcag taactggaac agtgtagttc     15540
     agtttttagt gtttaagttc agttcagttc agtttagctc agttcagtgt gatttaatca     15600
     ttactgagag ttcaaacact gaattaagtt atggtctata aaaagtctaa atgaactcat     15660
     cctaactgaa ttaaaattat ctggagtatt atttgcaacc ccaggctcag tctgaaaacg     15720
     tagtcccatg gatgtttctg gagactgcaa attatgtagc tggaggtaca tatggctgca     15780
     tttcatttct taagtgaaag ttacggtgcg gtatgatgcc gttcctttcc gcgctttccc     15840
     gctgcaacca gtttgtccag ttagctcgtc atgtacgccg gcggacttga gacgcagaga     15900
     ggagctgacc acgacgacga tgaccggcct cttgtggatt cacaaaaaaa attgcaaaaa     15960
     tacgtacctc cttggacgta tttcgcagtc tccagaaacg tccacgggac tacgttttca     16020
     gaatgagcct gggttgatta tttgatatca ttaaattaaa atatctgaaa gctaataata     16080
     aacataaaat tgacaagaaa tgcacttaaa aatgtaacta taatgaaata taattttttt     16140
     aaaaagtctg ttttactaca ttaaaaatca acaaaatgga gaacaactaa ttctaaaaca     16200
     ctaacatctg agtggtttct cttaccatga cacaagcatg agatttatgg tagtacgacg     16260
     ggtgcatgct tcgaaaacgc tcctgtcctg cagtatccca gaaatctgtg atgcagatag     16320
     acatgtgctt aacagcgcag cttcaacaca cactttaaag ttatcatgta ctcaaaacct     16380
     gaacgctaaa cattgcaata cacaattgta caaccgacca actactcacc aactagaatg     16440
     gtctgtccat tgatggtggt ggtgtatttg tacagagtca aagcgtaagt ggagagttgc     16500
     tgaggtcgac tgatacattc agttaagatt ctgtcaactt tcagaaacac atttgtacat     16560
     ttgagtgtgt atgcatgtgt ttgagtaaaa cactttttat gacatacaat acaatactgc     16620
     ccaaatttgt aataacaacg ttataaatta aagcaatttt tttgtgaagg aggtatgaaa     16680
     tctacatttg gtggggaaga ctcctttttc aaatacaact attaaaatga tttgtatttc     16740
     ggaacaattt tttttctgta attttcttga aaaataataa ataatacatc ttcaagatgc     16800
     caaaatttgt attgtgagga aatgttagta aagctttttt atttttagaa cacaattcgg     16860
     ctgaaaagta tcggctgact gaaaccaaaa ttttctgaaa actaaaaaag ctaagggtaa     16920
     agattttttt tctaaaactc tggcaacagt gttttcctgt ggacacaaca actgaagttt     16980
     tgcctaatga tgttagcatg ttcactattt tctcctttct cattagccaa cacggctggg     17040
     ttcacaccaa atgcggaaga tgcgaatgag gcaaattctg catgcaaacg cattgcgttc     17100
     tccccgttgc ttcaaaccgc gggacagtat ttaactttaa acagttttat acacagatgt     17160
     atgtgtgctt atggacatgg actttttttt ttttttgaca ctcaaccact ctcaatggag     17220
     ttatgataac ccaaaacgcc attggctgtt tttttttaag gggaggagct acactatgcc     17280
     ccaccctctc aaaataagca agttatttca tattacaaaa atttgttaca ctgaaattta     17340
     ctgtacattt tgagatgttc tacttggatt acttgcttta aaatgtgcat ttttattcga     17400
     ctttaacgta atcttaacta aaaaataaat agatggttta tcgcagctct gccagtggaa     17460
     gtggttgagc tcaagaacat taaggcaggg ctcaacagta aggactgccc ggtggcccgg     17520
     ggccagcgtg aaagacactc gggacagtag acaggattgt tactggcccc tatcggccag     17580
     taacgatgag cacgtttttt tttttgtaac ctggtaacaa ccagcacagc gaaaagatgg     17640
     caacatggta gcataattaa ataatgaggc taaaagaaaa cgtctgtttc taaagtctta     17700
     gaagcagaca attacatggg tacaacatta aaaaactgaa aaaaagaaca aaaaaaaaac     17760
     tgttgtcagt ttggaaagcc atttttataa aaactattta gaattgcatt aaaatgccag     17820
     cacatttttc atactgctct ttcatttgca taaaattacg aattttgctc attatacatt     17880
     tattaacata tttaaaatgt ttaagttcta gattcacagg cataattttg ccactattta     17940
     aaatatgtgg ctaagaaata gttaataact ttttagtttt tttggtgggg ccagtaaaaa     18000
     ttttggcagg gcaagtaaaa atctcaacca atggcccgat cggacccata taaaaaatcc     18060
     ttagcgttga accctgatta aggtaaagtc tagatcggat acgtggccag ccggaaatgc     18120
     gatatgcaca tcaatatagc agcatttttt gtgacactgt ataacaataa tttatatctt     18180
     tatagtactg tgatggttgg gtttagggtt ggggttgggg gtaggcatta aaaaatacaa     18240
     tttattgggt tatttaataa ataacaaata gtactcggta cacctactgt ttttacatta     18300
     ttgtgatgat tgggtttagg gtaggggtag tggtaggggt agacgttaaa agaatacaat     18360
     aaatgggaaa tttaataaat aattaaacca tatccatatc tggccgtaac catatccaat     18420
     cttgcaacaa ctgaacatca aatgaaaagc aaatgagaag cgtcttgaag ggggcgtggc     18480
     atgtcagtta ctagaacgca tttgattgat caagatttga tgagaaactg aagtacgagg     18540
     tgacgtgaaa aaatcgttta tgaatttaag cggaagtgac taactgcaag tgatcagaga     18600
     ttggaaaaat ttgtttcacg cttaaccctt ctctaagaaa tagaaagctt tagcatcttt     18660
     attagaatga aataacctct attcctcatg tcatatttca ctggaataat ttatttaatg     18720
     acattccttg gaagattgtg tggtctttac ccaacaaatt tttaattaca aataaggtta     18780
     aagaggtttc cttcaaattg ctaaattgag tttatccagt gaatgtttat atttaaaaat     18840
     gcatcatgaa aaggatcccc tttgttcctt ttgtggaata atagataaat ctgtagatca     18900
     tcttttttgg gaatgtgccc atgtcaagat tttttggaga gaattcagtt tatttatttg     18960
     taaatatttt aaatcctttt tctttgtcat acaaggatgt tttatttggt ttttatcatc     19020
     atgatacagt taaagataaa tattttctaa taaatctatt tattttacaa gcaaattttt     19080
     ttaaacacaa ttgctagttt tttttttttt gtctgtaaat gccctttttc ttatttttta     19140
     gcaaaaattt aaaatattat ttaaatacaa tctctacctt cagccatgtt aaagctttca     19200
     agagttcaca cttagctgat gattggtaat aagctagttt ggcatgcttt cccaggagag     19260
     agccccgagc tcaaaagatc cttgagcccg gagctccctc cttttgcagg gcgagagggg     19320
     agtttgagct tgggtagatc tcgagaaccc cccctcctcc tcctgctaca taaggattgc     19380
     taaggtgatg tgttgctgac agaattgaat ttggtgctaa tttggttttg tcaatttact     19440
     taagtcttat gtttttggga gtgtgggagg aaaccggagg acccggggaa aacccacgca     19500
     agcacgggga gaacatgaac tccacacgaa aatgctgtcc ggttgggtgg atacccgagt     19560
     cggaggcatt tttttgctgt gaggccacag tgctagccac tgggccgccg tgctgccctg     19620
     tagaaaagag gagaagaagg gatggaagag gggaatcttc aagacgaaga tgactaaagg     19680
     gaagatgttt ggttatttat actgggttag gaatagtctg attggtggtt cgtacattag     19740
     cttgactcgg ggccagccgt gtcaatcata agcacgagat cctctcgaaa ttagtttatg     19800
     aataaacttc acttaaaatc aataacacag ccatatcacc ctgtagccca agaccggtta     19860
     ctcactgaag ctaagcaggg ctgagcctgg ttagtacctg gatgggagac cactagggaa     19920
     cactaggttg ctgttggaag tggtggtagt gaggccagca gggggcgctc aacccgtggt     19980
     ctgtgtgagt cctaatgccc cagtaaaagt gaaggggaca ctatactgtc agtgggcgcc     20040
     gtctttcgga tgagacgtta aaccgaggtc ctgactttct gcggtcatta aaaatcccat     20100
     ggcacttctc gtgaaagagc aggggtgtaa ccccggtgtc ctggccaaag tccctctatc     20160
     ggcccttacg atcatggcct cccaatcatc cccttccacc caattggctc gatcaccgtc     20220
     tctccactcc acctatagct ggtgtgtggt gagcgcactg gcgccgttgt cctgtggctg     20280
     ccgtcgcatc atccaagtgg atgctgcaca ctggtggtag tgtggagaga cccccctcat     20340
     gattgtgaag cgcttgggtg tatggccata cacaataaat gcgctatata aatacacaat     20400
     acattacaac actttgtgaa acttacagta ttgtctcttt tctataaatc ccagcgggct     20460
     gtattatatg tgacctttta aacatcactg tgaccttgct tttagataga tttaaagtga     20520
     tttttgtctt tcatattccc cctggcataa tcttttgttt ctctctttgt tttgttccgt     20580
     tgtctacttt tgttgttatt ggagttgtac attttctgtt tttgtactct agttaaacgt     20640
     tcca                                                                  20644
//


spacer
spacer