spacer

EBI Dbfetch

ID   CP001806; SV 1; circular; genomic DNA; STD; PRO; 1829445 BP.
XX
AC   CP001806;
XX
PR   Project:PRJNA40507;
XX
DT   06-NOV-2009 (Rel. 102, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Vibrio sp. Ex25 chromosome 2, complete sequence.
XX
KW   .
XX
OS   Vibrio sp. Ex25
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RP   1-1829445
RG   Los Alamos National Laboratory (LANL), National Microbial Pathogen Data
RG   Resource (NMPDR)
RA   Munk A.C., Tapia R., Green L., Rogers Y., Detter J.C., Bruce D.,
RA   Brettin T.S., Colwell R., Huq A., Grim C.J., Hasan N.A., Vonstein V.,
RA   Bartels D.;
RT   ;
RL   Submitted (23-OCT-2009) to the INSDC.
RL   Argonne National Laboratory, 9700 S. Cass Ave., Argonne, IL 60527, USA
XX
DR   MD5; a5839954aa6b561e58ad4a91d1833a3d.
DR   BioSample; SAMN02603570.
DR   EnsemblGenomes-Gn; VEA_rna001.
DR   EnsemblGenomes-Gn; VEA_rna002.
DR   EnsemblGenomes-Gn; VEA_rna003.
DR   EnsemblGenomes-Gn; VEA_rna004.
DR   EnsemblGenomes-Gn; VEA_rna005.
DR   EnsemblGenomes-Gn; VEA_rna006.
DR   EnsemblGenomes-Gn; VEA_rna007.
DR   EnsemblGenomes-Gn; VEA_rna008.
DR   EnsemblGenomes-Gn; VEA_rna009.
DR   EnsemblGenomes-Gn; VEA_rna010.
DR   EnsemblGenomes-Gn; VEA_rna011.
DR   EnsemblGenomes-Gn; VEA_rna012.
DR   EnsemblGenomes-Gn; VEA_rna013.
DR   EnsemblGenomes-Gn; VEA_rna014.
DR   EnsemblGenomes-Gn; VEA_rna015.
DR   EnsemblGenomes-Gn; VEA_rna016.
DR   EnsemblGenomes-Tr; VEA_rna001.
DR   EnsemblGenomes-Tr; VEA_rna002.
DR   EnsemblGenomes-Tr; VEA_rna003.
DR   EnsemblGenomes-Tr; VEA_rna004.
DR   EnsemblGenomes-Tr; VEA_rna005.
DR   EnsemblGenomes-Tr; VEA_rna006.
DR   EnsemblGenomes-Tr; VEA_rna007.
DR   EnsemblGenomes-Tr; VEA_rna008.
DR   EnsemblGenomes-Tr; VEA_rna009.
DR   EnsemblGenomes-Tr; VEA_rna010.
DR   EnsemblGenomes-Tr; VEA_rna011.
DR   EnsemblGenomes-Tr; VEA_rna012.
DR   EnsemblGenomes-Tr; VEA_rna013.
DR   EnsemblGenomes-Tr; VEA_rna014.
DR   EnsemblGenomes-Tr; VEA_rna015.
DR   EnsemblGenomes-Tr; VEA_rna016.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00378; Qrr.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01808; MicX.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP001806.
DR   SILVA-SSU; CP001806.
XX
CC   DNA Source: Dr. Anna-Louise Reysenbach
CC   Vibrio sp. EX25 was isolated from samples taken from a deep-sea
CC   hydrothermal vent community along the East Pacific Rise.
CC   Genome coverage: 8,5x
CC   Sequencing Technology: Sanger, 454
CC   The NIAID funded Bioinformatics Resource Center PathoSystems
CC   Resource Integration Center (http://patricbrc.vbi.vt.edu/) is
CC   responsible for genome annotation updates of this record.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1829445
FT                   /organism="Vibrio sp. Ex25"
FT                   /chromosome="2"
FT                   /strain="EX25"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:150340"
FT   gene            30..1289
FT                   /locus_tag="VEA_000001"
FT   CDS             30..1289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000001"
FT                   /product="nitrite reductase [NAD(P)H] large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000001"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52688"
FT                   /db_xref="GOA:D0MCH4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCH4"
FT                   /protein_id="ACY52688.1"
FT                   /translation="MPDSAIICSCHNVTKGDLVAEIQAGTTNLTDLKANTKAGTGCGGC
FT                   SNMVKSVLDTQLAAMGVEVNNHLCEHFELSRQEMFHICQVEQIKDFDTLIALHGKGHGC
FT                   DICKPTAASVFASLWNEHIMEPQHQSLQDSNDAFMANLQKDGSYSIVPRVPGGEITPDK
FT                   LIVLGEVAQQYDLYTKITGGQRVDLFGAQLEQLPEIWQTLIDAGFETGHAYGKSVRTVK
FT                   SCVGSTWCRYGVDDSVGLAIELENRYKGLRAPHKLKFAVSGCTRECAEAQSKDIGVIAT
FT                   ENGWNLYVCGNGGMRPRHADLFASDLSKSELITMIDRVLMFYVSTADRLQRTSVWMENM
FT                   EGDLDYLKQVILDDSLNLCDSLDEQMARVVDTYQCEWKSTLDNPQKLQRFRPFLNSTSG
FT                   SKVLPYQRVRGQRIPVKQEV"
FT   gene            1290..1625
FT                   /locus_tag="VEA_000002"
FT   CDS             1290..1625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000002"
FT                   /product="nitrite reductase [NAD(P)H] small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000002"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52689"
FT                   /db_xref="GOA:D0MCH5"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCH5"
FT                   /protein_id="ACY52689.1"
FT                   /translation="MAALTKVKLCQLDDLMPFIGATVLIEGEHVALFCIPDSGVYAVQD
FT                   WDPIGKAYVMSRGIVGDIDGEMCVASPLYKQHFSLKSGQCLEDEAHCLKTWRVTVDDNQ
FT                   VCYLVEE"
FT   gene            complement(1724..2128)
FT                   /locus_tag="VEA_000003"
FT   CDS             complement(1724..2128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000003"
FT                   /product="predicted DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000003"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52690"
FT                   /db_xref="GOA:D0MCH6"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCH6"
FT                   /protein_id="ACY52690.1"
FT                   /translation="MSIEVIAVRLTKDMDLKLSLTKLVEQHGIKAGSIASCVGCISHLN
FT                   LRLAGAESTLTKQEPFEIVSVMGTLTPEHQHVHISVSDREGRVWGGHLMEGTVIDTTAE
FT                   LIIHSYSELEFTRAMDNSTGYTELQVNPSK"
FT   gene            complement(2130..2705)
FT                   /locus_tag="VEA_000004"
FT   CDS             complement(2130..2705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000004"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000004"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52691"
FT                   /db_xref="GOA:D0MCH7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCH7"
FT                   /protein_id="ACY52691.1"
FT                   /translation="MARKANFDREEKLLVAMDVFWRKGFANTSISDLTDELNINRFSLY
FT                   NTYGDKQQLYYEALDTYLKKISLPSLNDLEKDDASLPELESFLKSFAELQRKRNCGCFI
FT                   QNALIEHAGEDDDVLRKGHFLFDHLIDIIADALTNAQKETLVPKTLKPEELARFVLNNM
FT                   QGMRVLGKAKRYADLDTALSCLLVLIRK"
FT   gene            2850..3464
FT                   /locus_tag="VEA_000005"
FT   CDS             2850..3464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000005"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000005"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52692"
FT                   /db_xref="GOA:D0MCH8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCH8"
FT                   /protein_id="ACY52692.1"
FT                   /translation="MKLYETAITPSCKRVSIFLKEIGGDVERIALNVRDGENLAEDFKQ
FT                   KSVNGKVPLLELEDGTTICESVAICRYLDEAFENNLALFGANQLERAQVEMWHRVVEFQ
FT                   GLYAAFQAFRNITAIYEDRERCVKEWGEESKQRVQEFLPLLDKRLGESEFIAADHFTIV
FT                   DITGFILIGFAIKGLEIDVLTTAPNIARWYEQVSARPAFLS"
FT   gene            3678..3938
FT                   /locus_tag="VEA_000006"
FT   CDS             3678..3938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000006"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52693"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCH9"
FT                   /protein_id="ACY52693.1"
FT                   /translation="MRIQVKTINNVLIALLMVSVFGLVALYLNNTQQNEQIEKLQSQLI
FT                   EKEHQILISNEALSYTRYQHQLLAEDYSRFRNEQSVTSVLR"
FT   gene            3968..5161
FT                   /locus_tag="VEA_000007"
FT   CDS             3968..5161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000007"
FT                   /product="serine phosphatase RsbU regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000007"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52694"
FT                   /db_xref="GOA:D0MCI0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI0"
FT                   /protein_id="ACY52694.1"
FT                   /translation="MKSILLVDDSKTVLLYISSALEKQGYEVIAVEDGQSALEVLTYRK
FT                   DIQFVLSDLMMPGINGIELCRQLKSQVSERYIFFVLLSSRNDQSSIVKGIDAGADDFVD
FT                   KKTSVEELQARIRAGFRTLQLHNKLVERNKELDAAYQTIHQDLQSASHLMEQLLPAESS
FT                   IQNMQFSYAYKPCSQIGGDMLGYFELDEQHVAFYVFDVSGHGVSSALMAFSIQQTLSQN
FT                   LGPDSITMELRDGDYCISEPAAVIDRLNRRYQQTRNSQLYFTMVYAILNTESGQLRYCT
FT                   AGHPKFLVWRASTETTELAGEDNFMIGALQPMEYVGNQIILSEGDVVWLYSDGLIEARR
FT                   GEEMFSVQRLASSIKAVCSSQLEVEVQARCVFEQVQSWQNKDEFDDDASLLQVRWRG"
FT   gene            5185..5682
FT                   /locus_tag="VEA_000008"
FT   CDS             5185..5682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000008"
FT                   /product="putative anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000008"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52695"
FT                   /db_xref="GOA:D0MCI1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI1"
FT                   /protein_id="ACY52695.1"
FT                   /translation="MFQSEFKRTYGGSLTRSRSASKEVAKFLMDNQVSLSTAQSLELCV
FT                   VELMNNAYIHSYSEIEGKPIDVECRIRCDQMSDFIELRVSDYGASINEMTFNQHKNKQI
FT                   EAPNLMDDDSWSASGRGLMLVAQLSDQFKLEKEIGKNTFVLVKRNGEKLTTKQDLFTPP
FT                   GP"
FT   gene            complement(5715..5906)
FT                   /locus_tag="VEA_000009"
FT   CDS             complement(5715..5906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52696"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI2"
FT                   /protein_id="ACY52696.1"
FT                   /translation="MNNSNFKELIESLKDLTPTQKRYLLSRTKMALDDESNMLNISDIL
FT                   TPEELEALLSPAPTTNTK"
FT   gene            complement(5941..6276)
FT                   /locus_tag="VEA_000010"
FT   CDS             complement(5941..6276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000010"
FT                   /product="HPT domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000010"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52697"
FT                   /db_xref="GOA:D0MCI3"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI3"
FT                   /protein_id="ACY52697.1"
FT                   /translation="MINFDVLNKYMENDVDLIVTVFSTYLEDHANDIQRINELYANKCW
FT                   PELYLLAHSLKGILESFGEETAVIVFTKIEAETRNDNEPDSSDIAIVTKELAAINQQIF
FT                   AYLKNMQ"
FT   gene            complement(6706..8856)
FT                   /locus_tag="VEA_000011"
FT   CDS             complement(6706..8856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000011"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000011"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52698"
FT                   /db_xref="GOA:D0MCI4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI4"
FT                   /protein_id="ACY52698.1"
FT                   /translation="MEDSNKNNSINNKDSGDKTKIVKTQKRDNAIQSNKVASNEGSVQN
FT                   KNETNTKLSQKENTPLVNKKINNKNNTSNNDKDIINENLIGTTVKNRYEIESVLGHGGL
FT                   CDVYLAKDKILESSGSETPYVALKILQKEFASQPETARMLIREAQQTQRLSHPNIIRVF
FT                   DFGVDGEIYFLVMEYINGETLENLIQRSRPHGLKFNATLSILNQVLDALSYAHSLGVVH
FT                   ADLKPANVILTSEGNVKLLDFGVSKTHQLKQDQYAAKRKSENVETLGYTPNYASINLLS
FT                   GKEPNLSDDMFALFCIAYELLSCKHPYSRTPVNEALKKKMKVSKPANMPASKWPIFARV
FT                   FSTGIIPKDLTPEQLKQKLNMRYWPIVSGVAASVLLVTGIVFGYQQQQETISDLEIAIN
FT                   KQNDQINGQEWLLDTPPEKSLSLINSEKNLHPVIKAGLLRQHKSYLLSEFESEIDQVLN
FT                   SDANNYPNYDEIESVLNKAKAYYPDSHKIEVLALDIQSSKHSTLLSIARQINSQLEKSR
FT                   YSKEEDSKSIYELKDELNQIHQDYPFTPSSLSSDVFGKHLTEALKNKDAAALVALIKVG
FT                   NTFFSNVEEHQNNLKISNAMKDAVLQMKLYETALDSNDPLPFPDEAARILFQEEFENFY
FT                   YRLEKARTTTHLDNLVKDVDQFSKNFPIGFQDINDLRFKTADKYLRFSDILLNKRRTTS
FT                   ARRAMKKANELMRQVEQDSKQS"
FT   gene            9169..10362
FT                   /locus_tag="VEA_000012"
FT   CDS             9169..10362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000012"
FT                   /product="uncharacterized protein ImpI/VasC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000012"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52699"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI5"
FT                   /protein_id="ACY52699.1"
FT                   /translation="MKLVLTITSFHKFTPEIESEFVFESSDEHAKVTFGRSEQCDWTLP
FT                   DPERVVSGTHGELIKFGDKYLIKDLSTNGTFVNNAVTPVGQGNEIALSDDDTVSLGDYQ
FT                   ISVSIQTSTEAFNNQESNFRSSSEPEAFSSSSEAEFVDLGLSASELLNESVPSDFQLDI
FT                   GLVDDFIDIPKPEKQSVDPTPVPETPRQLERQSTPKFDSKGSELAAFIKGAGIDPTMIP
FT                   SDNREQWFEQLGESFSLMLVGLMETLHNRAVFKQTNRLSHTAFRKSENNPLKFSANLED
FT                   AIHNLYNRQTASFLKPSAAIKEAFSDIENHEQALMKGVEGTVSSVMSLVEPTSIYSEAL
FT                   AKDTVINKVIPARKYAQSWKRFEDIHEKLSDDIINKESPFYLEDFAKHYELALKNKS"
FT   gene            10374..10829
FT                   /locus_tag="VEA_000013"
FT   CDS             10374..10829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000013"
FT                   /product="type VI secretion lipoprotein/VasD"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52700"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI6"
FT                   /protein_id="ACY52700.1"
FT                   /translation="MKRVYQYILLLISMVLFGCSAANLVVDPYSDLEITANHNINPDSN
FT                   GRPSPVVVYVFELTSNTLFESQDFFSIYEESEKVLGPDLVNKYEISLTPGQKETYQASM
FT                   SPKTEYLGIVAAFRDIENSNWRQVIEVDKTGYNTYQILLEDLSLVVK"
FT   gene            10887..12176
FT                   /locus_tag="VEA_000014"
FT   CDS             10887..12176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000014"
FT                   /product="uncharacterized protein ImpJ/VasE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52701"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI7"
FT                   /protein_id="ACY52701.1"
FT                   /translation="MFLRPQHFQQHERATSQEFKGLHQFGGAYNWGVWKCRVKEHALKD
FT                   GLIELDHFEAVLPDMTLVNTLTASDSVVPLFIDKDVENTLVKITLPLSNVKGKNVSDVS
FT                   EAIVSRYVLKDVDVIDNLTGQDEETIQVAALNLELKASNDKLAGYVELPILKIKEVTAE
FT                   GEVILDDSYVPPLINLLSDKVMSAYLRNVIAMTKMRADVIAQRLIKGKAASASAVDFIM
FT                   LQMLNRYEAMLKHFSDLDRLHPLELATTLKGYIGELATFSDKTKRMPSLLTYDHLDVSS
FT                   VYSELNQVLSQYLSVVLDQTASKLPLEPRQYGIQVTPLPDKRLLESCQFVLAVKADTTT
FT                   DEIRRLVPAQLKFGPAEQIRDLINNQINGINVAPLSVVPRQIPYQTGYVYFEVVKKGPF
FT                   WMRLKDSGGIALHLSGHFPNADLELWSISQ"
FT   gene            12188..13480
FT                   /locus_tag="VEA_000015"
FT   CDS             12188..13480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000015"
FT                   /product="Flagellar motor rotation protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000015"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52702"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI8"
FT                   /protein_id="ACY52702.1"
FT                   /translation="MEQTIVKPTPGGRAPAPKPQSEKSADNTVVISKSPELVNNDSVVA
FT                   YGNNPLLAEANGLLSIIGQIRATATHSDPLFLKETLAQKLRDYENRLRHHDVDLDTIDT
FT                   ARYCLCCSLDEAVLNTNWGGHSFWSHDSLLSSFYASSQGGEAFFKYLDKCMAQPDTNLD
FT                   LLELMYVCLSLGFLGQYRLEKNGLESHRKLRRQIIAILKSYGRGIPQELSNSIEQHILN
FT                   GSKASDRAPLWVVCSVTAALLVCIFMYFSYELNKASNRTFSQLVNLVQPQQLNQDTTSE
FT                   SKSAPISERISMYLATEIGKGLINVEPLQDRVRISLKSQDLFESGSADVVAYIQPVISK
FT                   LARTLESTQGKIIVTGHTDDRPIFTSKYPSNWHLSLARATAMSEQLISNSTLEGRVIPE
FT                   GLGDARPLVENNSDENRAINRRIEIDLLVAN"
FT   gene            13497..17015
FT                   /locus_tag="VEA_000016"
FT   CDS             13497..17015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000016"
FT                   /product="IcmF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52703"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCI9"
FT                   /protein_id="ACY52703.1"
FT                   /translation="MRIKEIGRIFTQRWFLGLIGVAACSIFIWVVGPLITIAGYEPLKS
FT                   DFQRLVTILVLVFVWALFNVTKQHKQKVKEDESIQTLLEVDSQSDKEAASEIDLMRERI
FT                   EQAVKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTVLKQSGLEFPLADSLGSDSIAGVG
FT                   GTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYRTQRPINGAIVTI
FT                   SLASVMSQTRTERSLHARAIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFSDLSK
FT                   EEREELFGFMFPREVADERGVISLFNKEFHGMLERLDARMLRILETEDDLEKRALIFEF
FT                   PKQLRVLQANLDEFLAEIFAQNSFEEPALIRGVFMLSSVQEGLPVDKLMNESTNGLGLN
FT                   RLALAKSPTGSHSYFVKNLFDKVIFKEQLLGTVNRHYQKQSGWMRRGVYIGCASLLLGA
FT                   SALWLMSYKWNSQLIVDTNEQAGHIEAMIGAESLDFEADIISAVETLDRLMTLPLGKQS
FT                   NYGDADSVKRFGLYQGDKVSQAANNAYSDALTQYYAPLLLDSLVTEMESNQQHREYLYE
FT                   TLKTYLMLFNPDKYQQDEVLAWFNFYFERQYPGELNLDLRKGLLQHTQNLLENNGQGFS
FT                   YNTAAVTNAREVLTQMSLPERAYQRMKIQFSKSHVPSFRLTDVLGPKGLEQFERASGKP
FT                   LSQGISGFYTYNGFHSIFQIQINRTVKSLMEENWVYGDDLKAHEIDQDSAIQGVQSRYY
FT                   QDYVNEWKTLIEDIQLKQAPSLELATEQARVLSGVERPIESLLRAIQKEVGLSKVSLSE
FT                   NQKATSEVAGKVAKVKFSNTADRLDMYLPEENGFNVALPGKEVESHFSEILRLGEQDFD
FT                   DIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDVAASFARAKELLPRPFNQWLG
FT                   ELSQESVKFAESGSKDHLNQLWVTQVVRPYQRTIAGRYPFEPNASREVRLKDFKRFFGY
FT                   GGTLDSFFQEYLEPFVDTSKSRWRLEKEIGVRPETLMVFQRAKRIRQSFFESDNSLRVE
FT                   FGMKPVYLDQHITRFVLELGKQDLVYKHGPARAKSLSWPAGQDQTRIVFTPPESKREIA
FT                   HTYEGEWGIFKLLDQSLKARPESRKDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERF
FT                   RCPRTL"
FT   gene            16997..17692
FT                   /locus_tag="VEA_000017"
FT   CDS             16997..17692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000017"
FT                   /product="protein phosphatase ImpM"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52704"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ0"
FT                   /protein_id="ACY52704.1"
FT                   /translation="MSANLVTSAWGYIGKMPAKGDFVKDGLSQDFSERWHDWQQAVIAV
FT                   SREQLGESWNEHFLTAPVWHFALDVSYLEDSTYIGSMIPSVDACGRYFFFTIARAVKGE
FT                   AAQYWGDKAWTEDSASLALAVLEDDFVFDVWHKSMQEKNDLVANVKSEVRPLKFLYQSQ
FT                   ISTIFHDQGGADQSALLNYLIKEKLSKPCFWWTEGSTLVEPCMFMTSGFPSIGQFSAML
FT                   DGGWKKWNW"
FT   gene            17702..18496
FT                   /locus_tag="VEA_000018"
FT   CDS             17702..18496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000018"
FT                   /product="serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000018"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52705"
FT                   /db_xref="GOA:D0MCJ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ1"
FT                   /protein_id="ACY52705.1"
FT                   /translation="MNWNYFTFAKSHAGKVRPYNEDALLDMTEQHIWVVADGMGGHSAG
FT                   DIASQMLVDRIARHMQDVPNTNIDDIRSVVQAANLEIYQYAQNHLDGKTMGTTLVLLFI
FT                   QDGYYHCLWVGDSRIYQLRNGHFSQKTRDHSQVMDLVDQGLLAFEDAESHPLANVITRA
FT                   VGVDESITIDQVSGQLADGDQFLLCSDGLSKELTSDEIHRTLYADSVNQAGLALMHSAL
FT                   VRGASDNVTCALVKVRQAQTEFEAVTREDATIPVFLRGRSYE"
FT   gene            18489..19607
FT                   /locus_tag="VEA_000019"
FT   CDS             18489..19607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000019"
FT                   /product="uncharacterized protein ImpA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52706"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ2"
FT                   /protein_id="ACY52706.1"
FT                   /translation="MNSEMFDWYEQALAPISQENPTGVDPREDVSPQSAYYRLKDQRMA
FT                   ARNAERNALIEEESIYTHSNLWRVFIEEVPEILTNQSKDLEFVAWLIEALTRLHGFRGM
FT                   GVGYKLATEFIEKFWDDLYPMPDEDGIETRISAITGLNGIDSEGTLIFPIACIPLTDVG
FT                   VEQAYAYWEYQQAIELERLDEDKRRNRVDLGATELSDITTTVKSTSDAFYRELIADLEF
FT                   ATESFNEFSQRLDEAVGDVTPSSYISKRLESIHSALKHLLGERFNQPQAVFEELEEVDE
FT                   SSSSEQQVSSQSSDALLATNMKSREQAIRQLQQVADFFRESEPHSPVSYSIEQIIRWCG
FT                   MPLPELLAELISDGDAKKSYFRLVGIAEQNEN"
FT   gene            19623..20153
FT                   /locus_tag="VEA_000020"
FT   CDS             19623..20153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000020"
FT                   /product="uncharacterized protein ImpB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000020"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52707"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ3"
FT                   /protein_id="ACY52707.1"
FT                   /translation="MTSIHSKLSRVRKPRVHITYDVETEGTTLKKELPFVVGVMGDFAG
FT                   QNTEALKPLKDRRFIQIDRDNFDDVLKKMNPSVKFKVANKLANDDSQFEVDLNFKSMQD
FT                   FEPAAIVNQVDPLRQLMETRNKLRDLMTKVDRSEELENILEDVLNNTDNLAKLAGELDL
FT                   GKKAKSDGTEGAE"
FT   gene            20153..21646
FT                   /locus_tag="VEA_000021"
FT   CDS             20153..21646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000021"
FT                   /product="uncharacterized protein ImpC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000021"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52708"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ4"
FT                   /protein_id="ACY52708.1"
FT                   /translation="MTTEAEKQLDPTVNEQTTSFLDQAIGATKQTEASRAEELIKTLTE
FT                   EAMKGTVTWNKNLTVTFREAINLLDKQISDQLSEVMHHPELQKLEGSWRGLNYLVMNSE
FT                   TSSTLKIRMMSMTKKELHKDLSKAVEFDQSQIFKKVYESEFGSAGGEPYGALIGDYEFT
FT                   NHPEDIESLRLMSNVAASGFSPFLSAASPALFGFDEWTELSKPRDLDKVFESLEYAQWR
FT                   SFRESADSRFVSLTMPKVLARLPYGQATAPVEEFGFEEFEVDPVSGIAVNAEHNDYCWM
FT                   NSSYVLGVKLTDAFSKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITD
FT                   RREAELGKLGFLPLCHYKNTNYAVFFGAQTCQKPANHESPEATANAAISARLPYMMATS
FT                   RFAHYLKVMARDKIGSFMEAEDVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVK
FT                   EIPGAPGSYNAVAWLKPWLQMEELTTSLRLVAKIPQSGG"
FT   gene            21711..23210
FT                   /locus_tag="VEA_000022"
FT   CDS             21711..23210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000022"
FT                   /product="uncharacterized protein ImpD"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52709"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ5"
FT                   /protein_id="ACY52709.1"
FT                   /translation="MSLNFRDPSKLKHEFSTGGHAELDSPWLTRFNESSDLVEAARIWL
FT                   EGTRSRDLDSFRHSVMNTINRIDELLESQLNEIIHHPEFQQLERGWIGVRYLCEQVDTR
FT                   SSDSVKVKVLAATWNEVSKDALKAIEFDQSALFKLLYQNEYGMAGGEPFGVVVGDYQLR
FT                   CDASKNYFDRDLSVLSKISQSAAAAFSPFIMSASPEMFGVDSFSQLSAIRDIAAQFEQA
FT                   DYAKWRSLRDNDDTKFIGLTAPNVLFRQPYKSDGSRNDQFDFQEHVYDSNRDLLWGSSA
FT                   YCFAAVSIRAFREHGWFTHMRGIKQGDYSQGIIVAPTRNKMRVNGKNDRERCPLNLKIS
FT                   ERKEQELSECGFISISPVPETDMVGMTSNVSLYKPKQYAEKHISTNAKLTSMLQYTLCV
FT                   SRVAHYLKVMGRDKIGGYQDAESLERDFQRWLHQYTTASDEASDELRAKYPLNEAKITV
FT                   REKRETPGHYYSVIHLRPHFQLDQMVSSIKLITELSPEHLV"
FT   gene            23221..24015
FT                   /locus_tag="VEA_000023"
FT   CDS             23221..24015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000023"
FT                   /product="protein of avirulence locus ImpE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000023"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52710"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ6"
FT                   /protein_id="ACY52710.1"
FT                   /translation="MTQWKNALSQGQLQQALKLLIDEIKAAPKDASLRSSFIELLCIDG
FT                   DFERADEQLMQSIKLFPEYLPGASQLRHLVKAAQARKDFIDGAASAKVLGDEEFTKELV
FT                   RFNLALKNQDYAEASHLAHSIEEHRTIKGFNINGTNYEDARDIDDRLGGYIELFSTAGN
FT                   YFLVPISSIQALEIKAPTSLLESIWRPVEFDIDGLGEGEGHMPLTYVDSETDAQKLGRE
FT                   TDWKQLGEQESFVGLGQKCWLVGDSALPICDLTTLLESKQIA"
FT   gene            24023..24487
FT                   /locus_tag="VEA_000024"
FT   CDS             24023..24487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000024"
FT                   /product="uncharacterized protein ImpF"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000024"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52711"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ7"
FT                   /protein_id="ACY52711.1"
FT                   /translation="MSLTVSLLDKLMDSDPSTRDEKDFPTSQQQMLNSLLRDLESMLNS
FT                   RIGWKNIPDDLLEVRYSILNYGLPDFSSMPYSSQEGQNQLCDIVHDAIKEFEPRLRNPY
FT                   VQISDEKNAIDRVLRLQISATCLIDNSIHEVRFNSEVEPVNLGMKLSRAK"
FT   gene            24484..26307
FT                   /locus_tag="VEA_000025"
FT   CDS             24484..26307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000025"
FT                   /product="protein ImpG/VasA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000025"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52712"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ8"
FT                   /protein_id="ACY52712.1"
FT                   /translation="MSEEFLKYYNRELAYLRHKGQEFGEQYPKIAARLRISEEQVDDPH
FT                   VERLLEGCAFLTARIRQSLDNSYPQFTESLMGQLYPDFHAPIPSMSVIKMNCSSSTSSF
FT                   FDVEEGERVVIGAPGYHECEFRTCYPVRMYPVDVTSGAFKNAPLKSVGSQWESHAHSVL
FT                   KIQLTAQDEETSLSDMGLERLRFYLNGHSQLTFKLYQMLFQNLIGLSVVAGGKEVRSLT
FT                   KRHLIEVGFSEDEKVVPYSKRSFSGARLLVEYLHFPEKFMFFDITELGLSELALGEQAE
FT                   LYFYFDTNDDWLPKQVDEESLMVGCVPVVNLFKSVMEPKRILPTEYDYHLSPQYQEAES
FT                   NEVVSISDVTLRNWNKTYHNLPCYHAGEHTHYMNASEIYWLMRREDKNWAGGYDEPGRE
FT                   TYISFVDKRHQLFSPESRENWLMYVEAECCNRNLAQKLPFGGGLPKVSLPEVNDNFESV
FT                   RCLVSISETLRPEMDESTRWQLTKLLTLNHFTEEDGLTTLKQTLNLYAFSGTAETKAVI
FT                   DALAKLEFEPTTGRVSQKGKVGFAHGIKIILTVSDQILPKEQIFLLGSVLSVYFAQYAE
FT                   INIFTQLEIRLKSTGKPFHLWPALTGDKVLL"
FT   gene            26304..27269
FT                   /locus_tag="VEA_000026"
FT   CDS             26304..27269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000026"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52713"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCJ9"
FT                   /protein_id="ACY52713.1"
FT                   /translation="MIAEQFYRDLKQHPLFEAIHLIEHEILQAEAQIGTDALPKHEKLH
FT                   LKVNPSLGFENAQLCDLKHIDSHKLALETNLIGLTGEQGVLPQHYSELALHRQKEGDTA
FT                   MVDFYDIFNHRLLSLYYRCWQLSQLTVQSRAHAQGLRSPLEDCKSALTGQGSSLSLHYG
FT                   GVFASPTRSKAGLKSVLECLSGCQVKIHEFQGQWLHLAKEEQTRLSSRTMPEGQFAQLG
FT                   SGASLGSKAWNINAGTTIEFLPKHKGLVSKLLPNHPNVEIIKRAAYEFIGKHKQVKWQL
FT                   TTKHSLLPQVCLSKKHGQLGVGSVLKKHKRTKDRTITITI"
FT   gene            27280..29847
FT                   /locus_tag="VEA_000027"
FT   CDS             27280..29847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000027"
FT                   /product="ClpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000027"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52714"
FT                   /db_xref="GOA:D0MCK0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK0"
FT                   /protein_id="ACY52714.1"
FT                   /translation="MASLSLSALVERLSPQAKETLEQAAAMASSRTHHSIEMSHWLMTI
FT                   IQHPADIYSEVFDEFDVDKIKVETDLQKTLEKYKTGCQSVPGLSAHTVTVMQNALLSAT
FT                   IEFNQEQLDCIHLLFAYLSDDTLVNMAGSISPELNKIEPSRLLNFKESNTRQSGSNDLG
FT                   KSNANSALNQFTTDLTEQAREGKIDPVIGRDNEIRLMIDILLRRRQNNPILTGEAGVGK
FT                   TAVVEGLAQKIIDGDVPPALQNVAIKSLDLALLQAGAGMKGEFENRLKNLVKEVNDAPQ
FT                   PIILFIDEAHGLIGGGGQAGQGDAANILKPALARGELRTIAATTWAEYKKYFEKDAALT
FT                   RRFQVVKVDEPAPDLAIEMLRGLLDVMAQHHDVHITSQALNAAVQLSARYINGRQLPDK
FT                   AVSVLDTACSRVALSQSSTPGGLDAKRNKLKAKQAEYEHLSQESQLGAPLDMQLQDVRK
FT                   EIDVLSSEIVELETLWEKEKEWVSEAKSLRAQIIKEGSETARDKLQELESSLSANSQPL
FT                   VFSHVNEALIAEVISDWTGIPLGKLQDDEIQAVLSLKESLCKRVVGQEHALEVMSEVIK
FT                   TASAQLTDETRPNGVFLLTGPSGVGKTESALAIAEKVYGSEENVTTINMSEFKEEHKVS
FT                   LLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGSIKDGE
FT                   GRDIDFKNTIIIMTANTGTETTMSLYSDPDLSPEPSALKDALRDDLLVDFKPAFLGRVN
FT                   VLPYLPLSREVLIEITKLKLAKVTNRIRKNYGADLFFDEELINDIVDNSNESGSGARVV
FT                   QTTIENTLLPKISHEILHAILNDKTFDEIIVKGTTSGLDVSIV"
FT   gene            30056..30535
FT                   /locus_tag="VEA_000028"
FT   CDS             30056..30535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000028"
FT                   /product="hemolysin-coregulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000028"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52715"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK1"
FT                   /protein_id="ACY52715.1"
FT                   /translation="MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTA
FT                   MDREASATRLYDLTITKLQDRSSPDLFKEATIGKGKPAVFHITKQGEKVEEIMKIELTD
FT                   AMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM"
FT   gene            30584..32419
FT                   /locus_tag="VEA_000029"
FT   CDS             30584..32419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000029"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52716"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK2"
FT                   /protein_id="ACY52716.1"
FT                   /translation="MKRATQDNNFIRISSPFGKDAIILNSFEYKEEISELFSLRAKAYF
FT                   NDQRSELNEIIGKEVTITLENSEDVSSKPRYIHGYVSAARLEGQRVSNTHNGENYKNIE
FT                   LLIEPKLRFADYRKNCRIFQHKDIKEIISEVLSEHSVAFSFELTKSYPKYTYKVQYEES
FT                   DLEFVRRLLSEEGLSFCFTHTKSVHTLKIFDDISFYKPGTEFLVDFDTGTAKSSHISSW
FT                   HETQVLTTKASQKSGYNMLKPSSNPKNTAKGESDFFTVPESEYFEYMGETESDDQYALR
FT                   NTHAIEALQQNAYLCRGEATCRTFSVGKCFKFKKHEDKSRVGKEYVLSAVFLSAAVYNQ
FT                   TGQGGTAAQGVKVSFSCVDSKTILRPSVNYPKPQMKGLQTAVVTGNKDGEIYIDKHGRI
FT                   KVQFHWDRVGKYDVNSSCWIRVAQNIAGNGWGSVFHPRVGQEVIVEFVNGDPDQPIVTG
FT                   SLYNGSQLPPYTLPEQSSQSGYKSRSVQKGTSNFNELRFDDKPGEEHIYLHAEKLFQML
FT                   VEDCVDIAVENSKTEKVTNDVNQEIGKNATLKVGKNFSNETGEVLSFNAGKSIEIKVGG
FT                   ASIQMSSSGEINIKGNKISINGSAIALKAGQISLN"
FT   gene            32431..32721
FT                   /locus_tag="VEA_000030"
FT   CDS             32431..32721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000030"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52717"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK3"
FT                   /protein_id="ACY52717.1"
FT                   /translation="MGKPAAILGSFHLCPKKTGKIPHVGGPVVVGSPNVTIGGIPAARQ
FT                   GDKLICIGPPDSISAGSSSVTINGKPAARVGDSTSHGGKILSGMPTVLIGG"
FT   gene            32722..33561
FT                   /locus_tag="VEA_000031"
FT   CDS             32722..33561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000031"
FT                   /product="NAD/NADP transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52718"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK4"
FT                   /protein_id="ACY52718.1"
FT                   /translation="MPLAFQTHLLAINGRPYTVREIDNECFRLPAETPRSYPDQSLYEQ
FT                   ILNLVRSKREILEQSDIKGNICVLLPSSVDKSLLKALINEFSLILGNSANREIYFYPYG
FT                   QAAFLMALNRINREVNETQATWILAIEIARDAEEHAKSQNSIILTKCFFQQSGLVTDDV
FT                   RIDLDTKQQSIAVDKVFKQLGVGCDHSLSELHLSVDGDEPRWLNAMQFLSPWVTDQTQY
FT                   QFIDVKLGGLGACGGVLKVLMIEEHQRNSLNSDFHVLQADIEPDGYTVGVLYNWHNE"
FT   gene            33886..35019
FT                   /locus_tag="VEA_000032"
FT   CDS             33886..35019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000032"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000032"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52719"
FT                   /db_xref="GOA:D0MCK5"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK5"
FT                   /protein_id="ACY52719.1"
FT                   /translation="MKFIHTSDWHLGRQFHNVSLLEDQQAVLEQLINYIEHNPVDAVVV
FT                   AGDIYDRSVPPTVAIELLNRVVKRICTELKTPMILISGNHDGAERLGFGSEQMKNAGLH
FT                   IVSNFEDMLTPIIIKTDSAGEVAFYGMPYNDPEQVRFAYKTSVSTHDEAHQLLVEQIRE
FT                   HFISEQRRVLVSHCFVDGAIESDSERPLSIGGSDRVSHEHFLDFDYVALGHLHQPQKKG
FT                   AEHIRYSGSLMKYSFGEQNQKKGFTLVELDKKGFVSAKHIELIAPHEMRIVEGELDKVI
FT                   EQGKTDPKNEDYLLVRLMDKHAILNPMEKLRSVYPNVLHLEKPGMLIGVEQEMAQAKLA
FT                   RSEIDMFRDFFIEAQDSQLSQEQEQAVTDIIKQLSQQ"
FT   gene            35029..38085
FT                   /locus_tag="VEA_000033"
FT   CDS             35029..38085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000033"
FT                   /product="exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000033"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52720"
FT                   /db_xref="GOA:D0MCK6"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK6"
FT                   /protein_id="ACY52720.1"
FT                   /translation="MKPIKLTMQAFGPFAKTEVIDFEKLGRNPLFLINGPTGSGKTSIL
FT                   DAICFALYGETTGNERQGIQMRCDLSAQDLPTEVVLEFSLHGKQYRVVRSPEQEAPKAR
FT                   GEGMTVKKHTAALYELGETEKLITSKTTQVKTEVSNIIGLNETQFRQVMVLPQGKFREL
FT                   LLASSKEREEIFGQLFQTDIYKKIEYALKDKASAISKAKDEFDNQIRGALQVAGVSSEQ
FT                   ELLHQLEQATEQLEVDRKKEQASLDKLNVAKSELQKAETINGEFSKREQAENALKLHLE
FT                   HSDSIKVRQQQLENAKNANKIELPYVALQNAKTQTQELRQKIVALKESLDKANAVTKEK
FT                   ENLQQSAKEAAAKVPQLTQLQYQLESMKDKLVEKANLERKITAGHQQKQQFEATLKQYI
FT                   ELKDKLAFQAQQGQKDLEQARVDVALVGSIDAEIKQKQRLLQDLQKLHGLTLELSKLTA
FT                   LTVSKQQSLQEASQRYMQCQQAADTIELKWHNAQAAVLAQRLKAGEACPVCGSQAHPNL
FT                   ATFVEEVVTKEQVQAARVKEREAQTSLNQLSNQLEQHNVVIIQHQNQIDQLKEELGEHA
FT                   ASEISTVQTELQALNDQLLRLQSIDIEKLEKNVEQLNQRCLVGENKIHELQNQMAANES
FT                   TVQANQEHLTQLQASIDPKYSSVDALERDISLTKEQILTLNTGLEKAQNALQQAVLAQS
FT                   NAESQLVTNKQWLSESEQKLSQAELAWNEALQASKFEDESSYLNSRVTDDELQAWQKEI
FT                   DNFKQTQTKLEQTLHDLNHALKALERPDLDSLNDSLTTLQAQYIEVRNQLDTTRSTFER
FT                   IEKVRKDIATLHEKNSKLEEEYKVFGTLYDVASGKTGSRVSLHRFVLGVLLDDVLIQAS
FT                   QRLSLMSKGRYILARKTEGFKGAAGRGLDLMVEDGYTGKTRDVATLSGGESFMAALALA
FT                   LGLSDVVQSYSGGIRLDTLFIDEGFGSLDPESLDLAIQTLVDLQQTGRMIGVISHVSEL
FT                   KEQMAQRVDVEPSRVGSTVSVKSQLTRTV"
FT   gene            complement(38176..39090)
FT                   /locus_tag="VEA_000034"
FT   CDS             complement(38176..39090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000034"
FT                   /product="transcriptional regulator LysR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52721"
FT                   /db_xref="GOA:D0MCK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK7"
FT                   /protein_id="ACY52721.1"
FT                   /translation="MSNISIKQLETFRTVMRSGSVTVAAKTLCRTQPAISAMLVSLEKE
FT                   LGFALFERHKGRLIPNPEAYFLLEETDAILERLSRSTQLMAEVKNLTRGKLRIACMPAA
FT                   ALFFMPHVIAEFVKDRPEVEVSMMMRSSTMVQDWVASQQYDIGYSELPKDRDSFHVEPI
FT                   NLEGVCALHKDHPLALKEVITPKDLDNEPLAALYTRHSASEHVRMLFEEYGATYRPRFE
FT                   LQNYISGFEFVEQKLCACICDPISAASYKLYKSGQGNVVFRPFTPAVMFDHAILTPAHK
FT                   PMSQLAKVFAESIRGGVKQFVSM"
FT   gene            39203..39685
FT                   /locus_tag="VEA_004530"
FT   CDS             39203..39685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_004530"
FT                   /product="TRAP-type C4-dicarboxylate transport system small
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_004530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52722"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK8"
FT                   /protein_id="ACY52722.1"
FT                   /translation="MEQKFRYLLTCLIASVALMQFIQVVTRYIFEVPIMGLEESMVIPT
FT                   VWLYMLGAVNASREDTQIRANVLEIFIKTERGHQILALVGEVISFVISAWLTYWAWDYA
FT                   KYAWRVWKESPTLYIPTFYHECSVFLGLLLITLFIAVHIVKLVRQLRSPSYSVSKV"
FT   gene            39689..40987
FT                   /locus_tag="VEA_000035"
FT   CDS             39689..40987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000035"
FT                   /product="TRAP-type C4-dicarboxylate transport system large
FT                   permease component"
FT                   /note="COG1593"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000035"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52723"
FT                   /db_xref="GOA:D0MCK9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCK9"
FT                   /protein_id="ACY52723.1"
FT                   /translation="MVEVALLAVAVLVILLTFGVPLPFCFGGALMVMSFVGDMSMKGNM
FT                   MWGAGQLMNPVLLAIPLFVLAGTIMSRSGIAASLLGFVNVFVGHIRGGLGIVASVSCAI
FT                   IGAISGSGLTGVAAIGPLLIPEMEKRGYPRAYATALIANSSILGLLIPPSVTMIVYGWV
FT                   TDTSILACFLATLGPGLLVTFNFAGINMFMARKFPLVLDDKPTMSELIKQTSSKTFNAI
FT                   PALLMPVIILGGIYGGIMTPTEAAAVAVIYAVPVGFMIYKGLSWKTLLESGKESATAVG
FT                   SIMFMILFSLILSQMFVVEDIPQQLVEAIFGITDNKALLLIFINVLLFLVGMVVNDLTA
FT                   IILIAPLLLPLMTAIGISPIQFAAIMGVNTAMGGVTPPYASILYLGARIGNVKFSEVVG
FT                   PAMLLIVFGYLPVVILTSFWADLSLFLPTVFGY"
FT   gene            41000..42025
FT                   /locus_tag="VEA_000036"
FT   CDS             41000..42025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000036"
FT                   /product="TRAP-type C4-dicarboxylate transport system
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52724"
FT                   /db_xref="GOA:D0MCL0"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL0"
FT                   /protein_id="ACY52724.1"
FT                   /translation="MFKTSKFAPSKTLKKYSVLASLIAAAVTAIPAQATTLKISHVRPQ
FT                   GTVVDNDIKQLSEALKTSTDGDLKLRVYAANALGDYTLVQERISVGAIDMALQPASTST
FT                   DRRMQIGLLPFLANDWEEAQNVYGIGAPVREAMEELFEKQDITLLAAYPVYFGGISLNR
FT                   EAVDAGNPDSAKGIKLRVPPIKSFQLLADNVGYIGSPLPFSEAFTAVQTGVVDGVIGSG
FT                   AEGYYASFRDVTKTYIPLNTHFEIWYLMINSERLDDLDENEQQALKAAAQQFESRRWQA
FT                   AQVDQKENEQRLVEAGATIVEMTPAQLRKTADKVRATVWPQIIEDIGSDWSQPIIDKAL
FT                   N"
FT   gene            42084..43181
FT                   /locus_tag="VEA_000037"
FT   CDS             42084..43181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000037"
FT                   /product="nopaline dehydrogenase putative"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52725"
FT                   /db_xref="GOA:D0MCL1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL1"
FT                   /protein_id="ACY52725.1"
FT                   /translation="MKPEYIVVGGGVVGCALAYGLLKAGHQVTVLDGGDSAHRASRGNF
FT                   GLVWLSSKGLDAPHYAAWTRRSVNLWQGLAHELESATGEKLNLVQQGGYDFHFCEKELM
FT                   AKAQQYEHLREALGTDHPYEVWDRARLLKEEPDIGPDVVGAIYGPEDGHVNPLQLLKAY
FT                   TKAIRNLGANLITGVHVSDIEKDDTGRFQVTLEDGTQYQSDKVILSAGLGAAKLGPKLG
FT                   FVAPISPQKGQVLITEKLPKIIKRPSGIIRQVDEGGIQIGDSKENAGFDDSDTLEMTAA
FT                   IAERAIAVYPFLAQTRLVRSWGAIRIVSPDGLPIYQQSTTHSGAYLISCHSGITLAAAH
FT                   SYLLPHWLEDSADAPNLEVFSEERF"
FT   gene            43165..43464
FT                   /locus_tag="VEA_000038"
FT   CDS             43165..43464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000038"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52726"
FT                   /db_xref="GOA:D0MCL2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL2"
FT                   /protein_id="ACY52726.1"
FT                   /translation="MKNDSKFQRLEQAGSQPKSVQFYWEGKPYTACKGDTIAVALFSAQ
FT                   VNHTRETPQSGSPRAPFCMMGSCFECRVEVNGEQNVQACMNLIEDGMQIRRQTT"
FT   gene            43476..44939
FT                   /locus_tag="VEA_000039"
FT   CDS             43476..44939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000039"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52727"
FT                   /db_xref="GOA:D0MCL3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL3"
FT                   /protein_id="ACY52727.1"
FT                   /translation="MQDEVTNVVDVCVIGAGPAGMKAAVRCSAAGASVTVIDEQARPGG
FT                   QIYRAVQENGHPNGHIFGPDYLRGAELVKAFNQAEVNHVSQATLWRIDEDNTVYWSQQG
FT                   KAHKTIAKNIIIATGATERPFPFVGWTLPGVMTAGACQIMMKTSGLVPKQAVMVGTGPL
FT                   LYLLAAQMIDAGSPPKAIVDTQQSDGYLKSLRFASNAWTGRKYLVKGLGLLAKLRKAGI
FT                   KRYTRATNIEAEGTDSVQELVFKCGGNKVSLGTETVLAHIGVIPNVQLTRAMGLEHQWD
FT                   ALQVCWKPTLDENNMSSRQGVFIAGDSGGIGGALVAELQGELVACHVLQSLQNELSRDL
FT                   INESLALKESIEHELAVRPFLETLYAPPKQALCPSDKTIVCRCEEVTAGQIRQHAANGA
FT                   NGINQIKTYTRCGMGPCQGRYCGSTVAHIISDKIGLSMEQVGYYRLRNPIKPLKLGELA
FT                   SLTPVNKSFMEKYKSEGASHEQRAKTVQQ"
FT   gene            44908..45261
FT                   /locus_tag="VEA_000040"
FT   CDS             44908..45261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000040"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52728"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL4"
FT                   /protein_id="ACY52728.1"
FT                   /translation="MNNVQKQYSNKRMSKVVIHNDTVYLCGQVGVKGTSVAEQTEEALK
FT                   RVEDLLIEAGSDRKHVLQTIVWLADMKDFDEMNGVWDTWFEEGYAPARACGEAKLASPE
FT                   LKVELIVTAALRK"
FT   gene            complement(45309..45689)
FT                   /locus_tag="VEA_000041"
FT   CDS             complement(45309..45689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000041"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex
FT                   dihydrolipoamide dehydrogenase component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000041"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52729"
FT                   /db_xref="GOA:D0MCL5"
FT                   /db_xref="InterPro:IPR000010"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL5"
FT                   /protein_id="ACY52729.1"
FT                   /translation="MKLKTVSVCALLVLLAGCQQENPSQATQLTTSADVCNTQGNMPGG
FT                   WNEFNATPDAQKAMAFVLKRMDTIASFKQILNVHAQIVSGVNYAIEFELDDGSIWNTVV
FT                   YRNLDGEYAITQSPKEGHFCEQ"
FT   gene            46004..46537
FT                   /locus_tag="VEA_000042"
FT   CDS             46004..46537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000042"
FT                   /product="lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52730"
FT                   /db_xref="GOA:D0MCL6"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL6"
FT                   /protein_id="ACY52730.1"
FT                   /translation="MKSLKTLLLLSLVTLFGCTSKPDGVQPVNNFDLESYLGKWYEIAR
FT                   LDHSFERGLSNVTAEYRLREDGGVKVTNRGYSEEDQQWSEAEGKAYFVEDETVGHLKVS
FT                   FFGPIYSSYIVFELVENYDYAFVSGYNHDYLWLLSRTPNVDEKILERFKQVAKEKGFAL
FT                   DELILVDQESGRQF"
FT   gene            complement(46737..47732)
FT                   /locus_tag="VEA_000043"
FT   CDS             complement(46737..47732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000043"
FT                   /product="succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000043"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52731"
FT                   /db_xref="GOA:D0MCL7"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL7"
FT                   /protein_id="ACY52731.1"
FT                   /translation="MATQLLDDMIQGHQVIQSLNVADLGPGEHKFWFRIATNALSQWQH
FT                   LPVLVFKGEKPGKKIMITAGVHGDEYNGVLAAQKTARELIGTEVAGTVTIVPTINMPGM
FT                   LNHSRDFYSADPDASPANLNRFFPGDQNGNEAQRYLYALWNDLLKPNADLAIDLHTQTS
FT                   GAAYPLYVFADFRIEQSLEMARLINPDAILNDPGDTGVLETVWNNHGVPSITVEVGMGR
FT                   YTEQKLISRTVSGILSVLKQHNVVEGEIEPITSCLEGNEIVSVKATHGGFVLPHVGLMD
FT                   FVEQGQLVAIQYDSFGTEVERYTAPTSGTVLSHNVESIRAPGSLIVRLIK"
FT   gene            complement(47841..49316)
FT                   /locus_tag="VEA_000044"
FT   CDS             complement(47841..49316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000044"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52732"
FT                   /db_xref="GOA:D0MCL8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL8"
FT                   /protein_id="ACY52732.1"
FT                   /translation="MPDTLILIFIVGILAAILTYLIPAGHFDSQQVTYMVDGAEKTRTV
FT                   IDPSSFSYATDENGELVYNKVGLFASGGGIGLMNFPFEGLVSGSKWGSAIGVIMFMLVI
FT                   GGAFGVVMRTGTIDNGILRLIDKTKGNEALFIPVLFLLFSLGGAVFGMGEEAVAFAIII
FT                   APLMVRLGYDGITTVMVTYVATQIGFATSWMNPFSVAIAQGIAGVPVLSGMTVRMGLWV
FT                   GFTLIGIAFTMLYAARVKSNPELSYSHRTDKYFRQQELGNQDSRWNIGDTLVILTVIAT
FT                   TVWVVWGVVANAWYIPEIASQFFTMGFVIAIIGTIFRLNGMTLNCAADAFKEGAAIMLA
FT                   PALLVGCAKGVLLILGGGTTDEASVLNSILNSAGGVISGLPDVAAAWLMYVFQSIFNFF
FT                   VTSGSGQAALTMPLLAPLADIAGVTRQVAVLSFQLGDGFTNVIVPTSASLMATLGVCRI
FT                   DWGDWAKFCWRFILLLFTLSSVVVIAAHIMGFA"
FT   gene            complement(49577..49897)
FT                   /locus_tag="VEA_000045"
FT   CDS             complement(49577..49897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000045"
FT                   /product="cytochrome c553"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000045"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52733"
FT                   /db_xref="GOA:D0MCL9"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCL9"
FT                   /protein_id="ACY52733.1"
FT                   /translation="MFRFVLLTSLIFSSASHAAPFGDADKGKIKSPSCVYCHGATGVAG
FT                   NDAYPNLAGQNAQYLYDAMKSYQAGERKGPLAEMMGAQLRMLNDEDLRDVAAFYAEQTQ
FT                   DK"
FT   gene            complement(49977..50981)
FT                   /locus_tag="VEA_000046"
FT   CDS             complement(49977..50981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000046"
FT                   /product="low-specificity L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000046"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52734"
FT                   /db_xref="GOA:D0MCM0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM0"
FT                   /protein_id="ACY52734.1"
FT                   /translation="MDFRSDTVTQPTQAMREAMFKAPVGDDVYGDDPTVNELEEFAAEL
FT                   AGFEAALFTTSGTQANLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPVEN
FT                   NPDGTLPFDKLAAAIKPDDCHFARTKLLSLENTINGKVLPLSYLAEARDFVNKHNLQMH
FT                   LDGARVFNAAAALDVPVKEIGQYFDSMTICLSKGLTAPVGSLLLGSKEYIAKARRLRKM
FT                   VGGGMRQAGILAAAGKLALTEQVEQLKQDHINAKTLAEGLAELPGFSVNPEFVQTNIVF
FT                   AKLDPQVDIVNIAAKLKEQNITITPGNPIRFVTHKDISAQDIDNFLSSIKSLL"
FT   gene            complement(51004..51648)
FT                   /locus_tag="VEA_000047"
FT   CDS             complement(51004..51648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000047"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000047"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52735"
FT                   /db_xref="GOA:D0MCM1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM1"
FT                   /protein_id="ACY52735.1"
FT                   /translation="MRYSSLKVQTLSLCCNIFCFCFPPFVVNVEKRQNAVTARVNNCMS
FT                   KIIHKWKQISLIEEEVMLPTGQAITHTTIHHPGAAVILPITTEGEIVLVHQFRPSLNKW
FT                   LLELPAGTREGNENPLCCAKRELEEETGYSAEKFTSLGQVTPLAGFCDEIQYLFVAEKL
FT                   SQTNRYECDEDEVIEVVTLSLQQLEDKIIDGTITDAKTIACLSKARLCGYI"
FT   gene            51788..53449
FT                   /locus_tag="VEA_000048"
FT   CDS             51788..53449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000048"
FT                   /product="putative regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000048"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52736"
FT                   /db_xref="GOA:D0MCM2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM2"
FT                   /protein_id="ACY52736.1"
FT                   /translation="MTQTLFASNAEKALLSERINKLAKALTDGVYEREHTIKLCLLAAL
FT                   AGESVFLLGPPGIAKSLIAKRLIQAFDNSSYFEYLMTRFSTPEEVFGPLSIQELKDNGR
FT                   YVRLTKGYLPTAQVVFLDEIWKAGPAILNTLLTVVNEKTFKNGSDIERVPMRLLVSASN
FT                   ELPDEDSGLDALYDRMLVRVFVNRIQNKQNFKSMLTVGTSQEAQVPEGLAITDEEYHQW
FT                   QQQLDKLTLTDNAFEKLFQLKTMLESKVEAQFGDVANTDMYVSDRRWKKAVKLLKASAF
FT                   FNGRDEINPLDLLLLQDCLWNSPESRDVVREVVQEFALKHAFDQQDAEQEIEYCRESLV
FT                   DVQHELEDAYRMTLTSEAATGILRKETMRFDTSKAKTYKVGAAVNLVKLVILQSNMSVS
FT                   ESEKGDSRWVYVPKDELDRVIKEGHGDVYGYVNQNTNMCRLRFDVDAANNLVIRDIANR
FT                   GILVSLVTQEGLDVELYQKWLTQSEKAVNQLSEAEHHMRKVKANFHDALPHSFVDPELP
FT                   RLMESSLQQVSQRLESIQAESEKVIQRFKNLHQFFS"
FT   gene            53459..54913
FT                   /locus_tag="VEA_000049"
FT   CDS             53459..54913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000049"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52737"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM3"
FT                   /protein_id="ACY52737.1"
FT                   /translation="MLGADGLNLALMVADSGIIDSAVNDLMARSQVMMMAENRGVKSSV
FT                   KGHLLKWRGSVKKRITKVCETERFQQELSLYQEVIHWDEEAFFENIEDVIKKLEWHSAF
FT                   YMQARRMMEKNKGMNNPMFPHYFCDQWYQSLADAIKQAQVSELEANKEKVLNDLYQRME
FT                   TMRNMDKVTESGDAESVGRLWDMASAKLSKTDLTVMKRHAEFLKKHQGLQEIAEQLGRM
FT                   AGQVNDPELNRAPTEELQMIEEKSDEATDDIVGIHESDDLNKLLPNETMFLAYPELEVV
FT                   FYKHLVDKRLMNYRTQGKSRTLRKVKAHRPDNKAVDIEKGPFIVCVDASGSMSGFPEQC
FT                   AKAMAYALMQIALAEQRDCYVIIFSTEHITYELTKQDGLREAADFLTYSFHGGTDLEPT
FT                   LIKSIDLMSGDKYKNADMVVISDFIAPKQQDELLAKVDALKAKKNRFHAISLSKYGNPA
FT                   LMSMFDHTWSYHPNVVGRLLKRVGNY"
FT   gene            55120..55193
FT                   /locus_tag="VEA_rna001"
FT   tRNA            55120..55193
FT                   /locus_tag="VEA_rna001"
FT                   /product="tRNA-Cys"
FT   gene            55230..55305
FT                   /locus_tag="VEA_rna002"
FT   tRNA            55230..55305
FT                   /locus_tag="VEA_rna002"
FT                   /product="tRNA-Gly"
FT   gene            55542..56444
FT                   /locus_tag="VEA_000050"
FT   CDS             55542..56444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000050"
FT                   /product="transcriptional regulator LysR family"
FT                   /note="predicted Lactate-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000050"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52738"
FT                   /db_xref="GOA:D0MCM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM4"
FT                   /protein_id="ACY52738.1"
FT                   /translation="MRNTDDYIIFYHLIEQGSFSAAARHMSLTKSVVSKRIAKLEQELG
FT                   VQLLYRTTRTLTLTEAGRAFFTHAKAVYQAVATAEESIVGLGKNLSGNIKVSVPTISGE
FT                   LILPQVINEFNQKYPDINIDMDLDNRFVDIVNERFDLAIRTGVLPDSSLIARKLVDANW
FT                   IVCASPQYLAKHGIPKQPQALDKHNCLVYSYQETGAHEWAFKDGDEVYQITVDGNLCTN
FT                   NSSVLRNVALLGQGIIYVPRVLVYEDLKQGRLIQLFKDETAKCLGIYAVYPYTRQQPEK
FT                   IKIFIDHLYTSFQSQNHRF"
FT   gene            56829..58535
FT                   /locus_tag="VEA_000051"
FT   CDS             56829..58535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000051"
FT                   /product="D-Lactate dehydrogenase"
FT                   /EC_number="1.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000051"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52739"
FT                   /db_xref="GOA:D0MCM5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM5"
FT                   /protein_id="ACY52739.1"
FT                   /translation="MKQKQLIDEFKTIVGEENVLTDEVKTKYYRSGFRSGSGTALAIVF
FT                   PNTLVEQWKIIKQCVEANCIIIMQAAKTGLTEGSAPSGNDYDRDVVVINITKIKKIHLL
FT                   DGGKQAVCLPGASLHSLEKELKAVNRAPHSIIGSSSLGATVVGGIANNSGGALVKRGPA
FT                   YTELAIYAQVDKQGQLHLVNHLGIEGLGETPEEILTNLQEGNFDPAKIIHDERMASDKE
FT                   YDERVRDVTSDIPSRFNADERRLFEASGCAGKLGVFAVRVDSYPVPEKEQVFYLGTNDP
FT                   AKLTKLRKDFLSTFENLPEMGEYLHRDIFNMAEKYGKDVFLSIDLLGTDKLPKMFALKA
FT                   KVENFLERVPFVSKYLPDTILYYASKLFPQHLPERMLDFRDKYEHHLILKMSDGGIAEA
FT                   QKYLKEVWAVEDDCDFFECTPEEGKKAYLHRFAAAGAAIRYETIHRKDVEDIVALDIAL
FT                   RRNDEEWLETLPEEVSKNLVQALYYGHFMCYVFHQDYIFKKGTDTKLMKKLMLEHLNSR
FT                   GAKYPAEHNVGHLYEAENSLQKFYHELDPTNTFNPGIGKMDKYKRNCNCCA"
FT   gene            complement(58676..58984)
FT                   /locus_tag="VEA_000052"
FT   CDS             complement(58676..58984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000052"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52740"
FT                   /db_xref="GOA:D0MCM6"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM6"
FT                   /protein_id="ACY52740.1"
FT                   /translation="MNIETSVGGTLLIIIAMALVTLITRWGGVYVMSFIPISERVQRFI
FT                   TAMSGSVLVALLAPLAVEGDNGARAALFSTAVVMFIVKKPLPAIAAGIIAAAAVRAL"
FT   gene            complement(58981..59712)
FT                   /locus_tag="VEA_000053"
FT   CDS             complement(58981..59712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000053"
FT                   /product="AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52741"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM7"
FT                   /protein_id="ACY52741.1"
FT                   /translation="MTENTQHLQRSSSELHEFTRVDVWNGFTQLLPLSMFVVIFGLAFG
FT                   VAAVQTGLDVFPTMLMSTLVFAGASQFATLEMWGAEVPLIPVLITVFAINARHLLMGAT
FT                   LYPWLRQLPPTKRYGVMLVASDANWAMALNAFGRKEPGFGLLVGGGLAMWSFWIVGTWI
FT                   GIYFGNAIKDPVGLGLDMVMGCFLLSMVVAGPKDLRIFAIWATAAASSMLAYWYLPENS
FT                   HVVVGAITGGVLGACWKEKKA"
FT   gene            complement(60029..61258)
FT                   /locus_tag="VEA_000054"
FT   CDS             complement(60029..61258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000054"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000054"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52742"
FT                   /db_xref="GOA:D0MCM8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM8"
FT                   /protein_id="ACY52742.1"
FT                   /translation="MRLNKTLLSLTIAAATVAPAMQATAAPLQISNTVVKAEQVQGANA
FT                   WLEINLGQFRDNIEQFKSHMDGKTKICAVMKADAYGNGIAGLMPTIIEQQIPCVAVASN
FT                   AEAQTVRDSGFKGQLMRVRSADIGEIEAAIDLNIEELIGTAEQAKALSKLAEKADKEIK
FT                   VHLALNDGGMGRNGVDMTTKAGKKEALEIAQQDGVNIVGIMTHFPNYNADEVRQKLSSF
FT                   KDSSAWLIKEAGLKREDILLHVANSYTALNVSEAQLDMVRPGGVLYGDLPTNPEYPSIV
FT                   SFKTRVASVHHLPKNSTVGYDSSYKTSKESLMANIPVGYSDGYPRKMGNTAEVLINGQR
FT                   AKVAGVASMNTTMVDITGIKDVEPGSEVVLFGSQQGKTISAAEMEKHAEVIFPELYTVW
FT                   GAANPRVYVK"
FT   gene            complement(61459..63090)
FT                   /locus_tag="VEA_000055"
FT   CDS             complement(61459..63090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000055"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000055"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52743"
FT                   /db_xref="GOA:D0MCM9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCM9"
FT                   /protein_id="ACY52743.1"
FT                   /translation="MSIKNLSIAKKISLSFLLIAIVNIAFGVFLSTELKSIKSELLNYT
FT                   DDTLPAMERVDSIRDHLSRWRRAQFATYTYEDADQIRNKIASNIREREKISKELDSYGE
FT                   TIWPGEEQQTYQRLMRQWKKYLVTMDQYNEAMLANDKSKAHPILANSLPAFEAVDSELG
FT                   ELIRLLKNAMDSNKTHILSSVNGLSNSSIASNVIILLIMVGMTYVLTRLICGPLKLVVE
FT                   QANAIATGDLSNDIDRKAIGNDELGELADATTKMQDDLRQVIDNVIAAVTQLSSAVEEM
FT                   NQISDISASGMKDQQLQITHIATAMTEMKAAVADVARNTEDSANQANEANRRTQHGVRE
FT                   TQGMVDAIHEVSNVIGAAGDTVAELEQQSNKINVIVDVIRDIADQTNLLALNAAIEAAR
FT                   AGESGRGFAVVADEVRTLAGRTQDSTSEITSIIEQLQSLAKDAKSATELSRTSISECAE
FT                   QGIQSKQLMSDIEHSISDISDMGTQIATACNQQDSVAEELNRSIENIHLASQEVSQGSE
FT                   QTAQACRELSQLSISLKDVMSRFKLS"
FT   gene            63634..63720
FT                   /locus_tag="VEA_rna003"
FT   tRNA            63634..63720
FT                   /locus_tag="VEA_rna003"
FT                   /product="tRNA-Leu"
FT   gene            63758..63831
FT                   /locus_tag="VEA_rna004"
FT   tRNA            63758..63831
FT                   /locus_tag="VEA_rna004"
FT                   /product="tRNA-Cys"
FT   gene            64140..65663
FT                   /locus_tag="VEA_000056"
FT   CDS             64140..65663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000056"
FT                   /product="cytoplasmic alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52744"
FT                   /db_xref="GOA:D0MCN0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN0"
FT                   /protein_id="ACY52744.1"
FT                   /translation="MKTFKLKRTILPLTLLLSSSALAAGNGTMMQYFHWYVPNDGTLWT
FT                   QVENNAPTLAENGFTALWLPPAYKGAGGSNDVGYGVYDMYDLGEFDQKGSVRTKYGTKD
FT                   QYLSAINAAHNNNIQVYGDVVFNHRGGADGKSWVDTKRVDWNNRNIELGDKWIEAWVEF
FT                   DFPGRNDKYSNFHWTWYHFDGVDWDDAGKEKAIFKFKGEGKAWDWEVSSEKGNYDYLMY
FT                   ADLDMDHPEVKQELKDWGEWYINMTGVDGFRMDAVKHIKYQYLQEWIDHLRWKTGKELF
FT                   TVGEYWNYDVNQLHNFITKTSGSMSLFDAPLHMNFYNASKSGGSYDMRQIMDGTLMKDN
FT                   PVKAVTLVENHDTQPLQALESTVDWWFKPLAYAFILLREEGYPSVFYADYYGAQYSDKG
FT                   HDINMVKVPYIEELVTLRKDYAYGKQHSYLDHWDVIGWTREGDAEHPHSMAVIMSDGPG
FT                   GSKWMFTGKPSTRYVDKLGIRTEDVWTDANGWAEFPVNGGSVSVWVSVE"
FT   gene            65794..66048
FT                   /locus_tag="VEA_000057"
FT   CDS             65794..66048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000057"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52745"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN1"
FT                   /protein_id="ACY52745.1"
FT                   /translation="MESIADVLVVAIVFGAIFGGGIIKLILNHRKEVRALEISERNTMS
FT                   QEEQDNLNKQIGDLKRRVEVLERIVTDSKYQLEKEIASL"
FT   gene            complement(66123..66773)
FT                   /locus_tag="VEA_000058"
FT   CDS             complement(66123..66773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000058"
FT                   /product="lipase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52746"
FT                   /db_xref="GOA:D0MCN2"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN2"
FT                   /protein_id="ACY52746.1"
FT                   /translation="MIRVLWSKKQNEVVVVIKGSHSISDWLLNFAMWTRSCRRLGLNYR
FT                   IHAGFYHLLFQESLPSRNEDRLGLTVIERLEGIVVPLILKGKRITITGHSSGGAIGSVF
FT                   ADYIEKKYPKSIKRVVTFGQPAVGDWTFKKRYRLGHKTYRICCDIDIVTFMPPVPFLYW
FT                   HVGKMLWLYNGKIYENTPTFIRLGRSLFSWLMRPFSYHFMSKYIRDKDFFDER"
FT   gene            complement(66980..67909)
FT                   /locus_tag="VEA_000059"
FT   CDS             complement(66980..67909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52747"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN3"
FT                   /protein_id="ACY52747.1"
FT                   /translation="MFRKSSFQLPLHTDSELDFVVPYFLLTEFDYARSLEQGIVHDLDP
FT                   EYTHQYRVTLRRIRSLCLLLHELIPPFEQRILKPHLKIMMKKTNKLRDLDVFILDKSQY
FT                   IEMLPNHKPSLEPLFGFIESERAYEQAKVARWLATKEYTMHCTLVRNSLLRSTQHERVD
FT                   NNVPALLFASQKVSEQFKKVDKARRKISDKSRDSVIHSMRIKCKALRYLLEGFSALYPS
FT                   PQHKNNVKQLKLLQDKLGDFNDTSSQIEFFTQLKEAVNLNKQDRKALKKLINVLSEHHD
FT                   TSRQTILTQLDQFEAFIHDTNTQSLYQH"
FT   gene            complement(67919..68092)
FT                   /locus_tag="VEA_000060"
FT   CDS             complement(67919..68092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52748"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN4"
FT                   /protein_id="ACY52748.1"
FT                   /translation="MVKKPTQTNKGRSFCSQEHQRVLLSFTLLHHLMSTRNRQVAQIDS
FT                   MGINLIRTAGDK"
FT   gene            68212..68298
FT                   /locus_tag="VEA_rna005"
FT   tRNA            68212..68298
FT                   /locus_tag="VEA_rna005"
FT                   /product="tRNA-Leu"
FT   gene            68335..68408
FT                   /locus_tag="VEA_rna006"
FT   tRNA            68335..68408
FT                   /locus_tag="VEA_rna006"
FT                   /product="tRNA-Cys"
FT   gene            69390..71072
FT                   /locus_tag="VEA_000061"
FT   CDS             69390..71072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000061"
FT                   /product="peptidase M11 gametolysin"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000061"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52749"
FT                   /db_xref="GOA:D0MCN5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN5"
FT                   /protein_id="ACY52749.1"
FT                   /translation="MVILLNFKENPNEQPLTLSEANNLIFGTVNDFYRESSFDQMWLSG
FT                   KVVGWFNLPLSNQVCDFTAVQDAADQEAIAAGVKLEEYDRIVYLMTKTACGVAGSATID
FT                   GMPSRAHINGDFSPMNIAHELGHNFGLHHSRALDCGEHTLSDNCTLREYGDTYDVMGGP
FT                   DIGYLNTFQRERLGWLEGEHASKTLEVTQNGTYSIANYETTSDQPVTIKVPRGTDPSTG
FT                   AKKWFYIEYRQSIGFDDFLDARSYSFYRGDVTDGIIIRSAVEGDGRSSNLLHFKTDSEY
FT                   RAVFGRNDWFDPSMPVGGSYTDPDSGVTLSLVSAANGIAEVSVVFDGSDNGNIGTCTVN
FT                   APSVTAKAATNNSVAAGDEVQYQVTITNKDSADCSASSFSVNASVPTGWKASSNAITLA
FT                   AGETGQVMISVVSSVDASDKDYALNMIVTHGEDSSLQTAASVNYSVTTEISPSPELVAV
FT                   DDQVTMSSKQSVIIDVMANDVVGEQNSASVVSFTRPSKGRLELLSDGTLRYTPEKKFKN
FT                   NDSFTYTIGDGQSSSTAQVSVKLESSSGGDSGNSGNNGKGKNK"
FT   gene            complement(71145..72335)
FT                   /locus_tag="VEA_000062"
FT   CDS             complement(71145..72335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52750"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN6"
FT                   /protein_id="ACY52750.1"
FT                   /translation="MFKLFTWVIAVSLVLSSQIVYASAGDPSSRGVQPIFVEGNNTCQQ
FT                   LLPGIDGLIEYKLEPVTDGTFGDGMLEVVIDQQPGAKTFSWDQGDSPVIMQAIFVKGGP
FT                   DGNLYNYFTDGLLYQDDALLHAPVGNNGRYYGLSHISFCYTPGVPDIKITKTCTFGDVV
FT                   NGNTLKYNYKLTVENTGDFALYDVVATDTTAVDNDMAAGDHVFNLAMLAVGQTQEFNGS
FT                   FIIDQNGITNYAEVSAALETGGGVAVSDNADWECPSQNIPGSLSLEKDCSVVVVNRFED
FT                   TGINEYGLQVNYSGSVCNTSNVTIDGIVVIDNKDSNPIQVGMLAPAECYDFTGNYEPIP
FT                   GDGEGLPLPGEEVRAFTDTVDASGETIFGNVVVEAITASAECTLCPTCPEPVSCPE"
FT   gene            73112..74707
FT                   /locus_tag="VEA_000063"
FT   CDS             73112..74707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000063"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52751"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN7"
FT                   /protein_id="ACY52751.1"
FT                   /translation="MNSCKSGIWHTMKSFLYAIFTSLLIGSSAFATPTDGVFELEANAN
FT                   AIDDSGVGAPDDWSTPPNSGGALVFSFENDTATPDTIFTGGNKDIKDIPELGWKTGTVL
FT                   DKGDILHAYAAAYNINNDLVLTFGADRFGNSGDAFLGFWFYQDSVSTNPDGTFTGQHIA
FT                   GDLLIQVNYLQGANEGPEILVLEWDTTCAKADNNNPQDGQCAATNLRLKVKTNALCSPG
FT                   AQDVCASTNTTDSPAPWAYTPKSGVENVFPPETFFEGGVNLTELLQTDTCFSSFAAETR
FT                   ASSSITAQLKDFVVGDFELCSVDITKTCNQAVVNETEDGYVYSYSGDVINDGVGTLYDV
FT                   VVEDLEAGTTHSLGAIASGDSASYSGSFESTSNGLTNTVKVTAAATPGGQATITDTASD
FT                   PCESLSLSPMISVTKSCESGFKLTENGIIAEVSFSGMVCNTTPGLTLVNVSVVDDSGTP
FT                   EDASDDVTVVNNIELASDQCQSYTGSYIPTAFSNAETQSFRDTVTAVGFLKIDNTQATN
FT                   TASADCDICPAPSN"
FT   gene            complement(74771..76555)
FT                   /locus_tag="VEA_000064"
FT   CDS             complement(74771..76555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000064"
FT                   /product="Ca2+-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52752"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018905"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN8"
FT                   /protein_id="ACY52752.1"
FT                   /translation="MKKVILPQLGFVASNLRLLALGFVTLVSAYSFSSEAYAEQVASGE
FT                   QKTLVVLVNFQENPQEIPISKEDAHHVVFNTVSDFYSQMSQGQLWLSGDVAGTFTLPIS
FT                   NQICDDDAVAAEANKMAETAGYQLSNYDRFIYLTTKTGCASEGSGSQGVTPSRASINAV
FT                   FEPRVIAHELGHNFGLHHASALDCKDGTLAGDCRVIEYGDSYDTMGNYDMGYFSAFQLE
FT                   NLGWQTSPAQIISSDGVYSIDAYEDFESTSSKVLKIPRGTDPITGQRQWFYVEYRQALG
FT                   YDSFLRDRSYIVYRQDVTEGVVVRLATDGDLKSSRLLHMKPDSTFKQLFGSNDWEDPAL
FT                   PIGGTFTDPKTGVSITLESANGQNAQVSVIFGGESGQCVATSPLLSLTPLSGSDANAGE
FT                   TLAYNLKVTNQNNTECADATYTTALSVPDGWNYDASALTVPSGMSAETTVMVTSNNDAQ
FT                   PNSYSITVDVIDAENEQSAETELSYTVLSESTSPLEAVNDSVTISDKSVVRIEQLNNDS
FT                   FEQSTSLAITVAKPNKGSARVLSDGSIEYTPSKKFKNNDSFTYTISDGQSSSTATISIT
FT                   LQSTSGGNGGGNGKGKPN"
FT   gene            complement(77035..77997)
FT                   /locus_tag="VEA_000065"
FT   CDS             complement(77035..77997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000065"
FT                   /product="diguanylate cyclase/phosphodiesterase domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000065"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52753"
FT                   /db_xref="GOA:D0MCN9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCN9"
FT                   /protein_id="ACY52753.1"
FT                   /translation="MRKMEEYLTRIACLEKENEELKRKNARLQEKLNAALDSNGLCLWE
FT                   QHIPSGTLTIFNMQWGKMLGYQPHELTATVETWKNNLHPEDYDLAVGAFEDHLAGKTDL
FT                   YEVVHRMIHKDGSDSWVYDRGRVVEYGSDGEPLRMMGTHIDITKEKRYEQQLAKLASSD
FT                   PLTGLLNRKAIEENFNHQPQTKPSQQSALVFVDIDNFKAVNDQLGHHTGDTLLINIANS
FT                   LTELAPSKSQVGRIGGDEFVVLSSYSNQEEISQLCDRLLSSIIPAINQDLNKVTIGMSI
FT                   GVCLFDKGKQQFNEVYQKADHAMYEIKKNGKNGVAYIQI"
FT   gene            78050..78166
FT                   /locus_tag="VEA_000066"
FT   CDS             78050..78166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52754"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP0"
FT                   /protein_id="ACY52754.1"
FT                   /translation="MIELGDIGIEYAVNNKESVMLLKSSKVNAWKNKEGNRG"
FT   gene            complement(78227..78634)
FT                   /locus_tag="VEA_000067"
FT   CDS             complement(78227..78634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000067"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000067"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52755"
FT                   /db_xref="GOA:D0MCP1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP1"
FT                   /protein_id="ACY52755.1"
FT                   /translation="MSENNSIYISSLDMNRITALLDKMPNIAAELVELEAELDRATVLE
FT                   PEQMPDNVVTMNSTVEFKFAGEDRTMTKTLVYPSELKSSDDISIFAPVGSALIGLSVGQ
FT                   KLEWPMPNNQVKTIEIVDITYQPERCGALNR"
FT   gene            79164..81728
FT                   /locus_tag="VEA_000068"
FT   CDS             79164..81728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000068"
FT                   /product="nitrite reductase [NAD(P)H] large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000068"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52756"
FT                   /db_xref="GOA:D0MCP2"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP2"
FT                   /protein_id="ACY52756.1"
FT                   /translation="MSKLKLVVIGNGMVGHRYIEDLVEKADISNMEITVFCEEPRVAYD
FT                   RVHLSSYFSHHTADELSLVKEGFYEKHGINMLIGERAININRENRIVYSSTGREVQYDK
FT                   LILATGSFPFVPPIKGHESKDCFVYRTIEDLKAIEACAKNSKSGVVIGGGLLGLEAAGA
FT                   LKALGVETHVVEFAPKLMAEQLDLAGGNQLRQKIERMGVNVHTSKNTLEIAAEGKNARN
FT                   VMRFADGTELETDFIVFSAGIRPQDKLARQMELELGPRGGVAINDHCQTSDENIYAIGE
FT                   CASWNEMFYGLVAPGYKMATVAVDHLLGNTESKFEGADMSAKLKLLGVKVGSIGDANGR
FT                   TEGCKSYVYQNEEQEVYKRLIVSEDNKKLLGAVLVGDTSDYGDLLQLMLNEIDLPEHPD
FT                   ALILPAHAGAEKPALGADALPESAVICSCFDVTKGKIAQAVADGHHTLGDIKAVTGAGT
FT                   GCGGCIPLVTSVLNAELAKSGIEVKNDVCEHFAYSRQELFHLIRIEEIKTFDELLEKYG
FT                   KGYGCEVCKPLVGSILASCWGEHILKPQLVKLHDTNDNFLGNIQKDGTYSVIPRMAGGE
FT                   VTPQALGALANVAAEYNLYTKVTGAQRIGLFGAQKDDLPEIWRKLIDAGFETGQAYAKA
FT                   LRMAKTCVGSTWCRYGVQDSVGLGSYIENRYKGIRTPHKMKFGVSGCTRECAEAQGKDL
FT                   GIIATDAGWNMYVCGNGGMKPRHADLLASDLDKETLIKYIDRFMMFYIRTAAPLQRTSV
FT                   WMENMEGGVDYLREVIVEDKLGINAQLEADVAKLVDEYECEWTATINDESQLTRFTHFI
FT                   NSDKRDDNVVFVQEREQHRPATFTEKHPEAKGDILHVAITEA"
FT   gene            81742..82065
FT                   /locus_tag="VEA_000069"
FT   CDS             81742..82065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000069"
FT                   /product="nitrite reductase [NAD(P)H] small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000069"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52757"
FT                   /db_xref="GOA:D0MCP3"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP3"
FT                   /protein_id="ACY52757.1"
FT                   /translation="MSFEKICQISDIVPGTGVCALVNGQQVAVFRPTEAEEVFAISNKD
FT                   PFFQSNVLSRGLICEHQGELWVASPLKKQRFNLTTGACMEDERFNVKAYKTRVTNGEVE
FT                   ISA"
FT   gene            82109..82234
FT                   /locus_tag="VEA_000070"
FT   CDS             82109..82234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000070"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52758"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP4"
FT                   /protein_id="ACY52758.1"
FT                   /translation="MYLDSIDKGFPSVILGEQGSEMMSTAVGVNGKPFSIQSLTF"
FT   gene            82262..83113
FT                   /locus_tag="VEA_000071"
FT   CDS             82262..83113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000071"
FT                   /product="nitrite transporter from formate/nitrite family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000071"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52759"
FT                   /db_xref="GOA:D0MCP5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D0MCP5"
FT                   /protein_id="ACY52759.1"
FT                   /translation="MSTDFKPAEFVQTMINVGEAKINTSTRDLLLRGTMAGVILSLAVV
FT                   VAITAIVQTGIGLVGALVFPVGFVILSVMGYDLVTGVFGLAPLAKFANRPGITWGRIFR
FT                   CWGLVGLGNLIGSLIVAYLVAISLTGNFSLELNAVAKKFVAVSTARSLGFENMGMDGWI
FT                   TCFVRAIFCNLMVCLGVIGNMTARSVSGRVAMMWFPIFIFFALVFEHTVVNMFLFPLGM
FT                   ILGADFGIATWLNFNLIPTILGNIVGGLVMTCLPLYLTHAKTAPSINVVEEEVKAEPAI
FT                   AK"
FT   gene            83287..84045
FT                   /locus_tag="VEA_000072"
FT   CDS             83287..84045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000072"
FT                   /product="uroporphyrinogen-III methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000072"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52760"
FT                   /db_xref="GOA:D0M843"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D0M843"
FT                   /protein_id="ACY52760.1"
FT                   /translation="MTTANSSLNSGFVSLVGAGPGDPDLLTVKGLKAIQAAEVVVYDRL
FT                   VSKDILELAHASAEMIYVGKKLDFHCVPQDQINQILVQKAQEGKRVVRLKGGDSFIFGR
FT                   GGEELEELAEYGIKYEVVPGITAAAGATAYAGIPLTHRDHAQSVQFITGHVQKDGREIE
FT                   WHSLAQSNNTLVFYMGLKQSGHIMDNLITHGLDPEMSCAIIENGTRPEQRVFQGKLNEL
FT                   SEMAEKAISPALIVVGCVTQLHNKLDWFRK"
FT   gene            complement(84059..84499)
FT                   /locus_tag="VEA_000073"
FT   CDS             complement(84059..84499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000073"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52761"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:D0M844"
FT                   /protein_id="ACY52761.1"
FT                   /translation="MGGKLLVILLSCILSSTAFGYPAHSKYWPHRSVLYFAPENDEYVK
FT                   QFLLETLMNECELEDRDVVTLVITEQGYTSPAWLKEEFDLKMLAKLYEIEKGSHTAILL
FT                   GKDGQEKYRWGAETDWPFINNLIDQMPMRKQEMQRRHSPCKI"
FT   gene            84617..85105
FT                   /locus_tag="VEA_000074"
FT   CDS             84617..85105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000074"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52762"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D0M845"
FT                   /protein_id="ACY52762.1"
FT                   /translation="MNSERKQKIAILVDVQNVYYTCREAYRSNFDYNQFWYVATQGKEV
FT                   VSARAYAIASNDPKQRQFHHILRGVGFEVMLKPYIQRRDGSSKGDWDVGITLDAIEIAP
FT                   EVEEVILVSGDGDFSLLVERIQQRFNKTVTVYGVPKLTSQTLIDCADNFVAIDDDFLL"
FT   gene            complement(85194..86525)
FT                   /locus_tag="VEA_000075"
FT   CDS             complement(85194..86525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000075"
FT                   /product="C4-dicarboxylate like transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000075"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52763"
FT                   /db_xref="GOA:D0M846"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D0M846"
FT                   /protein_id="ACY52763.1"
FT                   /translation="MLYLEFLFLLVMLYIGSRYGGIGLGVVSGIGLVIEVFIFKMPPTS
FT                   PPVTVMLIILAVVTCASILEAAGGLKYMLQVAERVLRKNPKRVTLIAPFVTYFMTFLLG
FT                   TGHAVYSIMPIIGDVALKNGIRPERPMAAASVASQIAITASPISAAVVYYLAQLSDIQH
FT                   EITLLSILLVTVPATLFGTLLMSLYSLKRGKELEDDEEYQERLKDPVWREKILNTTATS
FT                   LDEVLPTSARNSVLLFIASILVIVVIAMWPDIRTIVDGAKPISMAVVIQMMMLCFGGII
FT                   LLATKTDPRDVPNGVVFKSGMVAAIAIFGIAWMSDTYFQYAMPQFKSGIVEMVTNYPWT
FT                   FALALFIVSVVVNSQAATARMMLPVGLGLGLDPALLIGLMPAVYGYFFIPNYPSDIATV
FT                   NFDTSGTTKIGKWYFNHSFMSVGLIGVIGACCLGYLLGQMIIPS"
FT   gene            86713..86844
FT                   /locus_tag="VEA_000076"
FT   CDS             86713..86844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000076"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52764"
FT                   /db_xref="UniProtKB/TrEMBL:D0M847"
FT                   /protein_id="ACY52764.1"
FT                   /translation="MLCIFAIMSALNAKRFKSLLLFIAYVTRPYGRKELENRGRDHR"
FT   gene            86947..87684
FT                   /locus_tag="VEA_000077"
FT   CDS             86947..87684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000077"
FT                   /product="hypothetical protein in aerobactin uptake
FT                   cluster"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000077"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52765"
FT                   /db_xref="GOA:D0M848"
FT                   /db_xref="InterPro:IPR023998"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:D0M848"
FT                   /protein_id="ACY52765.1"
FT                   /translation="MSEQFFPQLFQTSSEITPYLHGDIGEIGQEVIHIENDINPIIQGL
FT                   YQQLSEAHPEAGKAYWLTRTWDLLCWQPVYVAFISIYGFHTLPNIREMAQHLKPCFVSG
FT                   YRFADETHIHGKPEELIKEAGRQIRELFDFYQQEMSQWTRIRPGFTHQLMSDGIMACLI
FT                   RLQQRFPQMTNTTLREHAILWLQALGLDANNSHSLYETSLDQPLKLVRKSCCLVYKCEG
FT                   RKLCEDCPRLEKNRQLMSKYNPN"
FT   gene            87774..89945
FT                   /locus_tag="VEA_000078"
FT   CDS             87774..89945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000078"
FT                   /product="aerobactin siderophore receptor iutA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000078"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52766"
FT                   /db_xref="GOA:D0M849"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D0M849"
FT                   /protein_id="ACY52766.1"
FT                   /translation="MIKRTFSLNLIVLAMSSGYAVSSIAAEELQQTSTPSDEQMVVVGS
FT                   VMPKSISDIPGTVWFVGQEEIAQQYRAGKTLGDILSATIPSLDVGTGGRTNYGQNLRGR
FT                   AMLVMIDGVSLQSSRPISRQLDAIDPFNIERIEVLSGATSIYGAGATGGVINIITKKAY
FT                   SDALSFESYVSGTTGFNSSDDFDYKLAQSISGGNDRVAARGSVVYTETQGAFDANGDIV
FT                   TPDISQGSLQYNSTLDVMGSTEIQISDASKLNLVAQYYDSQQDSPYGLYIVNNKFVDVR
FT                   EGFDSDREHGTERVLLSANYAHDSVFDHQLIGELSYRSEDQTFTPYYQGASQQKTEVFA
FT                   GRLALAKNWESFNLVYGVDAYLDRFESNQALFDPSIANNSGNLINKTYAEVGRYPGVDV
FT                   TSYAMFVQGDYQINQDWSVQAGYRYQYMDNKIDDFVAYSVQKKIASGKGVSADAVPGGS
FT                   TDYSVSLFNLGTIYQLNDESQLWANFSQGFELADPAKYYGQGSYDAVDANGHYALNNSI
FT                   NVSNSKMSGIKTDSYEIGYRLDTNSLALQAAGYYSLSDNSIKYDRKTLLITNVDDEQRV
FT                   YGAEANINYWVTRDILLGASGHYVVSELKTDGKWEDLSAGKASTSKANAWAAYYQDSYS
FT                   IRLQSQTMFDYEDDANNKLEGYTTFDLLGNVTLPVGQLGFGIQNLFDEDYTTAWGQRAQ
FT                   ILYAAHYDAAAYDYKGRGRTFTLNYSVEY"
FT   gene            complement(89999..90190)
FT                   /locus_tag="VEA_000079"
FT   CDS             complement(89999..90190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000079"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52767"
FT                   /db_xref="InterPro:IPR021677"
FT                   /db_xref="UniProtKB/TrEMBL:D0M850"
FT                   /protein_id="ACY52767.1"
FT                   /translation="MNRKKKINQILKAKQKKHNAKLHKSNKPRYISKAERAKMEAEEQN
FT                   QASESTENVVDTVPTDQA"
FT   gene            90327..90836
FT                   /locus_tag="VEA_000080"
FT   CDS             90327..90836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000080"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52768"
FT                   /db_xref="GOA:D0M851"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0M851"
FT                   /protein_id="ACY52768.1"
FT                   /translation="MKTLITERLILRLVSIDDAPFILELYNHPDFYRFVGDKQIRTEYE
FT                   AARYIKENMLRMQKVKGVSLLVVEKKDDGQPIGICGLVKRDTLQHYDLGYGFLPSAYGC
FT                   GYGVESATAVLEYARGEMKLDKLAAITNNDNIRSISLLKKLGFEFERVEQQYDNGRTLE
FT                   LYTMTL"
FT   gene            90850..91239
FT                   /locus_tag="VEA_000081"
FT   CDS             90850..91239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000081"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52769"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:D0M852"
FT                   /protein_id="ACY52769.1"
FT                   /translation="MSDILLGKLATEFKTVKAMVEVYCHDHHGKKSDLCSECRELLEYA
FT                   EVRLDRCPYGENKPTCNKCPIHCYKPDPKEQMRLVMRYSGPRMLLKHPILAVRHLLHEK
FT                   RTVPEKPAANASNRHKRLSKQKREE"
FT   gene            complement(91288..92448)
FT                   /locus_tag="VEA_000082"
FT   CDS             complement(91288..92448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000082"
FT                   /product="permease"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000082"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52770"
FT                   /db_xref="GOA:D0M853"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D0M853"
FT                   /protein_id="ACY52770.1"
FT                   /translation="MENTVVPAASPRVTVPVVALSLYAVASGYLMSLIPLMLGEYNISA
FT                   DYASWLASVFYGGLLVGAMFIERVVRQVGHRKAFIGCLAAFSLTIVTLPVFANGLVWLA
FT                   ARFIAGIAVAGVFVIVESWLMSGDEASRAKRLSLYMLSLYGGSALGQFGIGVLGVSGGV
FT                   PFIAITTLILMAMLVLMFIECEQPNSHESTALSFKQIAKLNHAAIIGCVVSGLTLGAIY
FT                   GLMPVELTNRKINHQDIGTLMALVILGGMLVQPMVTTLNKYMSRTVLMAFFCILGIFSI
FT                   GLTFISSSAVVLAAALFFLGAATFALYPIAINLGCEGLDERFIVSATQVMLFSYSIGSV
FT                   AGPVVADKFMGQEHGLLGYLFAALVATGVYMLLAASKTKQRMAAGL"
FT   gene            complement(92625..93059)
FT                   /locus_tag="VEA_000083"
FT   CDS             complement(92625..93059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000083"
FT                   /product="thioredoxin 2"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000083"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52771"
FT                   /db_xref="GOA:D0M854"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:D0M854"
FT                   /protein_id="ACY52771.1"
FT                   /translation="MSSFKTRCPSCGGLNRVPNERVAESATCGKCKSALFDGAPIEGTQ
FT                   DNFSVLLQSDTPVVVDFWAPWCNPCVGFAPVFSDVAHEQAGTARFVKIDTEAQQALAAQ
FT                   FGIRSIPTIMVFKNGQRVDMINGALPKSQFDQWLNQALNK"
FT   gene            93222..94316
FT                   /locus_tag="VEA_000084"
FT   CDS             93222..94316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000084"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III
FT                   protein 2"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000084"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52772"
FT                   /db_xref="GOA:D0M855"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D0M855"
FT                   /protein_id="ACY52772.1"
FT                   /translation="MTNYYAEITGWGKCVPPAVLSNDDLSTFLDTSDEWIRTRTGIENR
FT                   RISHVNTSDMATVAAKHALARAGVDASDVDLIIVATCSPDSLIPNIASKIQQNLGIRSA
FT                   AAFDLNAACTGFVYGLETGTRLIQSGNYRNAIIIGAERLSFYIDWAMRDTAVLFGDGAG
FT                   AVVLSRTEKETGLLQSQIGCDAKGRDILSVPKFGTCMDRFAEDNGYWDFNFVGQEIFKR
FT                   AVKGMGLAAKTVLKASQLTTDQIDVVIPHQANIRIIQTLCDLSGIPHDKAFVNIQNYGN
FT                   TSAATVPIALCEAVEQGRVNPGDNMLLAAFGAGLTWGAAVLKWGDRVTPIGESDAALPE
FT                   CEQSALELLERAIKLCNERRRDEA"
FT   gene            complement(94403..95728)
FT                   /locus_tag="VEA_000085"
FT   CDS             complement(94403..95728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000085"
FT                   /product="DUF1501 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000085"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52773"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:D0M856"
FT                   /protein_id="ACY52773.1"
FT                   /translation="MDISRRHFIKSTASMGALASLGLPGYSLAAPSNDFRALICVYLAG
FT                   GNDAFNTVLPLSDAHYNQYAKVRGALSVTKDDILPINLRTTDSSDNLVELGLHPKLKAL
FT                   SSIFEQGDANIVLNSGILNHPVTKQAIELGEASLPEQLFSHNSQTDAWLLGGMQESSNL
FT                   GWAGRMLDVLTSESEITPLYSVHGNSLWLRAMEHRQTVLKKDRAVQLTAIDNPLYKGIY
FT                   DQLLSHQTENPFSGHFNLMVDESMMMSRVLSEQLNHIDDAPLFTSSTLGKQMQTVYKLI
FT                   ASQDVLKQQRQVFFVKHSGYDLHDSQLVRHPVLLEDLATNLLAMYRAIARLGLNKQVTS
FT                   FTMSDFGRRMTSNGNGTDHGWGGHQLLIGGAVNGQRPIGTWPELVLGGNDDYSQGRLIP
FT                   QIAADQVGSTLAQWMGVSDNAALEYVFPNIRNFANSNLGFMA"
FT   gene            complement(95738..97306)
FT                   /locus_tag="VEA_000086"
FT   CDS             complement(95738..97306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000086"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52774"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:D0M857"
FT                   /protein_id="ACY52774.1"
FT                   /translation="MRRQKQNEISCWVLGLIILLLSYVPSVPAEMELTPSDQTVARFLY
FT                   QSTFGPTPTLIDEVEEVGMESWISQQIYLPATYHQPLYRTPFSKGAQSNRENAWYQIVI
FT                   TADDQLRQRMAYALSQILVVSRYGGVLSSKPTGLVDYYDVLIANAFGNYRDLLYDVSIH
FT                   PVMGSYLSMLGSAKENNTTGALPDENFARELMQLFTLGLYELNIDGSKKLDRTTGKPIP
FT                   TYTQTDIQELARALTGWKNADLAFVEPMRVISHRHDDGEKRLLGNTIPAGLTAQEELSK
FT                   VIDILMSHPNMAPFVSKLLIQRFVTSNPSPEYIARVASVFNNNGKGEKGDLNAVIHAIL
FT                   LDSEALGMTDTPPIKVKEPILVLTNFHRAAGFTIKSTRYEDATTMMNIANQGPLRSPSV
FT                   FNFYSPGYQPSNEFTESGISSPEYELLNWSVYTDLVNYMLTSTRRGGGDSYTLDLGEFY
FT                   LLLDDHDALVELVNARFFAGMASAELTKLMLTVLDEYREDYVPTTKLALVIFTAISGDE
FT                   FYIQD"
FT   gene            complement(97714..98976)
FT                   /locus_tag="VEA_000087"
FT   CDS             complement(97714..98976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000087"
FT                   /product="hydroxymethylglutaryl-CoA reductase"
FT                   /EC_number="1.1.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000087"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52775"
FT                   /db_xref="GOA:D0M858"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:D0M858"
FT                   /protein_id="ACY52775.1"
FT                   /translation="MPKLNQDNPVQSSALSDIETSSKIQSALEPKFHKPEKRLCLSPGL
FT                   SDKHLARRWQVLEHVTNKDHILDPFTQSHCDAYSNNIEHFIGTVNVPVGIAGPLRVNGL
FT                   YANDDFLVPLATTEAALVASYNRGANLITAAGGASALLLSEGVSRTPVFAFNNLADAGQ
FT                   FVSWVVTQFDAFRQIAESTTSHGKLKDINVNIEGNHVYLVFEYVTGDASGQNMVTIATN
FT                   EVFHHILATSPIKPTQAFLDGNLSGDKKPNAHTLRSVRGKKVSAEVTIPAELVEKYLHT
FT                   TPESMVQFGKMTTVGGLLSGTIGVNAHYANALAALYIACGQDAACVAESAIGITRMDVD
FT                   AQGNLYACVTLPNIMVGTVGGGTSLLTQKACLDILGLHGNGNAKALAEVAAALCLAGEL
FT                   SIVGAFCADHFSRAHHKLARK"
FT   gene            complement(99327..100562)
FT                   /locus_tag="VEA_000088"
FT   CDS             complement(99327..100562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000088"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52776"
FT                   /db_xref="GOA:D0M859"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:D0M859"
FT                   /protein_id="ACY52776.1"
FT                   /translation="MNLNTISSHSFFQMNNKIQNYAWGSTSSIHDLFGFSNETNEPQAE
FT                   VWMGTHPNGCSEVQVEQNTLPLSELIKQNQPAYLSAETAAKFGDLPFLFKILAAEHALS
FT                   IQVHPSKQDAEIGFEKEQSAGIPLNASHRNYKDPNHKPELVYALTSYQAMNGFRSYSEI
FT                   IEAFSLCDIDELRAPLDAFKHEANSQGLRDFFVHILTMEGETKERALKQLLAHASHQSE
FT                   QSTDSEQGTDSDAFQLILELSTQYPGDVGLFAPLLLNVITLQPGEAMFLSAKTPHAYIK
FT                   GTGLEIMANSDNVLRAGLTPKHMDVEELVKCTDFVPKPFESLVLEPNANGCQSLYPVPV
FT                   ADFSFSILNQPNHDVVEANSAEILMAIDAELTLISDNGETLTAAKGQSVFVPAYVGHYR
FT                   IQSAGRVARAFN"
FT   gene            complement(100687..102027)
FT                   /locus_tag="VEA_000089"
FT   CDS             complement(100687..102027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000089"
FT                   /product="hexose phosphate uptake regulatory protein UhpC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000089"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52777"
FT                   /db_xref="GOA:D0M860"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="UniProtKB/TrEMBL:D0M860"
FT                   /protein_id="ACY52777.1"
FT                   /translation="MFGFLRSPKFTQPSLSKEQIDQRYRHWRLHIMLGMYIGYAGFYFT
FT                   RKTFNYAAPAMITDLGLDKGDLGLIGTLFYITYGCSKFISGTISDRSNPRYFMGLGLIA
FT                   TGLVNIAFGFSSSLAAFITLWILNAWFQGWGWPSCSKLLTTWYSRSERGFLWAIWNTAH
FT                   NVGGALIPILVGYLTLHYSWREGFILPGIIGVLLGLFVCWRLRDKPTTMGLPSVGQWRN
FT                   DALELAQENYGRGLTYREILKSYVFNNEYIWLLAFSYVLVYIVRTAINDWGNLYLTEQH
FT                   HYSLINANAALSMFEIGGFVGSLVAGWGSDKLFGGNRGPMNLLFAIGIFLSVSALWLMP
FT                   LTNFAFQAAGLFSIGFFVFGPQMLIGMAAAECSHKDSAGAATGFVGLFAYMGAALSGYP
FT                   LALILEEYHWTGFFITISVCAAVIGLLLLPFLQAQPSRKPLEPKPRL"
FT   gene            complement(102034..103536)
FT                   /locus_tag="VEA_000090"
FT   CDS             complement(102034..103536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000090"
FT                   /product="sensor histidine protein kinase UhpB
FT                   glucose-6-phosphate specific"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000090"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52778"
FT                   /db_xref="GOA:D0M861"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:D0M861"
FT                   /protein_id="ACY52778.1"
FT                   /translation="MRAYAVTTICGLFVMACAWFCLWVIAYYFVNDPELAILLFPFALR
FT                   LGIALHTRTAYWPTIYVSEWALTIALATLLEQPQWLTVLIASVASIPVTLIAKKYYYGD
FT                   QNRHLAVMGVVIIISAFINVMAVGFHVPSVYMVWLASISGGLLVVPMCYLLWSYLFQSR
FT                   WSPLSSLLLSNAVVFQVRHIVLYALLLIGSILVQTSLPEELKRFAPFCMAIPIIVLALR
FT                   YGWQGALLATMLNSIALIAARSGVSNLEITDLLLSLSAQTITGIMLGLGVQKQKDLNHK
FT                   LRGELARNQNLSRQLIKAEESVRRDIARELHDEIGQNITAIRTQANIIKRVNNAETSVG
FT                   CADMIEGLSLNVYDTTKRLLSKLRPKMLDDLDLKESVEQLTREMEFANHGTNVQLNWQG
FT                   DYTSLSDTLKVTLFRLCQESLNNAAKYAEAQLINIELTIGEAAVSLMINDDGVGFKVQD
FT                   SMKGMGVRGMQERVHALGGKMVIYSTSDQVIGTQISITLPKV"
FT   gene            complement(103536..104144)
FT                   /locus_tag="VEA_000091"
FT   CDS             complement(103536..104144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000091"
FT                   /product="transcriptional regulatory protein UhpA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000091"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52779"
FT                   /db_xref="GOA:D0M862"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D0M862"
FT                   /protein_id="ACY52779.1"
FT                   /translation="MIHVALVDDHVIVRSGFAQLLNLESDITVVGEFGSVAEARKGLPA
FT                   VHPHVVILDISMPDESGLNFLSEIPTGIACVMLSVHDSPAMVEKSLKLGAKGYLSKRCS
FT                   PDELIQAVRTSASGGCYLTSDIALKLATPSDNTTSLCQLTKRENEVCQLLATGLDVKSV
FT                   AAELGLSHKTVHVHRANAIDKLGVKNNVELAKLFSQESF"
FT   gene            complement(104291..105619)
FT                   /locus_tag="VEA_000092"
FT   CDS             complement(104291..105619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000092"
FT                   /product="hexose phosphate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000092"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52780"
FT                   /db_xref="GOA:D0M863"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="UniProtKB/TrEMBL:D0M863"
FT                   /protein_id="ACY52780.1"
FT                   /translation="MWFKPFIQSYLVVFIGYLTMYLIRKNFNVAQNDMISTYGLSMTDL
FT                   GLIGLGFSITYGIGKTVVSYYADGKNTKQFLPFMLILSGLAMLGFSFSMGGGSASLFLM
FT                   VAFYALSGFFQSTGGPSSYSTITKWTPRNKRGSYLGLWNMSHNVGGAGAAGVALFGANY
FT                   LFDGHVIGMFVFPSIIAIIVGFIGMRFGSDSPEAYGLGKVEELFDEAVSEEDTAAEENQ
FT                   MTKKEIFVEYVLKNKVIWLLCFANIFLYIVRIGIDQWSTVYAYQELGLSKETAISGFTL
FT                   FEVGALVGTLMWGYLSDLANGRRALVACVSLGLIIVSLEFYQHATSEFMYLASLFVLGF
FT                   LVFGPQLLIGVAAVGFVPKKAISVADGVKGTFAYLIGDSFAKLGLGMIADGTPIFGLTG
FT                   WKGTFAALDTSAMICIVLLAFVAIAEEKKIRHAKKLQLAQNQA"
FT   gene            complement(106092..106922)
FT                   /locus_tag="VEA_000093"
FT   CDS             complement(106092..106922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000093"
FT                   /product="formate dehydrogenase chain D"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000093"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52781"
FT                   /db_xref="GOA:D0M864"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D0M864"
FT                   /protein_id="ACY52781.1"
FT                   /translation="MRCTTQSYFELSDFNQAPPQPSAFNYRELIDGRPVQQMSLASESA
FT                   LAISYNGISQAVMMVTPGHLEDFVKGFSLSTGIVHDFKEIKDIEIGGDHESYYAEVEIS
FT                   NRAFWALKTQRRNLAGTTGCGICGVEALEQALPDLVPLTPSLPPRSDVFEGLRDKVAQH
FT                   QEAARESGALHAALFADLQGNIKLCREDIGRHNALDKLIGALANNHIEPQSGFAIMTSR
FT                   CSLELIHKAVRARIPTLVCLSAPTALTVEWARRNHLNLIHLPKHGSPRLYSPAP"
FT   gene            complement(106976..107860)
FT                   /locus_tag="VEA_000094"
FT   CDS             complement(106976..107860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000094"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000094"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52782"
FT                   /db_xref="GOA:D0M865"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M865"
FT                   /protein_id="ACY52782.1"
FT                   /translation="MDIKQLKYLIALEQTKHFGQAAALCHITQPTLSMRIRSLEEELDL
FT                   ELIQRSQRFEGFTEAGERILAWAKTVLAAHDGLQAEAANCRGQLVGSLRLGMVPLASQN
FT                   PIQLLKPLAQQFPELRFQILSMTTEQIIDQLNRNQLDLGMCYVDQVNTAYFDVIELDST
FT                   KLGVLFDERHFDFAESEVLWESLNNIPLGLLSKGMHYRHSVDLSFVSKGLVPQTVIESN
FT                   STFHLIQAVTSGLCCAIMPLNCGLEELNDTLRIMPIEEAAVHAPLGLLKRKQEPFSALT
FT                   DQCFAAAKSIFNR"
FT   gene            108529..110853
FT                   /locus_tag="VEA_000095"
FT   CDS             108529..110853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000095"
FT                   /product="putative formate dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000095"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52783"
FT                   /db_xref="GOA:D0M866"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="UniProtKB/TrEMBL:D0M866"
FT                   /protein_id="ACY52783.1"
FT                   /translation="MSQKEQIKAYKGPAGGWGALKAVTRSWWGSENAVKNIRTMLKTNQ
FT                   NGGFDCPGCAWGESPDSGKVNFCENGAKAVNWEATNRLVDPEFFANHSVSSLSTQTDYW
FT                   LEYQGRITRPMRYDAESDHYVPVSWDEAFSLVAKHLNQLDSPHQAEFYTSGRASNEAAF
FT                   LYQLFVRAFGTNNFPDCSNMCHEASAIGMKDTIGVGKGTVIFDDFEEADAIFVIGQNPG
FT                   TNHPRMLEPLREAVKRGAQVICLNPLKERGLERFQNPQMPIEMLSNGSEPTNTAYLRPA
FT                   LGGDMAVFRGIAKFLLQWEREALQNGGKAVFDREFIKQHTIGIDEYLAEVDATAWEHIT
FT                   EQSGLDLSEIEMVASMYRRAERVIMCWAMGLTQHRHSVPTIKEVANVQMLRGNVGKPGA
FT                   GLSPVRGHSNVQGDRTMGIDEKPSDLLLDRIESRFNFAVPRGEGHNTVQAIKAMEEGQA
FT                   KVFIGLGGNFAQATPDTERTHNAMRNCNLTVHISTKLNRSHLVTGKDALILPCLGRTEI
FT                   DQQATGSQGVTVEDTFSMVHISFGQLKPRSEHLRSEPAIIAGIANATLGAKPIDWLWAI
FT                   EDYDRIRDLIADTIPGFTDFNHKLKHPGGFHLVNPAAERRWNTPSGKAQFSSSELPKQL
FT                   ISEAILEKGQKPDLILQTMRSHDQYNTTLYGLNDRYRGVFGMREVLFINDADIRKLGFE
FT                   PGDKVDMVSLWEDGVERRVSGFTLVAYDVPAGQAAAYYPETNPLVPLDSYGDRTFTPTS
FT                   KFIAIKLEKSTSDKIALVEAE"
FT   gene            111193..111627
FT                   /locus_tag="VEA_000096"
FT   CDS             111193..111627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000096"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000096"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52784"
FT                   /db_xref="GOA:D0M867"
FT                   /db_xref="InterPro:IPR019545"
FT                   /db_xref="UniProtKB/TrEMBL:D0M867"
FT                   /protein_id="ACY52784.1"
FT                   /translation="MAVAIGIAIGIYTLPILIAPPAPTDEQVSESMQGAEYSAVVTRDL
FT                   KDSDAFHWGEGEIHLSSQAITLVGKLAPGPDYKLYLSPKFVETEQAFNDLKSEMSLVGD
FT                   VKTFNNFVVEVPQGISISEYNTVVVWCETFGEFITSAKYQ"
FT   gene            111769..112569
FT                   /locus_tag="VEA_000097"
FT   CDS             111769..112569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000097"
FT                   /product="phenazine biosynthesis PhzF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000097"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52785"
FT                   /db_xref="GOA:D0M868"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D0M868"
FT                   /protein_id="ACY52785.1"
FT                   /translation="MEVKIFQVDSFTSDVFKGNPAGVCITESSLDEEVMLAIAAEMSLS
FT                   ETAFLSLNTMQLRWFTPETEVALCGHGTLATAHVLREQGLYNTGDTIDFATLSGVLTAQ
FT                   LDHDDIHLVFPAPLLDMRASINTDLLHGLGLDVADVIAYGQFDNKQLIVINDESLIEQL
FT                   EPDFSALLKQKGRGVVITAQSSTDADFVSRYFAPWVGVDEDPVTGSAHCALCVYWAKEL
FT                   GKAQLKGFQASKRSGVVYTELLSPEYVKLSGSAVTMLRGDMRIA"
FT   gene            112714..113409
FT                   /locus_tag="VEA_000098"
FT   CDS             112714..113409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000098"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000098"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52786"
FT                   /db_xref="GOA:D0M869"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D0M869"
FT                   /protein_id="ACY52786.1"
FT                   /translation="MKTIGLLGGMSWESTLSYYKLINEGVKEALGGLNSAKICMYSVNF
FT                   SEIEKLQHQGKWEETASILSDAASSIEKGGADFILICTNTMHKVAPQIEASINIPILHI
FT                   ADATAELLREKGVQKVGLLGTQFTMEQDFYKGRLSDLYGLDVITPAQDDRSIVHNIIYK
FT                   ELCQGEIKEESRTIYLQIIEKLKEQGAEAVILGCTEIALLVNQSHTDVTLLDTTSIHAQ
FT                   AAVRLAIEG"
FT   gene            complement(113486..115189)
FT                   /locus_tag="VEA_000099"
FT   CDS             complement(113486..115189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000099"
FT                   /product="putative pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000099"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52787"
FT                   /db_xref="GOA:D0M870"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D0M870"
FT                   /protein_id="ACY52787.1"
FT                   /translation="MTKILIVGGVAGGASAAARARRLSEDAEIIMFERGPFVSFANCGL
FT                   PYHIGGDIQERSKLLLQTPESFLARFNVDVRVMNEVVSINRQDKTVTIKNLLDESEYVE
FT                   SYDFLLLSPGAGPIVPPIPGLDNPLTHSLRNIPDMDRIIETIQMNKPEHATVVGGGFIG
FT                   LEMMEAFHQLGIKTSLIEMADQVMTPVDREMAGFVHAEIRDKGVDLKLGVALESVKFVP
FT                   NEHVASFDSGESDKHQHLEGELELTLNNGEKLTTDILIMAIGVRPETKLAQEAGLQIGA
FT                   LGGIYTNEYMQTSDPSIYAVGDAIEEKDFVTGEQTLVPLAGPANRQGRMAADNMLGRKE
FT                   TYQGTQGTAICKIFGLAVASTGKNEKQLKCAGIEYDKVYVHTASHASYYPGAEVVSFKM
FT                   LFDPKSGKILGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELTYAPPYGSAKDVIN
FT                   QAAFVANNIIKGDAAAIHYDEIDNLTEDQILLDVRNPGELESVGYLEGAINIPVDQLRH
FT                   RMGELPKDKEIVIYCQVGLRGNVAYRQLVNNGYKARNLIGGYRTLKFSRL"
FT   gene            complement(115261..115446)
FT                   /locus_tag="VEA_000100"
FT   CDS             complement(115261..115446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000100"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52788"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D0M871"
FT                   /protein_id="ACY52788.1"
FT                   /translation="MTLENAVRIFAGTMVLISVILTVFVHSNFIWFTVFIGVNLIQSAY
FT                   TGICPAAYFLKKFGFR"
FT   gene            115625..115933
FT                   /locus_tag="VEA_000101"
FT   CDS             115625..115933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000101"
FT                   /product="transcriptional regulator ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000101"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52789"
FT                   /db_xref="GOA:D0M872"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M872"
FT                   /protein_id="ACY52789.1"
FT                   /translation="MSYTDMDVAAMKGNANEAADLLKVMAHPERLMVLCQLTQGEVGVG
FT                   ELQKNSFLSQSAFSQHLTVLRKHKLIKARKASQQVFYSLSEPRVESLIKALHSVFCN"
FT   gene            115962..116381
FT                   /locus_tag="VEA_000102"
FT   CDS             115962..116381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000102"
FT                   /product="DUF395 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000102"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52790"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR025598"
FT                   /db_xref="UniProtKB/TrEMBL:D0M873"
FT                   /protein_id="ACY52790.1"
FT                   /translation="MLNVIPWESLFGGILLGISATILLLVNGKIAGISGIMNGIMSPKK
FT                   GDYSWRLLFAVGMIAGGLISVLMLGVAVPSTANLSLGMVIAAGLLVGIGTRLGNGCTSG
FT                   HGICGMGRLSKRSIVATCVFMAVAGLTVFVRLHLV"
FT   gene            116392..116850
FT                   /locus_tag="VEA_000103"
FT   CDS             116392..116850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000103"
FT                   /product="predicted transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000103"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52791"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D0M874"
FT                   /protein_id="ACY52791.1"
FT                   /translation="MNKTIFRFSALLSGVLFGMGMAVSGMIDPAKVIGFLDISGSWDPS
FT                   LAFVMGGALAVFMPSYFLIIKPRKQSVSGEAFCTPTNKNIDGRLLSGAAIFGLGWGLAG
FT                   ICPGPAVASLALGNVSIVVFFLAMLLGSLFAKAIITHRNAKKVKTANA"
FT   gene            116879..120187
FT                   /locus_tag="VEA_000104"
FT   CDS             116879..120187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000104"
FT                   /product="acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000104"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52792"
FT                   /db_xref="GOA:D0M875"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0M875"
FT                   /protein_id="ACY52792.1"
FT                   /translation="MPDKLKRSFVQSVMNSFFPPIMILLALMVGAAALWLTPKEEDPQI
FT                   VVPMADILVSAPGLSASQVENQITEPLEKLVSQIDGVEYVYSSSMEGAAQVIVRFYVGE
FT                   NREDALVKLYNKLYSNQDKVPPSVTNWLVKPVEIDDVPIVVAAIYSTAPDILDRHQLRR
FT                   IADQATLGIKSLDATNKVEVIGGEPRKIQIELDSVAMANFKVTIDDLEQAIQLSNSKTQ
FT                   GKNVRVNGQNYTLESGRFLTNAEEVGDLVIAVLNGKPVYLKDVARIYDGEGEATSDTWY
FT                   RDKNHDEAYPAVFISVAKQKGSNAVNVAQSVRDKLAELQSEQFPPQVHVAVIRDYGETA
FT                   NAKVNNLVSSLGISILTVVVFVGLFLNWRSALVVGIAIPISYGAALGMDLAFGYSINRV
FT                   TLFALILALGLIVDDPIASIDNIERYLKRKNLTRTNAIVLAMAEIRSALLMSTVAIVIV
FT                   FTPMFFITGMMGPYMAPLAFNVPISVIFSTVVAFMITPWLAKKLLKGAEENGHYDIQSS
FT                   PMYRLYRGVLIPLLESRKKAWLFLGLVALLFVLAALLPALRLVPLKLLPYDNKNEFQLV
FT                   LNMPESSSFVDTSNALSSFTDYLMTVPEVTSVSGFAGTASPMDFNGMVRHYFMRSEPYQ
FT                   GELRVVLAEKNRRAMQSHELVTRLRADLEQIADNFDADVQLVEVPPGPPVIATITAEVY
FT                   GDEATSYEDLMIQAEKVADRLRKEQLVSEVDTSIQGDLETWQFIVDQEKAALSGVSVAD
FT                   INNTLITAANAKVLGYIADPREVAPLPIEVQLRREDRDNLNQLEQLYVRGRPGIAKVES
FT                   NGAVVDAPQPIVQLSEVGHFVKRAADKPIFHKNLKPVVYVYAEVVGRVPGEVIADVMAD
FT                   QDTTHAEDVHRHWQDRTYLSNGAGVTWSVPDYIEVVWSGEGEWKITVDVFRDLGIAYGA
FT                   ALLGVFVVMLIQTGLPAVSGIIMLAIPLTVIGIMPGFWILNVLSSDIGNYPNPALFTAT
FT                   AMIGMIALAGIVVRNSLVLIEFVQQSLAEGRSLHDALIESGVVRMRPILLTAGTTLLGN
FT                   VVITLDPIFNGLAWAIIFGITASTIFTLLVVPVVYNLAYQNTKGHGLPQMEEEQ"
FT   gene            120184..121239
FT                   /locus_tag="VEA_000105"
FT   CDS             120184..121239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000105"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000105"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52793"
FT                   /db_xref="GOA:D0M876"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D0M876"
FT                   /protein_id="ACY52793.1"
FT                   /translation="MKLDTKWLGVILFAILALLFLYMAGFFTEKLPTEHDAKTNQIDVN
FT                   NAETHQLMLTSESVVREFPGVVVAEQHADIAARLTASVMEVLVKVGDRVKQGDVLARLE
FT                   SDDLDARVRQSEQALSSAQAQLNTARKEFSRVRALLNKKLIPQSQFDQAESALQTAQAN
FT                   FNKAQAAVSEAETTFGYSIITAPFDGLITQKPINKGDTATPGALLLSMYNPNSLEIEVN
FT                   FAESVMPYVTYDKEVDVVFPSYNLNAQAAVKEVTPSADANSRSYTVKLQFEPLTAIYPG
FT                   TYAKVALTLTDDVVLRVPKEAVYQVGQLDYVKVVQDSGEVETRLIQLGELGRVRTGLKQ
FT                   GDVVLLNPRSL"
FT   gene            complement(121331..122197)
FT                   /locus_tag="VEA_000106"
FT   CDS             complement(121331..122197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000106"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000106"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52794"
FT                   /db_xref="GOA:D0M877"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D0M877"
FT                   /protein_id="ACY52794.1"
FT                   /translation="MRSLFVTALLIFSSTSLAQNSINLTSWNIEWLSINGGKVSRTSDD
FT                   FIKLNQYVDKTQADIIAFQEVDSKAAVQKAVGDGYAIYLSDRAQSNNKHLQFSDTNQYT
FT                   GFAVRKDIEVSDPADFSITRSNSKLRFASYIVVNPNQKDELHLLSVHLKAGCSGAYKNN
FT                   RNCQTLSQQGEALAKWMSEREKKKQQYAVMGDFNHNLSYQRDWLWAIMTLGNDAQLVTR
FT                   DTKADCKVRSNKNPRKTHQFRSLIDHIIVSPQIKAKNAHQTLFSSQDVLDYKLSDHCPV
FT                   NATVTLN"
FT   gene            122507..124627
FT                   /locus_tag="VEA_000107"
FT   CDS             122507..124627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000107"
FT                   /product="ribonucleotide reductase of class III (anaerobic)
FT                   large subunit"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000107"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52795"
FT                   /db_xref="GOA:D0M878"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D0M878"
FT                   /protein_id="ACY52795.1"
FT                   /translation="MKPIVIKRDGSRAPFNRDRIQAAVEAAAENKDKDVAIYALNVALA
FT                   VELQLKDHDEVHIHEIQDLVENELMQGPYKALARSYIEYRHDRDIAREKQSALTREIEG
FT                   LIEESNLDLINENANKDGKVIPTQRDLLAGIVAKHYAKTHILPRDVVQAHEVGDIHYHD
FT                   LDYAPFFPMFNCMLIDLKGMLTHGFKMGNAEIDTPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLEPYVITSYEKHLEIAKEWNIAEPEEFAKARTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWASRLIQQSILKNRIAGLGKNRKTAVFPKLVFGIKDGLNH
FT                   KAEDPNYDIKKLALECASKRMYPDILNYDKVVEVTGSFKTPMGCRSFLGTYEEDGELIH
FT                   EGRNNLGVVSLNLPRIALRAKGSEAKFYELLDDRLRLARKALETRISRLENVKARVAPI
FT                   LYMEGACGVRLKADDSIAEIFKNGRASISLGYIGVHETINALFGTEAHVYDDAVLREKA
FT                   VAIIKHLKDAVNQWADETGYGFSLYATPSENLCSRFCRIDTKEFGLIEGVTDKGYYTNS
FT                   FHLDVEKKVNPYDKIDFEMPYPEISSGGFICYGEFPNMQRNVEALENVWDYSYTRVPYY
FT                   GTNTPIDECYECGYTGEFECTSKGFTCPSCGNHDSTKVSVTRRVCGYLGSPDARPFNFG
FT                   KQEEVKRRVKHL"
FT   gene            124712..125182
FT                   /locus_tag="VEA_000108"
FT   CDS             124712..125182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000108"
FT                   /product="ribonucleotide reductase of class III (anaerobic)
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000108"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52796"
FT                   /db_xref="GOA:D0M879"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0M879"
FT                   /protein_id="ACY52796.1"
FT                   /translation="MNYHQYYPIDVVNGPGTRCTLFVSGCVHQCRGCYNQSTQRLDSGV
FT                   LFTQEAEDKIINDLNDTRIKRRGLSLSGGDPLHPANVPHILKIVKRVREECPGKDIWVW
FT                   TGYTLAELDDAQREVVQYIDVLIDGKFEQDKKDLNLEWRGSSNQIIHRFTDI"
FT   gene            complement(125267..126652)
FT                   /locus_tag="VEA_000109"
FT   CDS             complement(125267..126652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000109"
FT                   /product="adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000109"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52797"
FT                   /db_xref="GOA:D0M880"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D0M880"
FT                   /protein_id="ACY52797.1"
FT                   /translation="MLLTREYIDKAFWQKLIAIGLPVSLQSMLFALLGVVDIFMVSQLG
FT                   ESATAAVGVGNRIFFFNLAVIFGLCGAVTVLASQYYGSGNLAGIRRTLAQSWFISILVT
FT                   LPFIFLYAIFDKEIVSFMSDDPEYVTYARDYLVVTGFSLIATAIVVPIEAVLRSVGQTK
FT                   LATNVSVSAIVVNIVLNYVLIFGLFGFPQWGVFGAAVGSFVSRFFQTAVLIYFFCKRYA
FT                   YLIPTKFDWAQGRLKQYRQKYFKVSLPMLVHDALWTGGLIVYSIIYGQLGVSELAIISF
FT                   LSPIEGVLISTFMGFAVAASVLLGNDIGAKHYDRVEKTAWWYVLTSAILATLLFFLVWL
FT                   SSPLIHHLLVLSPLTDAEMALNVCLVMALGMILRVFNMVGIGGVLKSGADIRYSIFIDT
FT                   FGQWAIGIPLTYYTGMVLGLPLHFVLMSLLAEEFVKGVLTTYRIQSKRWINNMVEDDQT
FT                   VTA"
FT   gene            126773..127630
FT                   /locus_tag="VEA_000110"
FT   CDS             126773..127630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000110"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000110"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52798"
FT                   /db_xref="GOA:D0M881"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D0M881"
FT                   /protein_id="ACY52798.1"
FT                   /translation="MEDKQERYAISEKTYQEFIDHSRVLALEERGIVQCGIATCRDFFS
FT                   VYRKNQKKHMLLYTVRGKGWLESGACRYDLEPGSLITVPAGVENGFGMEEEPWQIAWLF
FT                   LIPDRAWPMIESNISYQLTSAPEVMYACIQTLLRSINLPIDYGGAVGAHSVAQLELMLN
FT                   MPPSESISRSQLRLRRVFDLVQRQLHKDWSVEQVAALYPCSEPHLHRLTQKQFGRSPMA
FT                   HLTRMRMEYAARLLRSTEWPIQHIGEIVGYPTSANFSTRFKAWSSMTPREFRKNGRVDW
FT                   YIEE"
FT   gene            127786..128973
FT                   /locus_tag="VEA_000111"
FT   CDS             127786..128973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000111"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000111"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52799"
FT                   /db_xref="GOA:D0M882"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D0M882"
FT                   /protein_id="ACY52799.1"
FT                   /translation="MFSNLPTPVLDPILSLSVAYRNDDRPNKVDLGIGVYKNSAGETPI
FT                   MKAIQMAQDVVVETQKTKSYVGLAGCEEFNKSMIDLLLTGTSAMDRVAAIQTPGASGAL
FT                   RMLGDLMKVAQPDTTVWISNPSYVNHKPVMEAAGLKVKFYHYFSPETKQVDTAKMMDDL
FT                   AKAGPSDVVLLHGCCHNPTGADIDFSAWQVITELSQKNGFTPFVDIAYQGFGDGLEEDA
FT                   KGLRFMADNVEEMLITTSCSKNFGLYRERTGAAIVVGKNMQDVANAKGKLLTLARSTYT
FT                   MPPDHGAALVKTILQDDNLTSVWKQELSEMQHRLVSLRQSLCNELRNNHNTDQFDFIEG
FT                   HKGMFTVLGFSENQMAQLREDYGIYGVGDGRINIAGLTETHIPYVADAIKKVSQA"
FT   gene            128985..129668
FT                   /locus_tag="VEA_000112"
FT   CDS             128985..129668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000112"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52800"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D0M883"
FT                   /protein_id="ACY52800.1"
FT                   /translation="MKNWKLILPLMMSGSLIACTSTQTTPEPAEPESPKVEEPVKVEPE
FT                   VKPEVDPTPEVEPKPEVKPEKKSEPKPTKPAKVTKTPDGMLILGSEEWVYVPEIDQTFK
FT                   ARVDTGATTSSISATDIVPFERDGKDWVQFKIDLGDKETKEFKVPVERWAKIKQSSSEE
FT                   VDKRAVVKAYITVGDHKEKTEFTLAERGHMKFPILLGRSFFRDIAVVDVSKKYVQDKPK
FT                   KSGKN"
FT   gene            complement(129782..130318)
FT                   /locus_tag="VEA_000113"
FT   CDS             complement(129782..130318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000113"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52801"
FT                   /db_xref="UniProtKB/TrEMBL:D0M884"
FT                   /protein_id="ACY52801.1"
FT                   /translation="MLGKVLKVAAFGLCAVLPLSAHANNFNYNTMEFRMGTSPGTFGGE
FT                   FNTYFTENTHFIARADSEFSGDWDIAGGIGFNGPAGQFADIYGQMLVHNIKENGSDKVG
FT                   DEWRTEVNIGTRIWFMQNVELHARIGQIMDNDDSNTVYNFGARFHSTQQLSLGADFKNN
FT                   GVYGQQIVMSARFAF"
FT   gene            130335..130448
FT                   /locus_tag="VEA_000114"
FT   CDS             130335..130448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000114"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52802"
FT                   /db_xref="UniProtKB/TrEMBL:D0M885"
FT                   /protein_id="ACY52802.1"
FT                   /translation="MIKMNKKMVCKKQTKIDKAIILSACRHHLAVMVTTSC"
FT   gene            complement(130472..130846)
FT                   /locus_tag="VEA_000115"
FT   CDS             complement(130472..130846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000115"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52803"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="UniProtKB/TrEMBL:D0M886"
FT                   /protein_id="ACY52803.1"
FT                   /translation="MKKNTIIATIAALVIAPSIAFAKDHAQNQSNLQFNGPVTVEKLDA
FT                   LLNDSNMFTEKDVVVEGNLLRQVRADKFVFSDGSGEVMVELDDDIRLNSPIDHTTKVRL
FT                   FGEFEGGNKPEIEVEQLVIM"
FT   gene            130996..132453
FT                   /locus_tag="VEA_000116"
FT   CDS             130996..132453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000116"
FT                   /product="cobyric acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000116"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52804"
FT                   /db_xref="GOA:D0M887"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M887"
FT                   /protein_id="ACY52804.1"
FT                   /translation="MFMKSAIPSLMVQGTTSDAGKSVLVAGLCRVLARKGINVAPFKPQ
FT                   NMALNSAVTKDGGEIGRAQAVQAQACNIEPTVHMNPVLIKPNSDTGAQIILQGKAISNM
FT                   DAAGFHDYKKVAMDTVLDSFSRLTQEFDSIMIEGAGSPAEINLREGDIANMGFAEAADV
FT                   PVIIVADIDRGGVFAHLYGTLALLSESEQARVKGFVINRFRGDIRLLQLGLDWLEEKTG
FT                   KPVLGVLPFLHGLNLEAEDAITAQQELHSEVKLNVVVPVLTRISNHTDFDVLRLNPDIN
FT                   LRYVGKGEKIDKADLVILPGTKSVRDDLEYLRSQGWDKDILRHIRLGGKVIGICGGYQM
FT                   LGNLIDDPNGVEGQPGQSEGLGLLDITTTLTNSKQLTNTQAQLSLNGKTANVKGYEIHV
FT                   GQSEVQGIQPLTLSTGEAEGAISKCGQIMGTYLHGFFDEADVLSLVSEWVNGTQIKQQD
FT                   FEELKEQGINRIADAIEQHMNLDFLFK"
FT   gene            132523..133278
FT                   /locus_tag="VEA_000117"
FT   CDS             132523..133278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000117"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdenum-binding protein ModA"
FT                   /note="TC 3.A.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000117"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52805"
FT                   /db_xref="GOA:D0M888"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D0M888"
FT                   /protein_id="ACY52805.1"
FT                   /translation="MKAWKTHACLAAILSISFSANAATNLKVYAASSMTNAIDEIAQNF
FT                   EEKYDVSITPVYGGSSSIARQIINGAPADIFISANTKWMDYLVDKDVISRDNVTSLVRN
FT                   SLVLIAPQSSELTSFNFSDATAWEKALHGNRLALGNPTSVPAGMYAKESLTTLGVWKEI
FT                   QTQIAPAKNVRLALALVERGEAPLGVVYKTDAQLTDKVKIVGEFASDTHAAIVYPAAVV
FT                   NDSIESEQFFQYLKSDEAARVFAQYGFLQ"
FT   gene            133306..133992
FT                   /locus_tag="VEA_000118"
FT   CDS             133306..133992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000118"
FT                   /product="molybdenum transport system permease protein
FT                   ModB"
FT                   /note="TC 3.A.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000118"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52806"
FT                   /db_xref="GOA:D0M889"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="UniProtKB/TrEMBL:D0M889"
FT                   /protein_id="ACY52806.1"
FT                   /translation="MTELEYQALMLSLKVGAYAVLWLIPLGVFLAWLLSRKTFFGKSIL
FT                   DSLIHLPLVLPPVVIGYLLLVSLGRQGFLGKWLYEHVGLVFSFNWKGAVVACIVVALPL
FT                   MVRSVRLSLENVDPKLEHAASTLGASPLKVFLTITLPLTIPGIITGTMLSFARSLGEFG
FT                   ATISFVSNIPGETQTIPLAMYNFIETPGAEMQAARLCIISVALALSTLMISEWLNRKAA
FT                   SRLGAK"
FT   gene            133992..135098
FT                   /locus_tag="VEA_000119"
FT   CDS             133992..135098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000119"
FT                   /product="molybdenum transport ATP-binding protein ModC"
FT                   /note="TC 3.A.1.8.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000119"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52807"
FT                   /db_xref="GOA:D0M890"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M890"
FT                   /protein_id="ACY52807.1"
FT                   /translation="MTIKVQFKQMLGDTDFDIKLELPCNGISALFGRSGAGKTTLINII
FT                   SGLVAPKQGHVAIGDHVLFDSEMGINLPTHKRGIGYVFQDSRLFPHYSVQGNLLYGVKE
FT                   KDDEYFDAVTELLSIKPLLKRFPISLSGGEKQRVAIARALLSKPNLLLMDEPLASLDMP
FT                   RKREVMPFLEELSEKVNIPIIYVTHSLQEIIRLAQHLAIIDQGKITSSGKLEEVWASHA
FT                   MRPWQSFSDQSSLFEGRIAEHHERYALTCVSLAPNASLWVQKIDGEPETPIRLQVRAND
FT                   VSITLEQPKATSIRNILPATVDSIEVFNAADDKQSINVSLKLDEGCYLWATITPWALDD
FT                   LDLKAGDSVFAQIKGVSVTQKDVALAPH"
FT   gene            complement(135170..135607)
FT                   /locus_tag="VEA_000120"
FT   CDS             complement(135170..135607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000120"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52808"
FT                   /db_xref="InterPro:IPR021422"
FT                   /db_xref="InterPro:IPR023132"
FT                   /db_xref="UniProtKB/TrEMBL:D0M891"
FT                   /protein_id="ACY52808.1"
FT                   /translation="MSEATNSESKKIDLATISPELRKVIEFDEVPEQMFEMVTSIHEVS
FT                   EEAVRESWDEMPASAQNILDNFEQFHALVSVGQAFAGINVMEEFPTLNLPENMTDEDKE
FT                   EYRAQLLDNVLHNCVKDMVKQLKKARRDPLLKREFKEVFAK"
FT   gene            135881..136840
FT                   /locus_tag="VEA_000121"
FT   CDS             135881..136840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000121"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000121"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52809"
FT                   /db_xref="GOA:D0M892"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0M892"
FT                   /protein_id="ACY52809.1"
FT                   /translation="MQPTGTSMRILLVDDVQLDRMQLAIRLKQLGHIVKAVGSGLEALN
FT                   TYESFDPELVLLDISMPDMNGFEVSLHIRETFPDWIPIIFLSSHEEPEMIAKAIEAGGD
FT                   DYLIKPVDKLVLNSKLIAMQRIAHMRRELKQATAQLEKVNQLLTQQANEDGLTKLYNRR
FT                   YIDHKLESMVAWHGRHNMPMALILLDVDFFKPFNDNYGHIEGDRCLQAIANQLKATFCR
FT                   SGEYVGRYGGEEFVVLLGCTDAQTAEREAERIQEAMYFLDYPHEYSSVSNRVTVSQGVF
FT                   VFQPTGKEQQSDLYATVDRALYTSKSLGRNTHTVVNAS"
FT   gene            136837..137829
FT                   /locus_tag="VEA_000122"
FT   CDS             136837..137829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000122"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52810"
FT                   /db_xref="InterPro:IPR021621"
FT                   /db_xref="UniProtKB/TrEMBL:D0M893"
FT                   /protein_id="ACY52810.1"
FT                   /translation="MKQSVINSYALATLSLFSLCSKANSIQDQIQKEYERNFAIGIVLS
FT                   DSDVFTVGFHDFDPNEYFNIDNEDIGTQDSVDLRKKIAVSTLPFSFDLFEQEGIQTHYL
FT                   LNGRVYALSTEQDVYVDQKGQIPDKSKELVMGGYIEFAGEKHLTDKLTLSGAIGSHLMY
FT                   YQNDYSYRSNALNDLKPFLEGVYLNTSAWAVVGEVNTKLKYLEHESWGKWYLWSAPHYF
FT                   YGTGWGKANNGDIGNPEGWYWVNGIKVFYDFTHIGDTVQSVYSSFNRVDIGGDTRKPMN
FT                   TVHYYEASVGWLMTPPFDSDWIDNIGIGLTINYGSALKGGSLVLFFNQD"
FT   gene            complement(137854..139092)
FT                   /locus_tag="VEA_000123"
FT   CDS             complement(137854..139092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000123"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000123"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52811"
FT                   /db_xref="GOA:D0M894"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D0M894"
FT                   /protein_id="ACY52811.1"
FT                   /translation="MSSSSMTSSGFRFLFPFMLLGLVSSSMNNIIQMTQSNWGIAANLP
FT                   YILLGCALLLCYSFKQGRESMVCLATLLAYFVIQHRLQVPLQSGTALLELTILATLLPV
FT                   SFLAVFLFSKDGFDSRAMFTYLLMLTMFVLWSYLTLAYYVEGGFEQWTSGILFIVPTVS
FT                   KLPFILVLYCVGIVCFLGILVLKKNEIIHAMTYSAMVLASATFIFFDVQYISSTMFTLT
FT                   GLLIIIYAASASHQLAFTDSLTRVPSRRALDLDLKHMGKKFTIAMLDVDHFKKFNDTYG
FT                   HDTGDDVLKMVASRLTKTPGGAKVYRFGGEEFTIVFKGKYADECKEFLEEARKSIAEYE
FT                   MILRDEESRPDNHKQGQKKRGNDSSRRKSVFVTASFGAADSKNGQAPQDVIKLADEALY
FT                   KAKKAGRNCVRLH"
FT   gene            139347..139715
FT                   /locus_tag="VEA_000124"
FT   CDS             139347..139715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000124"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52812"
FT                   /db_xref="InterPro:IPR019657"
FT                   /db_xref="UniProtKB/TrEMBL:D0M895"
FT                   /protein_id="ACY52812.1"
FT                   /translation="MQISSDVHNYMETLVGQVLSLPQFVEQYDNEQLADIACLALIQLK
FT                   PVYIRHDIDFLSSLPEQKLTQFKQSADIAVKNAAEMVKEDRRKNRDHDVPVIFTHTSYD
FT                   EDKELDWYEKPILNVNIK"
FT   gene            139757..140038
FT                   /locus_tag="VEA_000125"
FT   CDS             139757..140038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000125"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52813"
FT                   /db_xref="InterPro:IPR018772"
FT                   /db_xref="UniProtKB/TrEMBL:D0M896"
FT                   /protein_id="ACY52813.1"
FT                   /translation="MGFFSRLFGGSEKTAEVKTVEPVKYKGFLIYQESLSEGGQYRIAG
FT                   RIEKQYDDEVKTHRFIRSDLLGSEQDANELMLKKSQMFIDQMGDKIFD"
FT   gene            140474..142030
FT                   /locus_tag="VEA_000126"
FT   CDS             140474..142030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000126"
FT                   /product="NAD(P) transhydrogenase alpha subunit"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000126"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52814"
FT                   /db_xref="GOA:D0M897"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="UniProtKB/TrEMBL:D0M897"
FT                   /protein_id="ACY52814.1"
FT                   /translation="MQIGVPKEILAGESRVAASPKSVEQLIKLGFDIAIESQAGVLASF
FT                   DDAAYEAAGAKIVSSEEVWASGLILKVNAPIVDEEQGIDEIALLQDGATLVSFIWPAQN
FT                   AELMEQLSSKNINVLAMDSVPRISRAQALDALSSMANIAGYRAVVEAAHEFGRFFTGQI
FT                   TAAGKVPPAKVLVAGAGVAGLAAIGAAGSLGAIVRAFDVRPEVKEQVESMGAEFLTVDF
FT                   QEDSGSGDGYAKEMSDDFNKKAAELYAEQAKDVDIIITTALIPGKPAPKLITKEMVDSM
FT                   KAGSVIVDLAAANGGNCEYTVKDQVIMTDNGVKIVGYTDMVGRLPTQSSQLYATNLVNL
FT                   LKLLCKEKDGNINIDFEDVVIRGVTVVKEGEITWPAPPIQVSAQPQVKQEQPAKPEPKV
FT                   EEPTSPTKKIIGVAAAVGAFAWIASVAPAAFLSHFTVFVLACVVGYYVVWNVTHALHTP
FT                   LMSVTNAISGIIVVGALLQIGQGNGVVSFLSFIAVLIASINIFGGFTVTKRMLEMFRKD
FT                   K"
FT   gene            142039..143415
FT                   /locus_tag="VEA_000127"
FT   CDS             142039..143415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000127"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000127"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52815"
FT                   /db_xref="GOA:D0M898"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="UniProtKB/TrEMBL:D0M898"
FT                   /protein_id="ACY52815.1"
FT                   /translation="MSAGLVQAAYIVAALFFIMSLAGLSKQESARNGNYYGIAGMTIAL
FT                   IATIFSPDAQGFGWIIIAMAIGGAIGIFYAKKVEMTEMPELVAILHSFVGLAAVLVGYN
FT                   SYLDAPEAATHAEHVIHLVEVFLGVFIGAVTFTGSIVAFGKLRGVISSSPLNLPHKHKM
FT                   NLAAVVISTLLMIYFVKADGSMFALIVMTLIAFAFGYHLVASIGGADMPVVVSMLNSYS
FT                   GWAAAAAGFMLANDLLIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFGQEIVISGD
FT                   EEQGEHRETTAEEVAEMLKNSKSVIITPGYGMAVAQAQYPVHEITDVLRSKGIEVRFGI
FT                   HPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFAETDTVLVIGANDTVNPAALEDPN
FT                   SPIAGMPVLEVWNAKNVVVFKRSMNTGYAGVQNPLFFKENTSMLFGDAKESVESIFKAL
FT                   "
FT   gene            143571..145025
FT                   /locus_tag="VEA_000128"
FT   CDS             143571..145025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000128"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000128"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52816"
FT                   /db_xref="GOA:D0M899"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR021821"
FT                   /db_xref="UniProtKB/TrEMBL:D0M899"
FT                   /protein_id="ACY52816.1"
FT                   /translation="MIKKFLLGFATVLPLFSAPAFSDSLPERIDTFTELFNYEVALKSY
FT                   DIRILQSNYPTKLLAPDSLLPQTSDYPLKDIQQLYSLANTCRGKLPLSPLITEPLVFTR
FT                   AICKGTQLTPRWFSRSGLIHPGGGTYAARYVDKYPELKPKLAQYMHIKERDNEEGDELL
FT                   ESLKNMDDDAINALIAGASMFIEGNELWLRRGDRYFVFEKDIWEENVANAGLSYALASQ
FT                   SKSCFVKRGNICWDVEDHSQVLRISMIILVIANILLVIGWAVYRWNSKREELRSRMLVL
FT                   QILTHELRTPIASLSLTVEGFRREFEHLPESVYDEFRRLCEDTRRLRQLAEASKDYLQS
FT                   DNQMLATDWVPSVADWLEFKIEEEFDSAVLFNINEDVAAKVNVYWLGTCIDNLLRNALK
FT                   YGIAPVELDVSTSEEKIVFQVRDAGGLTAKDWANLKKPFVSKSGLGLGLTIVESMVGRM
FT                   GGKMSLMGPPTTFILEIPCETDTASR"
FT   gene            145000..145662
FT                   /locus_tag="VEA_000129"
FT   CDS             145000..145662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000129"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000129"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52817"
FT                   /db_xref="GOA:D0M8A0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A0"
FT                   /protein_id="ACY52817.1"
FT                   /translation="MKQTLLLVEDDKNLADGLLVSLEQAGYECLHVERIADVEPQWKKA
FT                   DLVILDRQLPDGDSVQCLPEWKQIKDVPVILLTALVTVKDKVAGLDSGANDYLTKPFAE
FT                   AELFARIRAQLRAPDSAEQSSADKVITKDLEIDRSTREVTYKDELITLTRTEFDLLLFL
FT                   ASNLGRVFTRDELLDHVWGYNHFPTTRTVDTHVLQLRQKLPGLEIETLRGVGYKMKA"
FT   gene            145669..146550
FT                   /locus_tag="VEA_000130"
FT   CDS             145669..146550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000130"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52818"
FT                   /db_xref="InterPro:IPR021290"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A1"
FT                   /protein_id="ACY52818.1"
FT                   /translation="MKTLLPVVLSLALVKPVHAMDWFQTNTPLTQAHQHLLEDDLAGMF
FT                   NSLVELWQTEPSKDLTPHLNDLLGQSLSKNCGKSLTGVTLPEWISGVNVIRQTIQSPGR
FT                   DTFRLVIKLRATTDIENISFNRWVDDSISADSSFSYEEQPSGTELANERSYSKRYNLTG
FT                   KLEAGLYHLTIVSKDKQEYRTWVILGDSNSSQYVRWTSKENWKVEKSALRNPHCPLPQL
FT                   EVGLYDYIDGQYEQMWKKTYESNYPNSLELAGVPNDRYVLAVSINSRRWQGDIIVEQAQ
FT                   TISRTYDLSQEE"
FT   gene            146611..147732
FT                   /locus_tag="VEA_000131"
FT   CDS             146611..147732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000131"
FT                   /product="TraF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000131"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52819"
FT                   /db_xref="GOA:D0M8A2"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A2"
FT                   /protein_id="ACY52819.1"
FT                   /translation="MKTKYKILATSVATTLFANVASAATYAIEARSDAMGGVGTVSATY
FT                   LTAPFFNPALTAIYRRNDDAGMIVPSFGGNYDDQYDLVDEIERISKLTDVDEIKKSMNA
FT                   IDGKKTDFDLGGVVAIGIPNKFLSATAYGKLYTESFVQPKVDTSGTNPLDDSYVQGVSI
FT                   GVAEAGVSLAKYTNFMNQHLSFGVTPKLQRIYTYSYATSFQNFDTKDLREHETAETMFN
FT                   LDAGALWFFGPYRVGISAKNLIGRDVKTKSFMYGSDTIKSYEYSMRPVYTVGAGIVADY
FT                   FTMSVDYDLNEEKRFSSFDDNTQMIRAGIEFDILRQMALRAGYMKNLARSSDEGTITAG
FT                   IGLSPLKLIELDIAAQYTNENAMGASINFLATY"
FT   gene            147775..147936
FT                   /locus_tag="VEA_000132"
FT   CDS             147775..147936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52820"
FT                   /db_xref="InterPro:IPR005371"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A3"
FT                   /protein_id="ACY52820.1"
FT                   /translation="MFDDLPPLSHQEQQQAVEKIQELMAKGTSTAEAIKIVAEQIRSEY
FT                   AEKQQQQN"
FT   gene            148863..149252
FT                   /locus_tag="VEA_000133"
FT   CDS             148863..149252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000133"
FT                   /product="universal stress protein family 2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52821"
FT                   /db_xref="GOA:D0M8A4"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A4"
FT                   /protein_id="ACY52821.1"
FT                   /translation="MSYKHVLVAVDLSQSSQVVIEKAITQAKNSNAKLSFVYVDVDRVI
FT                   MEPKEEQKLQKELQELADKCLYPVHETMAVIGDLHIKLSGIVKKEGIDLVVCGHHHNLL
FT                   SRFFSSVPRVANEVEADLLIVYLDE"
FT   gene            complement(149356..149568)
FT                   /locus_tag="VEA_000134"
FT   CDS             complement(149356..149568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52822"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A5"
FT                   /protein_id="ACY52822.1"
FT                   /translation="MDKLLASALEIKQRTMVTGFFARNGFKIAMTDFDDVTFEREGVQV
FT                   NVHFDLQSNAESASILSQEASAIPG"
FT   gene            complement(149875..150714)
FT                   /locus_tag="VEA_000135"
FT   CDS             complement(149875..150714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000135"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52823"
FT                   /db_xref="GOA:D0M8A6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A6"
FT                   /protein_id="ACY52823.1"
FT                   /translation="MELMNNELVCFAAICKHLSLTEASKELGKSKAQVSRQLAALEKQL
FT                   GVTLVHRTTRKLVLTDHGESIRELAIKTLESLQELNYRASSLSECINGKFKITMPNSIA
FT                   SSIFGSVLKGLQERYPAVNFEISSSNNVENLLESNVDLAIRLNNIIDDTLIAHKIGDYN
FT                   DVLISTVNNANNNTLLIYKNHSNKESIKKQYTDVIEVDNTSILINFVSEGVGVGVIPNY
FT                   LVKGNHIDNNIQISQNFDIERSMYIAYPYQNPLPRKLAEISTFIRSELSKILKNESL"
FT   gene            151689..151862
FT                   /locus_tag="VEA_000136"
FT   CDS             151689..151862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000136"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52824"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A7"
FT                   /protein_id="ACY52824.1"
FT                   /translation="MQELNQLHGFKVDDWFLSSGRCGEIEVHGPYNTADEACKAAKAKY
FT                   GVTKLTSPLLIS"
FT   gene            152160..152315
FT                   /locus_tag="VEA_000137"
FT   CDS             152160..152315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52825"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A8"
FT                   /protein_id="ACY52825.1"
FT                   /translation="MRHDRLELPTGQLVTAQQVLIGVALLELGASNDMKVAHQILKYAR
FT                   ILKKIV"
FT   gene            complement(152360..153118)
FT                   /locus_tag="VEA_000138"
FT   CDS             complement(152360..153118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000138"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52826"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8A9"
FT                   /protein_id="ACY52826.1"
FT                   /translation="MKEVLSSILEHTKDRIRQPFLGAYSLSLMMYNWDVIYYLFWAKGD
FT                   VEVKIVVLKQQYLSITDLTYPFFVALLVVYIPITINAYRQQLFESLEGRVENQRLTRKL
FT                   KRSSFDLEVAENEARLKYVPTRIQKESEEEIDQIKNLNQSLNNEIENLNERIETLNELV
FT                   RSQTNRLEELTERNEELTTRIRLHQINSTDYGVTKLNSQQADLLNSLSRFAGKVPSNKW
FT                   KELENAAIACDEKTLKRLIRDIENTHTTAE"
FT   gene            complement(153243..153947)
FT                   /locus_tag="VEA_000139"
FT   CDS             complement(153243..153947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000139"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52827"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B0"
FT                   /protein_id="ACY52827.1"
FT                   /translation="MAKFLNTSATNYYLEELIKNASERLILISPFLKLNDRIRELLEDK
FT                   DRLKIDIRIVYGKSELQPDEINWLKGLSFVRTSFCKNLHAKCYMNESACIITSLNLYEF
FT                   SQVNNNEMGIFIDRDEDPDVYKDSYEEAQRIIRISDEVRISLEKVKSSVNDPSKNEESE
FT                   PEQAKLTSSKLAKKHKIKTDDFLQMCVSKGYLSFDDGKHSLTEEGKSLGGEFKYSKRFG
FT                   PYFIWPQSLDVE"
FT   gene            complement(154153..154713)
FT                   /locus_tag="VEA_000140"
FT   CDS             complement(154153..154713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000140"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52828"
FT                   /db_xref="GOA:D0M8B1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B1"
FT                   /protein_id="ACY52828.1"
FT                   /translation="MAQSDDRNTDNNTTGDLHDLTAVVLDSNVEVTGYKQFDCGNEIIN
FT                   RYVKKSLKAQAKAPGNGVVVLLNNENQIVGFFTLTLHSLTRDKLNSVSDFVGKTAMVPA
FT                   VRLTMIGVDIKYQGNGIGSDLMALVFEKTHAIASSAGCSGLYLDADHYAVDFYRQLGFT
FT                   ALDTPDPITLVVPMFLHLSAIPK"
FT   gene            complement(155749..155892)
FT                   /locus_tag="VEA_000141"
FT   CDS             complement(155749..155892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000141"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52829"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B2"
FT                   /protein_id="ACY52829.1"
FT                   /translation="MNEYVTHGQLVEIIELFDHLSIVNAVIVVLAYDLARYLLGKLVDY
FT                   FN"
FT   gene            complement(155892..157277)
FT                   /locus_tag="VEA_000142"
FT   CDS             complement(155892..157277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000142"
FT                   /product="zona occludens toxin"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000142"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52830"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B3"
FT                   /protein_id="ACY52830.1"
FT                   /translation="MATSFRYGHGGSYKSACAVWFDLLPALREGRICITNIHGMQPLEV
FT                   IEQRLGEKFPDTARLIRISSRNPEGFELWKYFFCWAPIGAFILIDECQQIFSVNAGFKM
FT                   ANIHKRPFTDFEPHLPEGFSELFHSRWLTIDTSSLDNGEIDDCQRTRFDEQGRIIYPEN
FT                   FNNAFMEHRHYNWDIVLLTPDFAQIPKELKGVAELAKQHKGKDGIFFSNRKPRILEHDP
FT                   TRTVTKPSKDDVVYNLKVPLDVHLLYASTVTGQITKSGLGKNIFLNPKFLAAMALVVLS
FT                   FGYLVYALIGMVSDSETTTAEGTQLHQTSQQSGVSTSQGQARPGQSGSPGSVMGSSGSG
FT                   CTGSGCGNESYHDVGTVPAWFPLANSESIYVSAVERWHKATSIHVNVHFEVVTPRGVTY
FT                   LDDGFLNKLGVKMEYLDDCLVQLSRGASNFYVTCSPYEQYAQRQEQDIELKPVGGLFSG
FT                   DET"
FT   gene            complement(157282..157626)
FT                   /locus_tag="VEA_000143"
FT   CDS             complement(157282..157626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000143"
FT                   /product="accessory cholera enterotoxin"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52831"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B4"
FT                   /protein_id="ACY52831.1"
FT                   /translation="MEYIYSALEFIANIGQTFLDFFDVAIEWIKNAFEYGAMWLISVWL
FT                   DIKIASIQIALKIAQLLLEEYGVYTLVEDRFNALPSDVRYILTEYGVTSGLRVIFDAFA
FT                   TSLVMRFFNW"
FT   gene            complement(157628..158734)
FT                   /locus_tag="VEA_000144"
FT   CDS             complement(157628..158734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000144"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52832"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B5"
FT                   /protein_id="ACY52832.1"
FT                   /translation="MDACQFKQSIGDTVKLHWHPAVYGELVTGACYGDYGATRCEMTKN
FT                   ESTIICTGVPDGQYTPDSQCSLRFAYTGRQCEGGTLFWGVNGPDEPIIPPDEPEDPTHD
FT                   PDDPTGEIEDPSVLPDDSTNTVNPGVVDDKPDVEDPDTDESTDTAVLSAIKGLNMDVNK
FT                   GIHDLNVDINQSHADITNAVIGVKGSLVDNTQAIQEQQINDNKIYNNTKALIQQANGDI
FT                   TTAVNNNTNATIGIRDDLKGLGDSVGELDSSLNAIEGLLTGSEFGTPTGTAITGEIFTA
FT                   EDFANLQTTIDEKAESIQGYVDDIKGLITIGTNFNNGTLSDKSFNIKGATVESGLQRFD
FT                   AVSGYVRPVVLFICALIALWVLFGNRSK"
FT   gene            complement(159296..159541)
FT                   /locus_tag="VEA_000145"
FT   CDS             complement(159296..159541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000145"
FT                   /product="bacteriophage f237 ORF4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000145"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52833"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B6"
FT                   /protein_id="ACY52833.1"
FT                   /translation="MKKLELVVTNVKHAVVNKKTAAGAALMAASVSPAFAEVDITGAIN
FT                   SAVSGGQANVSLVVAGLIGMAALGFGVTMVVGFLRR"
FT   gene            complement(159547..159777)
FT                   /locus_tag="VEA_000146"
FT   CDS             complement(159547..159777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000146"
FT                   /product="bacteriophage f237 ORF3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52834"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B7"
FT                   /protein_id="ACY52834.1"
FT                   /translation="MSVCVTVVNQYGNLKATKTPVADCQEYVLISAVDYQEYKEPVLFN
FT                   GDLFLYVSGVLLINMVVGHWVGRVVRLMSKR"
FT   gene            complement(159781..160140)
FT                   /locus_tag="VEA_000147"
FT   CDS             complement(159781..160140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000147"
FT                   /product="integrase phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000147"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52835"
FT                   /db_xref="InterPro:IPR009712"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B8"
FT                   /protein_id="ACY52835.1"
FT                   /translation="MAKSVFVLGMDITWNSARGDSAQLNVSRPLREINSEKFKRRTIGE
FT                   SGDVNPQWDQPLMIDHEYALLLERTGALVPRREYQLRLEINPEDPLAGAIVTELIPVDQ
FT                   EIKKHFEASMKPVQG"
FT   gene            complement(160144..161292)
FT                   /locus_tag="VEA_000148"
FT   CDS             complement(160144..161292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000148"
FT                   /product="RstA phage-related replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52836"
FT                   /db_xref="GOA:D0M8B9"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8B9"
FT                   /protein_id="ACY52836.1"
FT                   /translation="MTTATNILKKFDEQSVHIDYLCFTFAVKDLRHCHDAVRRLHKHEE
FT                   YKGFAKSGLLQRHCRAPKFPAPPVFNPTVAQTSDEIDAYNKAFELCYRNYLEDCLRIFT
FT                   NQVLGLSLSAPRGLGFQFYTESMKLTSPDGEDFCGFVGIGGNNDTVHFQINGTGCKHVF
FT                   ARRPTWSLHDWLTNVLGVQTLARVDLAYDDYDGIFDCEYAYKAWRDDCFRTAERGRGPV
FT                   LHEDMTIASIGKDGKPIYTKEQYSIGSRTSRIYWRIYNKALEQKLANTGLVWYRSEVEL
FT                   KKWNVDVLLNPAGAYAALNDFAASISTAKKFNTKPVPTKRAALDLLASAHWMRRQYGKI
FT                   LNSLIEFHEGDIETVVGSLVRDGTKFTFPDTYGKLVTHILET"
FT   gene            complement(161276..161491)
FT                   /locus_tag="VEA_000149"
FT   CDS             complement(161276..161491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52837"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C0"
FT                   /protein_id="ACY52837.1"
FT                   /translation="MNEAQIIYYDLLPDYTVSVLVKGCDEWDLLKSMSHLESWASSQFA
FT                   SYELVSITNTTVEQRINLGVFDDYRN"
FT   gene            complement(161494..161799)
FT                   /locus_tag="VEA_000150"
FT   CDS             complement(161494..161799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000150"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52838"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C1"
FT                   /protein_id="ACY52838.1"
FT                   /translation="MIVLETEVQNVNVKTLTLRHFAVSHVPAFKLCYITTTDIFEEVVV
FT                   PFNHFGYCISTFENNQESFGYLSVGDYEFRFESDEHEVLCRFLGMTPSKATALEAQ"
FT   gene            161999..162367
FT                   /locus_tag="VEA_000151"
FT   CDS             161999..162367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000151"
FT                   /product="bacteriophage f237 ORF10"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52839"
FT                   /db_xref="InterPro:IPR021096"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C2"
FT                   /protein_id="ACY52839.1"
FT                   /translation="MYTNKLIDAYKEQMNYIQYKQIAHDLGVSPQMLTEVRKGRSYLNE
FT                   NQILMLAETIGEDKEKALIGLAMDKAKTHEAQTLWQNIGKKFNGLGLSSISMACAGLAL
FT                   VIASPQEPLHQCALCILC"
FT   gene            complement(162597..162908)
FT                   /locus_tag="VEA_000152"
FT   CDS             complement(162597..162908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000152"
FT                   /product="translation initiation factor SUI1-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000152"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52840"
FT                   /db_xref="GOA:D0M8C3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C3"
FT                   /protein_id="ACY52840.1"
FT                   /translation="MTLVYSTETGRIKPEEEKTSRPKGDGIVRIQRQTKGRKGKGVCIV
FT                   TGLDLDDAPLKLLAAELKKVCGCGGSVKDGNIEIQGDARDKIKAHLEKKGMTVKLAGG"
FT   gene            complement(162910..163197)
FT                   /locus_tag="VEA_000153"
FT   CDS             complement(162910..163197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000153"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52841"
FT                   /db_xref="InterPro:IPR021753"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C4"
FT                   /protein_id="ACY52841.1"
FT                   /translation="MTAVKKSIDWWCDTASIIDPKEFAALGQRAQQVGGAKSEVFNGYT
FT                   IQNDTGQPNSWYCMFNGKLIKGSKTAIQRHIEAYLVAKQKAMQAQQQKKQ"
FT   gene            complement(163425..164414)
FT                   /locus_tag="VEA_000154"
FT   CDS             complement(163425..164414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000154"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52842"
FT                   /db_xref="GOA:D0M8C5"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C5"
FT                   /protein_id="ACY52842.1"
FT                   /translation="MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIEDVHVTRVEIKN
FT                   EGWMTNQGELVYLDLNTKQLCSSESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLG
FT                   CGPEASSNSFNKITSKLWYDAIGIPNTPYLFLTRNDEEAHTQAHKAFEKWGKVFVKAAR
FT                   QGSSVGCYSVTEKDKLSNAVNDAFGFSDQVLVEKSVKPRELEVAAYEMNGQLHITKPGE
FT                   VIAPDGAFYSYDEKYSSSSHSLTEVEAKNLTQAQLDAIQHASERVFKQMNLRHLSRIDF
FT                   FLTEDDEIYLNEVNTFPGMTPISMFPKMLQNNGHKFHEFLEDCINSAK"
FT   gene            complement(164564..165133)
FT                   /locus_tag="VEA_000155"
FT   CDS             complement(164564..165133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000155"
FT                   /product="DamX-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52843"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C6"
FT                   /protein_id="ACY52843.1"
FT                   /translation="MKKIAIIGLSVLLSACASETYITDVTSESYREDYKSDRISKPIMA
FT                   SENAVVEKDVQPTVVKMTAKPEEKKVVKLTPKEQAKPVKIVPPSKKQAGIQRFGYTIQV
FT                   AAVGSQAKVDQFANKLPQNGQPIWENYKVVNGTKWFSVLYGDYATSAEAKQAISTLPAQ
FT                   FQQLRPFVKSIDAIKNSAYPTLNKLN"
FT   gene            165370..168003
FT                   /locus_tag="VEA_000156"
FT   CDS             165370..168003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000156"
FT                   /product="protein acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52844"
FT                   /db_xref="GOA:D0M8C7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C7"
FT                   /protein_id="ACY52844.1"
FT                   /translation="MNKLHKLFKPNSVAVIGASQKALRAGHVVMRNLLQSGFGGAIMPV
FT                   TPRYKAVSGVIAYPDVASLPYTPDIAILCTNVSRNEQLLKELDERGTPFAIVISDDAQP
FT                   LNISSLNIRVLGPNSLGIILPWHKFNCTFSPVAAKPGKIAFISQSAAVCTTVLDWANDK
FT                   NIGFSSFISIGRGQDIDFADLLDYLSMDGNTEAILLYVDNIQDARRFMSAARAASRNRR
FT                   ILVLKAGRSKEMNTFEQQDGDTLDVIYDSAIRRTGMLRVSNTHELFAAVETLTHSVPLR
FT                   GERLAIITNGGGPAVMSVDTLIERGGQLATLDDAAIEQLQTVLPSNWRTRNPIDLSGDA
FT                   TKKRYIDTINALMNNDCADAILIMHSPSAVSDPLETAQAVIEAIKAHPRHKHFNVLTNW
FT                   SGEQTSREARLAFTQAGIPTYRTPESAVVAYMHLVEYRRNQKQLMETPTTAEPLHSGSV
FT                   SSAKEWVNERLLDKNTVTLDTHQTSPLFKLFGFNVLPTWIASDDIEAVHMAENIGYPVA
FT                   VKLRSPDIPHKSDVHGVALNLRNSREVSNAALSILDTVKLSYPSANVHGLLVQGMAKLG
FT                   SAEELRISIAVDKVFGPVILLGQGGSEWNIAQDAVAALPPLNMTLARYLVVVALKSGKI
FT                   RLQKHKDALDISELSKFLVRISQMAVELPEIQRLDIHPVLVSGSDLTILDADITLCKYE
FT                   GDAQKRLAIRPFPAEFVETVTLRDGQPILLRPILPEDEPLHAQFINSVSKEDLYKRFFS
FT                   EVGEFNHEALANFTQIDYDREMAFVAVAFNTDGPSIIGVARALITPDNSDAEFAILVRS
FT                   DLKGKGLGKVLMQKIISYCKIKGTKQMSGMTMPTNRGMLMLAQNLGFEVDVQFADGTAD
FT                   MVLPLN"
FT   gene            complement(168080..168967)
FT                   /locus_tag="VEA_000157"
FT   CDS             complement(168080..168967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000157"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52845"
FT                   /db_xref="GOA:D0M8C8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C8"
FT                   /protein_id="ACY52845.1"
FT                   /translation="MQSPITLEALHILDAIDRRGSFAAAANELDRAPSSLSYQIQKLEQ
FT                   DLDIIIFDRSGHKAHFTEAGKLILERGRAILQASEKLVNDATLLANGWELDITIAFDGI
FT                   IPISNFFPMVDALAEVSSTRVRLQEEILAGSWESLNTGRADLLICPSLDTLPQEVKSEK
FT                   IGKMSMFWVAAADHYVHKRSGKFDEAAREKYRIIAIADTAREQPALSINIIQKQPRLTV
FT                   TNFTAKVDALTAGLGIGTLPSQIAQPLIDSGVLKRIEGTEEQPMDIILAWRRNTMGEAK
FT                   SWCIQYLKKNWKLK"
FT   gene            169200..171281
FT                   /locus_tag="VEA_000158"
FT   CDS             169200..171281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000158"
FT                   /product="TonB-dependent heme and hemoglobin receptor HutA"
FT                   /note="most likely function alternative not yet resolved;
FT                   TonB-dependent hemin ferrichrome receptor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000158"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52846"
FT                   /db_xref="GOA:D0M8C9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8C9"
FT                   /protein_id="ACY52846.1"
FT                   /translation="MYKKSILSASILIALSQGAYAEDHSTFNEVVVTATRTNSQIEDTA
FT                   ASVAVVTDKNIEESMVTGLDDLFEYTPGVTVKTNSRQGVQSINIRGIEGNRIKVLVDGV
FT                   SQGNQFESGNTFINSARVNVDTDLIKAVEIVKGAASSLHGSDAIGGIVAFETKDPADFL
FT                   KGRNFGGHAKLNYSSEDNTFSESVALAHKTGDLESLLAYTRRDGNELDNFGDLADADTE
FT                   ANNLLVKLQYQLNDAHRVEFNGNYIRNKGNGKQSYNGYTNATSEDVTEQYQVGIKHIWE
FT                   MQTAVADSLTWQLDWLSKEENGITDRVKGQNNQRKDYIYEDEGYQFDSQFDKYLMLGST
FT                   EHYFVYGASFSDKDIKNVNKEYNSASANKEIFYIPSASERRYGLFLQDEITVGNFTITP
FT                   GVRWDAFETDPGDTSSNPSGNAASDYKKFSDSAFTGRLGSVYKLNEQHRLFAQISQGFR
FT                   APDFQELYYSFGNPMHGYIFKPNPDLKAEDSISYEFGWRHNNDISSSEVSVFYSDYDNF
FT                   IESKTVSGTWTPVTDPAILQYVNIGKATIKGIEFSNQLSWNKFMPIEGFSSRLAAAYTE
FT                   GEDGNNNPLNSVNPWNLVAGFNYDSEQNWGTTLTINYTASKDKSDINDDKVLPISAATV
FT                   VDVTAYYKPIKDLTLRAGLFNVTDEEYYNWNDVRDLQTENKDLTQAGRNWSITAKYEF"
FT   gene            171362..171487
FT                   /locus_tag="VEA_000159"
FT   CDS             171362..171487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000159"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52847"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D0"
FT                   /protein_id="ACY52847.1"
FT                   /translation="MKVYCFAISFFTITAAAMIKVMIRPSSMNYPNSYEKIYNPN"
FT   gene            complement(171616..172632)
FT                   /locus_tag="VEA_000160"
FT   CDS             complement(171616..172632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000160"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000160"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52848"
FT                   /db_xref="GOA:D0M8D1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025308"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D1"
FT                   /protein_id="ACY52848.1"
FT                   /translation="MKVLVTGGMGYIGSHTCIQMIEAGMTPVILDNLYNSKSTVLERIE
FT                   KVCGVKPTFIQADIRDKSTMVEVLKSHDIEAVIHFAGLKAVGESVAKPLEYYDNNVNGT
FT                   LVLVDAMREAGVKSLVFSSSATVYGDPASVPITEDFPTSATNPYGRSKLMVEECLTDFQ
FT                   KANPDWSITLLRYFNPVGSHPTGELGEDPQGIPNNLMPFVSQVAVGRREFLSVFGSDYP
FT                   TKDGTGVRDYIHVMDLSDGHVAALEKVGNKAGLHVYNLGTGNGYSVLEMVKAFETASGK
FT                   DVPYQLVERRPGDIAECWADPSKAMNELGWKASRTLEEMTGDTWRWQSNNPQGYPDA"
FT   gene            complement(172687..174645)
FT                   /locus_tag="VEA_000161"
FT   CDS             complement(172687..174645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000161"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000161"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52849"
FT                   /db_xref="GOA:D0M8D2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D2"
FT                   /protein_id="ACY52849.1"
FT                   /translation="MSLRAKLIWPILVFITAIFVISKGYTSYTAYQSSKHELVEQTRKL
FT                   INNVSFSIKDALTTKNKQKAQTTLINFLNQPNVTRVKLYDQDDQPFVVLEGSGVSAPVP
FT                   NQTERSKLHALGYALSAKFLYVLEPIIHDGRVIGSMRVTLSHRPIIEAQQSLLQDGAVL
FT                   LLLLFAGGTIFYISINKLVLKPVIELSHTIESVTHGQNTDTQVRYYSKDEIGELAHSFN
FT                   QMMNKLTTREKQRQHSLEMLEQKRAFSEEVIESVQHALVITDNFGRVIYCNTATRQIFQ
FT                   KKSEELEHANIRDLIKTKTPNELSQILSRGLECDDIHLKNADNEQQLSLTSRRLSTHGH
FT                   LLFSIQDITEIEEAMSRQRVAGRVFESSQDGLIVLNHRGVITMANPAVTKLVGLEMDQL
FT                   IGKSFIQTLKWRKLQEMMPSIIESIKNYGVWQGEVIEQNHLGQFVPMFARVNRIVKCED
FT                   HGFYDLVIVLTDLSGAKEMERLEYLAHHDALTGLANRSKFHLELEELVQRSGYLRDEFA
FT                   VLYLDLDGFKEVNDTYGHDAGDEVLKKVAERLTSATRHSDLIARLSGDEFVMLVNPANQ
FT                   KVVTRIAEQLLESVCTPIKYKGNSLKVGVSIGVKLVGVNERDATRVLKSADTAMYQAKK
FT                   AGKGQAILMGCELQETV"
FT   gene            174965..175720
FT                   /locus_tag="VEA_000162"
FT   CDS             174965..175720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000162"
FT                   /product="lactam utilization protein LAMB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52850"
FT                   /db_xref="GOA:D0M8D3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D3"
FT                   /protein_id="ACY52850.1"
FT                   /translation="MTLNKQQLTLNCDMGESFGAWIMGADEDVMPHVDMANIACGFHAS
FT                   DPNVMHDTITLANDNDVDIGAHPGYADLQGFGRRSINMTGDEITNMVIYQVGALQALCQ
FT                   AQYTDISYIKPHGALYNDMMKSDAIFRSVVKAAALFKVPLMILASQENEKYLEIADDYD
FT                   VPLLFEAFADRLYQDDGLLTPRTQPNAVLKNEHAILEQVRTLADSGRVKTASGGYILLE
FT                   ADTICVHGDNEESIALIQKIRQSLYAGGN"
FT   gene            175720..176403
FT                   /locus_tag="VEA_000163"
FT   CDS             175720..176403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000163"
FT                   /product="allophanate hydrolase subunit 1"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000163"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52851"
FT                   /db_xref="GOA:D0M8D4"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D4"
FT                   /protein_id="ACY52851.1"
FT                   /translation="MHKEKFSISLISECSIFIKFDENISENAVGELARNIKDTLASIIM
FT                   NVVPSYQTILIDYLPFRINEKDLVHKLHQMISQFDTQSFSLVQPNHIAIPVYYSEETAL
FT                   DLPRFQDRGLSLDVLISLHTQAEYAVSAIGFAPGFAFLSDVDTQLHMPRLATPRTRVPA
FT                   GSVGIADNKTAVYPSDSPGGWNIIGRSPLPLFSDTPPFIPFEVGDKVTFNAISKQKFIE
FT                   LGGVL"
FT   gene            176400..177335
FT                   /locus_tag="VEA_000164"
FT   CDS             176400..177335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000164"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000164"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52852"
FT                   /db_xref="GOA:D0M8D5"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D5"
FT                   /protein_id="ACY52852.1"
FT                   /translation="MSYAGLLVEKSGPLSLIQDFGRFGLAHIGVTQGGPVDDYAYSWAN
FT                   HLLGNVVNCAVIEITLGNACFVALHNCHLAICGGDLNAKVDGEPISNWSDFTLKKGQKL
FT                   QFGVAKNGLRSYLAVKGGFDIAQHLGSASTVTRESLGGYDSNGGALKAGDILPFFPHNL
FT                   PKHKPRLMTFRFKPDYNLPIKLRVIEGYQNEDFDEDARQAFYSNAFTISPDSNRMGYRL
FT                   EGNKIKPPYEGVLSEGIALGSIQVPNDGNPIVLLNDHQTIGGYPKFGCVARIDLPRLAQ
FT                   AKPGQKVNFVKGDRQGLQEVWCQWAQFFGY"
FT   gene            complement(177363..178802)
FT                   /locus_tag="VEA_000165"
FT   CDS             complement(177363..178802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52853"
FT                   /db_xref="GOA:D0M8D6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D6"
FT                   /protein_id="ACY52853.1"
FT                   /translation="MKSEFPNYKDKHIAVVGGGVAGATAAIHFAELGFKVSVIEKGVSL
FT                   VNGPPICHLHAGGNLYREISEQQCLDLLAQSIDTVRLYPLSLNIRPTIIAVPYSDGGDP
FT                   SALIPRLEVVKNAYQTLVDKDQSNKVLGEPSEYYKLYSKEDLEALAQRTQPSHPATFDE
FT                   WCIPFAQHADLEALKYPVVAVQEYGWSVFRLAAIANLTLNALPNASVCTQATLKQADWM
FT                   GNHWQLGYERDGIDYLMTCDYLVNACGFETGSIDNTIGAKRDRLVEFKAAYVTKWADCQ
FT                   QLWPEVIFHGPRGTDKGMAQLTPYGDGYFQLHGMTKGITLFEDGLVESTPSSAQPELPV
FT                   PLLSKIRNGWREEVLEERTNNAIKHMAQFIPDYHSAIKGGKALFGAQQIPGTDPVLRAA
FT                   DVTFEDNHYARIEVVKASSTLLAAQKMLQFWFDIEPNQNVESQHPVAVHWSEQEIEQYA
FT                   IKLTQERDYPQALAERYGMPA"
FT   gene            complement(179156..181612)
FT                   /locus_tag="VEA_000166"
FT   CDS             complement(179156..181612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000166"
FT                   /product="predicted ABC-type transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000166"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52854"
FT                   /db_xref="GOA:D0M8D7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D7"
FT                   /protein_id="ACY52854.1"
FT                   /translation="MSAVSSSEATSTERSSAIKHSSNKSLIRWSFGEIRQGNLWPISVA
FT                   LILVIASIFALSALAERMEQVIVKQGKDALTADAVFVSANPIPDTLLASTENLERSTMT
FT                   RFATMAFSDNGMQLISVRAVDDNYPLMGELVLDNNPSGRVKENQLWLDERIMAQLDVKS
FT                   GDSVTIGDADFTVSGAVLMEPGLSFNPFQQMPSAYIHQKDVEKTGAIQVGSRVQYRLFL
FT                   QADDKTLKGLQEDTVLSPSDRWRTQDTASRSNEVFERTTQYLSLTVAIVIIMAATTLVL
FT                   TCQNYVNSRTQTIAMLKSLGASRRWIEKWLFIQVTILLISASVVGLLLGSGLEYLLRIP
FT                   LKDLLPEPLPSYGVTPYLVSFISAVLITVPALGIPLLGLITTPALEVLQQGKAQRSWKR
FT                   MLLVLVPVVPLLLLYADNTLVWIVLIGIAVLFVVLAAVSVALTKLFARISTQPAMKLAL
FT                   SRINRTPVTSGLQFGALALSLMLLSIIWLVRSDILADWERTLPADAPNVFALNIGDYEL
FT                   DSYLETLDKNGVTRSQAYPIIRGRLTEINGQNVKEIEYEGEGSDAIRRELNLTWGNSLP
FT                   EYNDVLAGEWTNKGSVSVEADVANDLGIELGDKLRFVINSQNYDAVVDTIRYVEWRDMK
FT                   PNFYFIFSSDVMANLPGSYLISYRIDEGNEALLTSMSRSHPTVSVLDIRTMGEKIQDLI
FT                   QQIVSAITILALLGVVAGVLLIFTLLRLSLSQRQQEIRLYRTLGSSKKRINTTLWAEYG
FT                   IMALIASGVAVFAAEVCVAAVMIYGFDLNAQIHPELWIALPLATFVTLALVVMSLLKRL
FT                   LTPVNT"
FT   gene            complement(181612..182304)
FT                   /locus_tag="VEA_000167"
FT   CDS             complement(181612..182304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000167"
FT                   /product="predicted ABC-type transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000167"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52855"
FT                   /db_xref="GOA:D0M8D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D8"
FT                   /protein_id="ACY52855.1"
FT                   /translation="MQTPVLNAPIVQANLVSKQVSTNQEQLTILKDVNVDIRKGEKIAI
FT                   VGTSGAGKSTLMTLLAGLDTPTSGEITLLGHELSKLDDEARAKIRADSLGFVFQSFLLI
FT                   PSLSALRNVTLPCLLRGEAEDEARAAELLTAVGLEKRVDHLPSQLSGGEQQRVALARAF
FT                   MTQPELLFADEPTGNLDHQTADKVIELLFDLNEQHGTTLILVTHDGHLASRCDRIYRME
FT                   AGELKEEV"
FT   gene            182303..182905
FT                   /locus_tag="VEA_000168"
FT   CDS             182303..182905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000168"
FT                   /product="arylesterase precursor"
FT                   /EC_number="3.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000168"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52856"
FT                   /db_xref="GOA:D0M8D9"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8D9"
FT                   /protein_id="ACY52856.1"
FT                   /translation="MIRILSLVLFFCFSATAHASEKLLVLGDSLSAGYQMPIEKSWPSL
FT                   LPDALSEHGQDVTVINASISGDTTGNGLARLPQLLTQHSPDMVLIELGANDGLRGFPPK
FT                   LITSNLSKMITMIKDSGADVVMMQIRVPPNYGKRYSDMFYDIYPKLAQHQQVTLMPFFL
FT                   EHVVIKPEWMMDDGLHPKPDAQPWIADFVAQELIKHL"
FT   gene            182988..184187
FT                   /locus_tag="VEA_000169"
FT   CDS             182988..184187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000169"
FT                   /product="uncharacterized paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000169"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52857"
FT                   /db_xref="GOA:D0M8E0"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E0"
FT                   /protein_id="ACY52857.1"
FT                   /translation="MRIDPLIQGVVARSAHPYGCHASIKEQIEYVKHAPQIKSGPKRVL
FT                   IIGASSGFGLAARIALTFGGAKADTIGVSFERGPSDKGVGSAGWYNNIFFKQEANHAGR
FT                   TAINIVGDAFSDSVRNQVIEAIETYFEGEVDLVIYSLATGVRPKPESDEFWRSVIKPIG
FT                   EPVTGASIMLENDQWVETTLTPATEEEAEATIKVMGGEDWESWIDTLINNDSIAQGCKT
FT                   IAFSYMGPDVTHPIYLDGTLGRAKIDLHQTSHSLNLKLANFDGGAYATVCKALVTKASV
FT                   FIPALSPYLLALYRVMKEKGTHERCIEQMQRLFTTKLYDQDKVPVDGERLIRIDDLELD
FT                   PQVQQEVHALLEQMNANNFKEIGDYQGFKDEFMKLNGFNFEDVDYSQDISIESLKSLKP
FT                   "
FT   gene            184368..186278
FT                   /locus_tag="VEA_000170"
FT   CDS             184368..186278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000170"
FT                   /product="GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000170"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52858"
FT                   /db_xref="GOA:D0M8E1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E1"
FT                   /protein_id="ACY52858.1"
FT                   /translation="MGRLQTLDYEIPESMQKSWQEIVNLLAQITHVPTTLIMRIHPDRI
FT                   EVNTSSETQGNPYRTGDTELLGNGLYCEHVIEHKSELMVPNALEDEEWCNNPDIKLGMI
FT                   SYCGLPLFWPNGETFGTICMLDSKKNEYSDTYRQLLGTFKDSIEAQLSVVYQQHKLQRL
FT                   NNELKNRVENRTTDLAQLSYSLTKEIDRRKAAEKQVSYQKTHDQGTGFLNRAALESVVG
FT                   ETLGTLDHSQQSLLVINIGFSNARSIQTRYGFEAFDEILKEFRYRLGKRESSYFVTGRP
FT                   SSNDLVLLIWGNDIDMKLRKLLDDITNIGLGSFYIKDTEVHLNSYIGVVQAHQTSNAKQ
FT                   LLQNACYAMLLCKESGEAYSYFCESHSNELNNHNQLESYLLQAVRNDDLMLYFQPKVHP
FT                   HTHKWIGAEALLRWRHPILGDVSNEALIHMAEQNGLIFEVGSFVLRTAIDKAKQWSELI
FT                   DNFKIAVNVSPIQLQNVNFAEQVQHLLESFHLPAHFLELEVTESALIADEIVARTTLNK
FT                   LHELGVTLSLDDFGTGYASFSYLKKYPFDAIKIDKSFVQQMEKSDDDRAIICSIIHIAK
FT                   KLDLQVVIEGIESPQQEQFLIGEGCDIGQGFLYGKPMPCNEFEQSLFNQRLSGGQYAYS
FT                   S"
FT   gene            186350..188005
FT                   /locus_tag="VEA_000171"
FT   CDS             186350..188005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000171"
FT                   /product="isopentenyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52859"
FT                   /db_xref="GOA:D0M8E2"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E2"
FT                   /protein_id="ACY52859.1"
FT                   /translation="MDQLTATLKKIEKQNYRAYQQIKGQYDFTDFTLFIDHVQGDPYAS
FT                   ASRFRATRAWSLTGLEWLKDESPAFQRAARDFIARSFELFAKQENSVSISLNGQTVLDS
FT                   TAVLFTEEGIELRFRVNLPAEGRSVLGKKANNILTFHLPKFIRRATLERELDKAALIEH
FT                   CQVVEDQDALRAQLEANNLVAFVANGSILPRIAGNCDLPMKEAVEFKAPESLQVTLHAP
FT                   NKGHVTGLGIPKGITLIVGGGFHGKSTLLNAIERSIYDHIPGDGREYIVADDKAMKIRA
FT                   EDGRCVHHLNLSNYINHLPMGKDTADFSTQDASGSTSQAAWLQESIEAGASTLLIDEDT
FT                   SATNFMIRDERMQALVAKGDEPITPLVDRIGQLRDDLDISTIIVMGGSGDYLDVADTVI
FT                   QMHDYQAVDVTEKAKEVIAQHPTQRHNESEERLQTFPPRALNRVALMNILTDGKFRVNA
FT                   KGKESLRFGKEFTDLSALEQIESADEVNTIGWLWFQIAQLPGWCNHPAKEIEEMLSGEW
FT                   HASLPKQGDLAKPRTLDVMAALNRMRKSQFKPSC"
FT   gene            complement(188088..188708)
FT                   /locus_tag="VEA_000172"
FT   CDS             complement(188088..188708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000172"
FT                   /product="DnaJ-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52860"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E3"
FT                   /protein_id="ACY52860.1"
FT                   /translation="MEGQRTVSSIETHAIENPLLWPMLEILRKQPSDWKVHTLASKLSE
FT                   QGYISKLDDSPDKDLFKRNFLIMNALYQLQETLYPDAWLQVEAMNIQLMSSLEASRHIV
FT                   DINDPLREYYLDWRNYEADEDEVRRLLNEFWTTYQKFIGGSSTVSVDKTKALSLFELNP
FT                   DATPAEIRKQWRKLALRWHPDRENGDAERFRILCEAWNVLRNE"
FT   gene            complement(188912..189751)
FT                   /locus_tag="VEA_000173"
FT   CDS             complement(188912..189751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000173"
FT                   /product="isopenicillin N synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000173"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52861"
FT                   /db_xref="GOA:D0M8E4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E4"
FT                   /protein_id="ACY52861.1"
FT                   /translation="MKLETVDYLADDAAQQFVTSLRETGFGVLKNHPIPQELVESIYKN
FT                   WHEFFCSDQKNDFHFNVDTQDGYFPPSVSEVAKGHKVKDIKEYFHVYPWGQIPEQLKAE
FT                   ILEYYERANAFAQELLGWVEAYAPKDVQEKFSIALSEMINNSDKTLLRVLHYPPMTGEE
FT                   EPGAIRAAAHEDINLLTVLPAANEPGLQVKSKEGDWIDVPCDFGNLIINIGDMLQEASG
FT                   GYFPSTTHRVINPTGGRQEKSRISLPLFLHPKPEVVLSERYTAHSYLMERLRELGVI"
FT   gene            complement(189789..189902)
FT                   /locus_tag="VEA_000174"
FT   CDS             complement(189789..189902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000174"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52862"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E5"
FT                   /protein_id="ACY52862.1"
FT                   /translation="MMVFLITKNVDLLPNCSTLKRLRVHFSLKFDLQHAHP"
FT   gene            189994..190590
FT                   /locus_tag="VEA_000175"
FT   CDS             189994..190590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000175"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000175"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52863"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E6"
FT                   /protein_id="ACY52863.1"
FT                   /translation="MKSTSTLLGLTVFYAIVFLFSALEPNSRAVWFAEIIPAIGILVAI
FT                   WVISIRYQFSNTAYLLMFIWLCLHTIGAKYTFSEVPFDWFNDMIGSDRNNFDRVAHFSI
FT                   GLYAYPIAEYLIHKNKFNKTFSCWFALFAIMSLAAGYEIIEWWYAELAGGDEGIAFLGS
FT                   QGDIWDAQKDMLCDTVGAALSLFLMSAQRRFSQPL"
FT   gene            complement(190552..190860)
FT                   /locus_tag="VEA_000176"
FT   CDS             complement(190552..190860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000176"
FT                   /product="periplasmic divalent cation tolerance protein
FT                   cutA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000176"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52864"
FT                   /db_xref="GOA:D0M8E7"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E7"
FT                   /protein_id="ACY52864.1"
FT                   /translation="MVLSTTSNEKNRDQIIKGLLDAQLAACIQTMPIESHYVWKGEICT
FT                   DNEWLLVIKTRRELYELVEEKIENLHEYEVAQIVQVPIVDGFNPYLEWLRKSTLSRH"
FT   gene            complement(190899..191150)
FT                   /locus_tag="VEA_000177"
FT   CDS             complement(190899..191150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000177"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52865"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E8"
FT                   /protein_id="ACY52865.1"
FT                   /translation="MAKPNKKQPTKTVDIYCSKCKTQLFKYRKGGKGALVKCFKERIVD
FT                   DFTQTPCTCPSCGQEFARDTLVRGTPAYKMIGGKVTMK"
FT   gene            complement(191134..192843)
FT                   /locus_tag="VEA_000178"
FT   CDS             complement(191134..192843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000178"
FT                   /product="SgrR sugar-phosphate stress transcriptional
FT                   activator of SgrS small RNA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52866"
FT                   /db_xref="GOA:D0M8E9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8E9"
FT                   /protein_id="ACY52866.1"
FT                   /translation="MSSPRLRVQFETLFEKFAGHDTDVQLEDITEALFCTRRNARIVLN
FT                   KLEEEGWIEWHPAAGRGKLSKLVFKRNRSDVSENLARRYLDEGKIGQALDALDNDAARL
FT                   TQVIQGYLGLQHRQGEQVVRLPYYRPLAMLNPQKPMRRSEQHIARQIFSGLTRLDENEQ
FT                   LQPDLAHTWEAISDTHWRFYLRRGVRFHNGEPLSTSCVLESVLALSSLNLFSHIKKVSS
FT                   PQEWTVDIELVRPDRYLPLALSESQAKILLPSALRSENFDRQPIGTGPFQVKMNDDKRL
FT                   ILTAFDGYFGFRPLLDQVEVWVIDEAYSSMVYPSLSKPKMDKQGSSDEVELDPGCTFLL
FT                   LNKNTGIAKDPRWAEFLSQTLNSHQIYAHVPQDKVMELGVLQAFGLKPGWIDLRPAEAG
FT                   SVPQADKVISVAYQKKHPMFPVVAKAIKTLLKPHGIEVEFIRYDSQPPAPEEVDIWVKA
FT                   MGIATNRNDALAGWLLDYSDIEKFSSGYDFSEWAKLVDQWRAGVYPDFPARELGRQLVK
FT                   SCQVIPMFHCWLGVNKDHSGALQNAKCNALGWFDFNNVWVKPDIEMNHGETE"
FT   gene            complement(192923..193156)
FT                   /locus_tag="VEA_000179"
FT   CDS             complement(192923..193156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000179"
FT                   /product="phosphotransferase system IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000179"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52867"
FT                   /db_xref="GOA:D0M8F0"
FT                   /db_xref="InterPro:IPR021811"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F0"
FT                   /protein_id="ACY52867.1"
FT                   /translation="MVIEFSLGKIIATQREIVIKLSGSAMVTLQAQTDSIQLLGRGANV
FT                   VLSHGAECKWSMKLDNEEQLADLAREIGIDIQ"
FT   gene            complement(193163..193597)
FT                   /locus_tag="VEA_000180"
FT   CDS             complement(193163..193597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000180"
FT                   /product="phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000180"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52868"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F1"
FT                   /protein_id="ACY52868.1"
FT                   /translation="MSIWKKPVSIEILNATSKNTLIEHLQIEYTDFTDDSLTATMPVCS
FT                   FTHQPLGMLHGGASVVLAETLGSLAANFSVDEGSYCVGLDINANHVRAMRSGHVIGTAK
FT                   PVHLGVSTQVWQIDITDERGRLVCTSRLTIAVKQHKTKSV"
FT   gene            193801..194589
FT                   /locus_tag="VEA_000181"
FT   CDS             193801..194589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000181"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000181"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52869"
FT                   /db_xref="GOA:D0M8F2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F2"
FT                   /protein_id="ACY52869.1"
FT                   /translation="MKVWMKASALLTIAGLTACSASPTGRNQILMFSDQEMSSLGAKSF
FT                   EQMKKDIPISKDRKTNAYVQCVAKHITDTIPAQAGFKDWEVVVFDSEQVNAFALPGGKI
FT                   GVYTGLLGVAKNQDQLATVIGHEVAHVLADHSNERLSQSQLANAGLSLANVAIGASEYK
FT                   QYQQMTMAALGVGVQYGVILPYGRTQESEADIVGLEFMAKAGFDPRQSVDLWKNMSAAS
FT                   GGSQPPEFFSTHPSHSTRIKDLQATINKLPAYNAKAPKCG"
FT   gene            complement(194663..195745)
FT                   /locus_tag="VEA_000182"
FT   CDS             complement(194663..195745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000182"
FT                   /product="Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000182"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52870"
FT                   /db_xref="GOA:D0M8F3"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F3"
FT                   /protein_id="ACY52870.1"
FT                   /translation="MELLNVEFLGRSLRLEGSMAGWQQLYWDNTLVSQIDASDNVADTC
FT                   LHQFRLSAGEEVLVCHLECSLTWQPFELSYKVTINDELISEGCRNEKDIERQVPEVEPP
FT                   TEKRLSVIGLVSLGMKALKSAKVIKVALASASLAAYSWLFSIEFALALIACLVFHEYGH
FT                   IRAMKYFGMKTKGIYLIPFLGGLALSDEKINTRWQDVVISIMGPFFGLVLSIAFTLLYW
FT                   MTGEVLFAGLAVFNALLNLFNLLPILPLDGGHVLKSITFSMNTWVGLVGSIAAAFLGIF
FT                   ISYSFGLTLLGFLLLMGMLEVVMEWRGRHHSHLLPLTRYGQLFSLAWYLVSVGGFVAII
FT                   WYFATLGDSLLSLPLQILGT"
FT   gene            196115..197359
FT                   /locus_tag="VEA_000183"
FT   CDS             196115..197359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000183"
FT                   /product="long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000183"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52871"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F4"
FT                   /protein_id="ACY52871.1"
FT                   /translation="MNKKHCSLLTISILFACNAHSAGFQVAEHSASGLGRAFSGEGAVA
FT                   DNASVLARNPAAMTLFKEAQFSGALSIIDPEVDVYDTVNKEHAKDVAPLQVVPAGYYIS
FT                   PINDNWAWGIGMFTTYGVATDYPDDISAGDMAGDTSLLSVNINPNVAYRINESFSVGGG
FT                   INLVYAEAELTRHKGALARILGGNKSDNLVGMEGETFAWGWNIGALYELNENNRFGFGY
FT                   RSKVDLDFDDGEFSSYDSGRAPSPKVDGRLKISLPSIIELSAFHQLNEQWAVHYGWQQT
FT                   DWSTFKELKATSPQCNDGTAGQCFYKPEKYEDNNRYSIGATYTLNADWTFRAGFAYDEQ
FT                   AGEATLSIPDSDRFWYSAGLTYAMNENLTFDAGFALVKSKSGSFTETNAQDEEIKFDSE
FT                   GTAYISAVQMNYTFK"
FT   gene            197380..199788
FT                   /locus_tag="VEA_000184"
FT   CDS             197380..199788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000184"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000184"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52872"
FT                   /db_xref="InterPro:IPR020009"
FT                   /db_xref="InterPro:IPR025920"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F5"
FT                   /protein_id="ACY52872.1"
FT                   /translation="MKHTFKLSMLCSAILLAGCGDNTSSSGTSDKVQFEDEVQALLDRG
FT                   TSISFTLQGANADVPAPSYLLMDTTDGTLGLPTDGDDALTNPRASMNTMDGWSTSMPIV
FT                   LNFKGDGFATGMLPSGIKVIKINQRLTEWDGKSNPIEEVLVQNQDYVVQAKGNSLYIQF
FT                   MDALDESSEYIFAVTQDVTDVNGEPIGTSASYATGKSKEIVYETGALASIQAVTQAVEG
FT                   IFGLAQVNPDDIVYSSWFSTQSVGDTLAAVKGVTATGFSTGANTLNAVYKNDANEGSVD
FT                   LSTAYTMTLGATQDFSTALDSDDDFSKYVSDLDAAKTAIKGLYAKSGADVNVTQGVVRL
FT                   PHYLEKGANWNMQPMVSAMPSLAKLSAALADPNEQANMVQQLSTGVFANNPVDVTKLAT
FT                   DPTEQLKLVGAKLTLSDGTQLDSERIVTRYSPVPVVKSVEDVEVLVFTPKSGVATDVVI
FT                   YQHGITSAKEDSYAFAFNMVKAGVAVIAIDLPIHGTRSLDEQRSANANILAYLNLSNLA
FT                   IARDNLRQSVLDVLGLRASLVVSAQGGLLAEGPLQGFNPMTGSKVKMLGHSLGGIVATS
FT                   AVAAANNTLGSPNADALYTFSSASVQNSGGQIGNLLLGSEAYGAQIRHNLAYAASADYA
FT                   SYADASCTQLEDKTCYEAFEAAATETQLATLEAGFSQFIYAAQTTLDTVDPFTNASDLV
FT                   ASGSLTTPFLMTEVDGDGNVPNSVPNAPFAGTEPLAAKLGLTTVNSANTAVSPMASFVQ
FT                   YNATASHITFVSPNGTLSDIDHHVEMQMENTDFLMDDTLTGVTNTSVLK"
FT   gene            199989..200132
FT                   /locus_tag="VEA_000185"
FT   CDS             199989..200132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000185"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52873"
FT                   /db_xref="InterPro:IPR010305"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F6"
FT                   /protein_id="ACY52873.1"
FT                   /translation="MSTNEGKIITSYGKPDLNEETGMYEYEDMDGKEMSISKDQIVQII
FT                   ER"
FT   gene            200422..200979
FT                   /locus_tag="VEA_000186"
FT   CDS             200422..200979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000186"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52874"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F7"
FT                   /protein_id="ACY52874.1"
FT                   /translation="MSIEATLLARCESKCELCSSESQLTAYAVPPHGNVTVDTAIMVCD
FT                   KCLGEIDEPKDINHWRCLNESMWSQVPAVQVTAWRQLTRLNSESWAQDALDMMYMEEEQ
FT                   MNWAMKGMSDDDKTLDCNGTELKKGDDVTVIKDLPVKGTNQVIKQGTVIRGISLGDDPK
FT                   LVSGKANGGQSMYVIAEYCRKK"
FT   gene            complement(201171..201362)
FT                   /locus_tag="VEA_000187"
FT   CDS             complement(201171..201362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000187"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52875"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F8"
FT                   /protein_id="ACY52875.1"
FT                   /translation="MAQAMQMTNVALPTSMDKKTYAVNFKGLIAHLLDILFVDNTAPRS
FT                   YYAEDLSAHIQKDIGMYR"
FT   gene            complement(201641..202660)
FT                   /locus_tag="VEA_000188"
FT   CDS             complement(201641..202660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000188"
FT                   /product="membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000188"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52876"
FT                   /db_xref="GOA:D0M8F9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8F9"
FT                   /protein_id="ACY52876.1"
FT                   /translation="MSLIESTTQLSQSAPLQESLAMYGAFGLFTLVLVALDIYQTRGGV
FT                   ITMKKAILWSVFWFLLAFVFAGSIYLFWDFYAPHSTYTNDKATVSFLTGYLLEKSLSVD
FT                   NLFVFAIIFAQYSVPEHLRPRALLWGVIGALVLRAIMIAVGAQLLAQYHWVLYLFAAFL
FT                   IWTGIKLARDKGEAEEVNPYPEQFIRRILPVTDDYQGNHLILKQAGKWVATPMLIVVGV
FT                   IAVMDVMFALDSIPAIFAVTREPFLVLAANVFALLGLRSLYFVLQAMLDKFVYLKPALS
FT                   VIMMFIGVKMLLVGTEYEIPTTWSLTFLIVVMTSAVVASLLKNKSNSRSSVKITNQKI"
FT   gene            complement(203287..205023)
FT                   /locus_tag="VEA_000189"
FT   CDS             complement(203287..205023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000189"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000189"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52877"
FT                   /db_xref="GOA:D0M8G0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G0"
FT                   /protein_id="ACY52877.1"
FT                   /translation="MNNNHKPVRIKLAHINDTHSYFEPTSLQLKLKINNELTLEPYVSA
FT                   GGFSRIATRVEQLRDDAQRQGHGMLFLHAGDCFQGTLYFSLFKGKANADLLNALKIDAM
FT                   ALGNHELDMGNEPVALFCQRTQFPLLAGNWDLSNESLQKPHRVSDSNNVYSYQTETQSA
FT                   QYIVKEFHGEQVAIFGLSIDKMSDIANPDADTPFKSAIETAKATVKQIHYSGIKNIILL
FT                   SHLGYEGDLELAEQVEGIGIIVGGHSHRLQGDFSSIGLGQDDPYGVKVKDTYVVQAGFH
FT                   ALTMGHCVIEFDENGKATMLSGQNELLLGRRIFWDSTLNQQLDQGVFETACDFIHGQPN
FT                   VVVCKKHPETQAILSDKYIPRVRQLQSQVIASIDTKKRHVRIPDEFGESELASSVARSF
FT                   LYSLNKRGHEVQFAIHNAGGVRTSLNPGNITVADIAGRLLPFAVPIGFYDVKGRAIRRA
FT                   LEGAINNALNNDVEGTGSGSYPYTYNLNFEYRADAPKGERIQSLAIFDGQQWVDVQDDT
FT                   WYRGTSSAYTMKGKEGYDALLEMKGEGRVTNLSMADCFIELLTDEPSCLNQSHKLYTQQ
FT                   HR"
FT   gene            205301..206935
FT                   /locus_tag="VEA_000190"
FT   CDS             205301..206935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000190"
FT                   /product="ATP-dependent endonuclease"
FT                   /note="predicted ATP-dependent endonuclease of the OLD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000190"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52878"
FT                   /db_xref="GOA:D0M8G1"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G1"
FT                   /protein_id="ACY52878.1"
FT                   /translation="MRLERIEISGFRGIKRLSLSFDELTTLIGENTWGKSSLLDALSIA
FT                   LPANGSLYQFELKDFHVDYSISHPQTQHLQIIVCFKAQDKNEVKAGRYRRIKPAWCTNE
FT                   DGEQVIYYRISASRDEYDIKTEYAFLDHNGKPKKLHHSEKLAVELMTLHPVIRLRDSRR
FT                   FPDLNHVNGDSKNARIEKRINNTCRRLLAMPGHVNKGEIRSSLDSMQTLVEHYFAFRSV
FT                   SKGNPRKPRDGLFYTSPSSDKGLSQFLKETNDKQSRLLLMGLLNAYLQAKGPTDLRRCA
FT                   RPILIIEDPEGRLHPTHLARAWSLLQLLPMQKILTTNSGTLLGSVPLYSIRRLIRLSDR
FT                   TIAKSLNSAKFGRDELRRIGFHIRFHRSGALFARCWLLVEGETEVWLFHELARQCGYDL
FT                   AAEGVQIVEFAQSGLKSLIKVAKEFGIDWHVVTDGDPAGKKYAHAVRAQLDHDQERHRL
FT                   TELPDRDIEHFLYNHGFELFFKDIIKVPHDHPIPAKKVVNRVLKKHAKPDLALAIVSHC
FT                   EERGMECIPVLLRWTLKRVVTMANGNT"
FT   gene            complement(207087..207569)
FT                   /locus_tag="VEA_000191"
FT   CDS             complement(207087..207569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000191"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52879"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G2"
FT                   /protein_id="ACY52879.1"
FT                   /translation="MTTLLAISITTGILSGVWGWIAISLGLLSWAGFLGCTSYFAAPTS
FT                   GLKGLGISLITNMTGVFWAMVIIHGSTYVGLEIIGYVITAIVAFFMCIQAKQAWLAYIP
FT                   GTFIGSCATFAADGNWQLVIPSLLLGGVFGYLMKATGLWLHTKSSTTSSTLAEQAQ"
FT   gene            complement(208012..208917)
FT                   /locus_tag="VEA_000192"
FT   CDS             complement(208012..208917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000192"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52880"
FT                   /db_xref="GOA:D0M8G3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G3"
FT                   /protein_id="ACY52880.1"
FT                   /translation="MRYSLKQLAVFDAVADTGSVSQAAEKLALTQSATSMSLAQLEKML
FT                   GRPLFERQGKQMALTHWGMWLRPKAKRLLQDALQIEMGFYEQHLLSGEIRMGASQTPAE
FT                   HLVPDLISIIDNDFPEMRISLGVQSTKGVIDGVLDYKYDLGIIEGRCDDNRLHQEVWCR
FT                   DHLTVVAASHHPFARNQSVSLAQLEQAKWVLREHGSGTRKTFDSSIHHLIEDLDVWREY
FT                   EHVPVLRSLVANGQYLTCLPYLDVERYIEADHLVALNVPELKMERTLSFIWRADMAENP
FT                   LVDCIKREGLRMMKGKPSVL"
FT   gene            209222..210673
FT                   /locus_tag="VEA_000193"
FT   CDS             209222..210673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000193"
FT                   /product="formate efflux transporter"
FT                   /note="TC 2.A.44 family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000193"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52881"
FT                   /db_xref="GOA:D0M8G4"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023999"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G4"
FT                   /protein_id="ACY52881.1"
FT                   /translation="MAVTSSQNHQYFSPKEMMAEAEKFALSKANKTSSMTLSLAIMAGA
FT                   FIGLAFLFYITVTTGSAGAGWGLSRLAGGLAFSMGLILIVICGGELFTSSVLSSISWAN
FT                   KQISFGKMLSIWGKVYVGNFIGAMFLLALVTAAGLYQMDSGQWGLNALNIAQHKLHHTL
FT                   IQAFALGILCNLLVCLAIWLTFSSANAMTKAAMTIMPVAMFVSSGFEHCVANMFMVPLG
FT                   IVIANFAPESFWASVGVPASQYADLNIGHFITANLIPVTLGNIVGGAVLVGLANWCIFR
FT                   RPELKAANISSITTTTTLSSVKDFTMKNASFVKDIMNPKPVTISAETPIAIALDVLLDN
FT                   NVTSAPVVDVQNRLVGFFSAHDVMVELWCEDYIPVKDQKVVDIMSRDVVAIDAGDRLVD
FT                   VVEFLCIDKEQLYPTSSMGIATRMTSLSLEERAKSIKVSKPQVLPVLENGQMVGVVTRT
FT                   EVLKALRPIFGERLNLVEKNELETA"
FT   gene            complement(210812..211342)
FT                   /locus_tag="VEA_000194"
FT   CDS             complement(210812..211342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000194"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52882"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G5"
FT                   /protein_id="ACY52882.1"
FT                   /translation="MALPFGAQAADYVIDTKGAHASINFKVSHLGYSFIKGRFNTFSGD
FT                   FSFDENNIADSKVNVVVDTTSLDSNHAERDKHIRSGDFIDAGKYSEATFKSTKVVDKGN
FT                   GKLDVTGDLTLHGVTKPITIEAEFVGAGSDPWGGERAGFVGNTRLELADFDIPVMGASS
FT                   YVDMELHIEGVKK"
FT   gene            complement(211378..211917)
FT                   /locus_tag="VEA_000195"
FT   CDS             complement(211378..211917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000195"
FT                   /product="cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52883"
FT                   /db_xref="GOA:D0M8G6"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G6"
FT                   /protein_id="ACY52883.1"
FT                   /translation="MDTLVKNYNLTARVMHWLSALCIIGLFAVGLWMVDLSYYSEWYRT
FT                   APHYHRSVGILLAILTLARIVWKHVTASPKVEGKPYEVLAAKAAHGVMYLLLVTIFVSG
FT                   YLISTSDGRGIEVFNWFTVPGAGELFPGQSDIAGEIHFYAAWAVILIAGLHAIAALKHH
FT                   FIDKDNTLRKMLGASK"
FT   gene            complement(212092..212334)
FT                   /locus_tag="VEA_000196"
FT   CDS             complement(212092..212334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000196"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52884"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8G7"
FT                   /protein_id="ACY52884.1"
FT                   /translation="MIKLERAQKETLATAIQDYMQDELDVEIGQFDSAFLIDFITEKLG
FT                   PIYYNKGVEDAKSLVERRMLEVSEELYEIEQEVKL"
FT   gene            212521..213153
FT                   /locus_tag="VEA_000197"
FT   CDS             212521..213153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000197"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52885"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L1"
FT                   /protein_id="ACY52885.1"
FT                   /translation="MLLDLVIQSVNDFQDDCLKLCEKHYPAVHNQGMSEHHLGLAFSRR
FT                   MEHTFRHFGYNSVVKPIEVLNTPDLPHHYRISSEIGTVWVLSHHMVSAGKSCRENLLSS
FT                   ITEWQSEYGYALQPNDLLFLVCDHWISRSKTSRELLHWWMGELPDQINEYTEQGITLYT
FT                   SESQLTQSLDTRFGISPCYIKFGHPLRRSNKQQLVRKYLQLYAVLQW"
FT   gene            213340..214128
FT                   /locus_tag="VEA_000198"
FT   CDS             213340..214128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000198"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000198"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52886"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L2"
FT                   /protein_id="ACY52886.1"
FT                   /translation="MMSTSQLLSCIRKQADGQYIAKYAKLTLRSVFQPIYKKDISIVGL
FT                   EALVRITNANGTMIRPDQFFQSKTIAAQDLLNVERLSRLIHIKNFAQSHFHNKQLFLNV
FT                   LPEAAKILARDITYNRLLKQTIYQSHLVNEQIVMELLELNVEDESSLSQAARELSQGGF
FT                   KLAIDDYGVNASTIERVKGVRPDIIKMDRSLMLRYENGDWKALVDALSLARTLRSKTVI
FT                   EGIETEHQLNLMKKLGFDMYQGYLLAIPQTLDVYEEAKTA"
FT   gene            complement(214156..215415)
FT                   /locus_tag="VEA_000199"
FT   CDS             complement(214156..215415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000199"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000199"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52887"
FT                   /db_xref="GOA:A7K2L3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L3"
FT                   /protein_id="ACY52887.1"
FT                   /translation="MSVNFADLGIEQKLIETLSNLNIVTPTPVQEKSIPHVLEGKNLLA
FT                   AAQTGTGKTAAFGLPIIQTVQQKKLNGTPQALVLVPTRELAQQVFDNLNQYSAQTELRI
FT                   VCVYGGTSIGVQKRKLEEGADILIATPGRLLDHLFNGNVNISKTSMLVLDEADRMLDMG
FT                   FWPDLQRIFRRLPAEKQILLFSATFEKRIKTIAYKLMESPVEVEVSPANTTAETVKQMV
FT                   YPVDKKRKRELLAYLIGSRNWQQVLVFTKTKQGSDELAKELKLDGIKAVSINGDKSQGA
FT                   RQRALDEFKQGKVRALIATDVAARGLDIQELEQVVNFDMPFKAEDYVHRIGRTGRAGKS
FT                   GLAVSLMSRDEEYLLHAIENLLDQRLPQEWLAGFEPTLIEEVEPEKNGSGRRRSRSSEK
FT                   RKLKAKLAIHKNRGKSRNSR"
FT   gene            complement(215483..216085)
FT                   /locus_tag="VEA_000200"
FT   CDS             complement(215483..216085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000200"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52888"
FT                   /db_xref="GOA:A7K2L4"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L4"
FT                   /protein_id="ACY52888.1"
FT                   /translation="MNFLAHLHIADHCNSHLLGNLLGDFVKGDPSKLYERDISNGIKLH
FT                   RFVDRITDHHPIVNECKPHFKGTARRFAPIALDMFWDHCLAKHWDDFYAVSLEHFVDSA
FT                   YERVNRDVNEHLPPRFLVLHSRMWQGRWLQSYQDLDSIEFALHRMSQRSPRMADLTTTF
FT                   KVIESDYTVLEEKFSTLYRDVLRQSYDFQQQLIDSVQ"
FT   gene            complement(216167..216337)
FT                   /locus_tag="VEA_000201"
FT   CDS             complement(216167..216337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52889"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L5"
FT                   /protein_id="ACY52889.1"
FT                   /translation="MDMARPSRQQVQARELKIKEVTMSDQYQNDESLELLDALEIGIIL
FT                   SEYVGSDNEAE"
FT   gene            216654..218084
FT                   /locus_tag="VEA_000202"
FT   CDS             216654..218084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000202"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000202"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52890"
FT                   /db_xref="GOA:A7K2L6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L6"
FT                   /protein_id="ACY52890.1"
FT                   /translation="MREVEFRTIDRLFIKMSINDKMWVIFLLFLVALTSVAGSRYFNEI
FT                   QQFKQQAISASEAKLSGIVDAQPGHVPQIDGVSKSSRVSEGSFVDGSVTAYANLHSGEV
FT                   IKLTQNVSAQYESAKSSALTSLLLSFLWVVPFALFSYWVATFIGGALWVLYTTTEKIGE
FT                   GDLTSRLGFHPGRDEFGTIGCALDKSMDTLSELVNSVKNNAATLSETSSAFEKDMQLSE
FT                   TQISHQYQTLDSVATAMEEMTASAKEVSNISQQATMQSDQDAQKIELSRNRVQNVIGEI
FT                   ETLSSYIEQASTSVTNLNENTTQINDVITTINAISEQTNLLALNAAIEAARAGEQGRGF
FT                   AVVADEVRTLASRTQQATVEIQAMIEKLQTESQNIASITDRTVQQAQTSSQLIDEIGHD
FT                   VTSIAESARSLMDMSIQISTSAEEQSAVANDIASELSEIRSQSSTIREVAEQSTVGVAN
FT                   LTQASVSLGEVLHRYRTA"
FT   gene            218053..218190
FT                   /locus_tag="VEA_000203"
FT   CDS             218053..218190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000203"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52891"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L7"
FT                   /protein_id="ACY52891.1"
FT                   /translation="MRYYIATAQHNFAAFMINKGSSGALFFKPFSAVIVDIFYYTQVDI
FT                   "
FT   gene            complement(218514..219182)
FT                   /locus_tag="VEA_000204"
FT   CDS             complement(218514..219182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000204"
FT                   /product="putative phosphatase YieH"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000204"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52892"
FT                   /db_xref="GOA:A7K2L8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L8"
FT                   /protein_id="ACY52892.1"
FT                   /translation="MAITNIKCVIFDCDGTLVDSERLCCQALVNVFNLHGAELTMEECV
FT                   SHFKGGKLADILLDTKELKDIKVPIDVLEPQYREEVQSLFVRHLQPMDGAKRLIQFLDS
FT                   HNIEYCVASNGPKDKIEYALELTGLLDAFQGKVFSAFDANSWKPEPDLIMYSAMSMGFL
FT                   PSDCLYIDDTPKGVEAGLNAGIKTVQLFNGEAINRVDDERVIRIQHLDELKEQLFSCSV
FT                   "
FT   gene            complement(219377..219886)
FT                   /locus_tag="VEA_000205"
FT   CDS             complement(219377..219886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000205"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52893"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2L9"
FT                   /protein_id="ACY52893.1"
FT                   /translation="MNEQQLASIERKNTWLYDLVEVEFPTPESLKGRDVYFKALEQATY
FT                   QVVDKDTLLESNSEFSSDDIFLVDFHRLTIMFSVLQSQRWDQQYDKDMIVEYLTQIILT
FT                   PDFELYVGFKSGAPIGAAIISHLEGNTLISDVAVSESKYKSSFVADLAKRLSTEHKLLD
FT                   SVIIES"
FT   gene            220149..220619
FT                   /locus_tag="VEA_000206"
FT   CDS             220149..220619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000206"
FT                   /product="CreA protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52894"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M0"
FT                   /protein_id="ACY52894.1"
FT                   /translation="MKKMLLSALLATTLVGCSDNDVADVGLGWFTLKDIKVGELKDEVV
FT                   TGVTCHIASIEADFSLADPSDSSISCRQTGEITPEMIAKIDKSKSGEIVFKKSKSIFFK
FT                   TMKVRRIYDADNQTLLYLSYTTKETDGSFKHSLSTVPLWGTKAYVEPTEVKK"
FT   gene            220840..222144
FT                   /locus_tag="VEA_000207"
FT   CDS             220840..222144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000207"
FT                   /product="inosine-guanosine kinase"
FT                   /EC_number="2.7.1.73"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52895"
FT                   /db_xref="GOA:A7K2M1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M1"
FT                   /protein_id="ACY52895.1"
FT                   /translation="MKFPGQRKSKHYFPTHARDPLVNQIRQAPKLYRPTIVGVGQTIVD
FT                   IEARVDDAFLEKYNLSKGHSLVLEESKADALYEELVEQGLITHQYPGDTIGNTLHNYSV
FT                   LADSKSVLLGVMSKNIQVGSFAYRYLCRTSSRMNLNHLQTVDGPIGRCYTLISQDGERT
FT                   FAINEGHMNQLLPESIPEEIFEKASALVVSSYLMRGKEEDPMPRAVQKAIDFAKKHDVP
FT                   VVLTLGTKYVIEGNAQWWQEYIRENISVVAMNEEEGAALTGETEPLAAADKALEWVDLV
FT                   LCTAGPNGLYMAGYTDEKVKRETTHDILEGSIEAFNQYEFSRAMRKGDCEKPMKVYSYI
FT                   GPYLGGPLEIKNTNGAGDAALSALLHDMAANSFHQKEVPNSEKHEVRCLTYSSLSQICK
FT                   YANRVSYEVLTQHSPRLSRALPEREDSLEETYWDR"
FT   gene            222381..224129
FT                   /locus_tag="VEA_000208"
FT   CDS             222381..224129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000208"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000208"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52896"
FT                   /db_xref="GOA:A7K2M2"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M2"
FT                   /protein_id="ACY52896.1"
FT                   /translation="MQSDIEICRNTPLSSIDVIAEKVGLLPEEYDTHGRHKAKVHPKCL
FT                   ERLKENDNGKLVLVTAITPTPLGEGKTVTTVGLAQGLAKLRQSVIACIRQPSMGPVFGI
FT                   KGGAAGGGYSQVAPMEELNLHLTGDIHAVTAAHNLASAALDARLYHEQREGYDAFEART
FT                   GLKALKIDTASITWKRVMDHNDRALRKVKIGLNEPGKVINGYERDEGFDISAASELMAI
FT                   IALAKDLKDLRQRIGKIVVAYDLNGNPVTTEDLQVAGAMAVTLKEAIAPTLMQTLEGVP
FT                   TLIHAGPFANIAHGNSSIIADDIALKLSDYTVTEAGFGSDMGFEKACNIKAAAASKAPD
FT                   CVVIVATLRGLKANSGHYDLRPGMAIPDSIFNPDQAALEAGFENLKWHINNVHKYGIPA
FT                   VVAINQFPQDCEKELKILKELVQQFNPEVKVAISTAFAQGGQGTTQLAQHVIDACTQPT
FT                   EFRPLYNKEQSLREKLMAVCEAGYGAANIEMSSLATEQLNHFENLGFNNLAVCIAKTPL
FT                   SITTDSAVKGAPTGFTVPIRELRLCAGAGFVYALSGTVMTMPGLPDKPAFMNLDLDDEG
FT                   NIVGLS"
FT   gene            224540..225757
FT                   /locus_tag="VEA_000209"
FT   CDS             224540..225757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000209"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000209"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52897"
FT                   /db_xref="GOA:A7K2M4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M4"
FT                   /protein_id="ACY52897.1"
FT                   /translation="MEDALAVILAGGMGSRLSPLTDDRTKPAVPFGGKYRIIDFTLTNC
FT                   LHSGLRKILVLTQYKSHSLQKHLRDGWSIFNPELGEYITAVPPQMRKGGAWYEGTADAI
FT                   YHNMWLLSRNDAKYVVVLSGDHIYRMDYAAMLEEHKEKGAKLTVACMDVPVEDASAFGV
FT                   MGTAENGLVTSFIEKPECPPTLPGSKTRSLVSMGIYIFDMDVLKEALEDDSKLDSSSHD
FT                   FGKDIIPKLIDTESVYAYQFCGSKGRVDKDCYWRDVGTIDSFYEANMDLLEPVPPMNLY
FT                   QSNWAIRTYEPQFPPARTVSSATGNEGIFINSIIATGVINSGGSVQHSIISSNVRIQDS
FT                   ATVVDSIIFDDVEVGEGSQLVNCIVDKHVRIPPHTQIGINKLEDAKRFKISDKGIVVIP
FT                   ESYQFD"
FT   gene            complement(225856..229020)
FT                   /locus_tag="VEA_000210"
FT   CDS             complement(225856..229020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000210"
FT                   /product="chitodextrinase precursor"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000210"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52898"
FT                   /db_xref="GOA:A7K2M5"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR009470"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M5"
FT                   /protein_id="ACY52898.1"
FT                   /translation="MHLKNGNAVKSVFTLSTLTASCLMAFNSYAAVDCAPLETWQSSKV
FT                   YNGGDQVQHEGNAYKARYWTQNSNPAQSGEWGEWETLGACDGTGPVDPPQNEVPTVTLT
FT                   SPSASASVTAGDVVNLAADAVDTDGTVSKVEFFVDGVLVGQATSAPYAASWTATEGQHE
FT                   FSTKAYDDAGAVSTASAVTLTVAPAQPGNEAPTVDVALSATSIDLGGSVTLTANAADAD
FT                   GTVAKVDFYVAGVLAGTATTAPYTLDVMPSQAGSLSVYARATDDAGATADSALATLTVN
FT                   GGAVTSNCRPDGLYQTTGVDVPYCSIYDEEGREKMGADHPRRVIGYFTSWRAGEDPQST
FT                   YLVKDIPWEQLTHINYAFVSIGSDGKVNVGDVNDPNNPATGKTWPGVEVDPALGFKGHF
FT                   GALATYKQKHDVKTLISIGGWAETGGHFDTNGNRVADGGFYTMTTNADGSINHAGIEKF
FT                   ATSAVEMMRQYKFDGLDIDYEYPTSMAGAGNPYDKDFMEPRRQYLWASYQELMKVLREK
FT                   LDAASAQDGIHYMLTIAAPSSGYLLRGMETFDVTKYLDYVNIMSYDLHGAWNDHVGHNA
FT                   ALFDTGKDSELAQWNVYGTAAYGGIGYLNTDWAYHYFRGSMPAGRINIGVPYYTRGWQG
FT                   VTGGENGLWGRAALPNQAECQPGTGEGEKNNCGHGAIGIDNMWHDTDPKGNEMGAGSNP
FT                   MWHAKNLENGIWGSYAAAYGLDPVNDPSDKFVGTYTRHYDSVAVAPWLWNAEKSVFLST
FT                   EDKASIEVKADYVIDKEIGGIMFWELAGDYNCYVLDANGNRTAVDATEQACAAGNGEYH
FT                   MGNTMTKAIYDKFKSATPYGNKVATGPTPTEAVDITVSVGGFKVGDQNYPINPKITFTN
FT                   NTGQAIPGGTEFQFDIPVSAPDNAKDQSGGGLKVIASGHTRANNIGGLDGVMHRVSFSL
FT                   PAWKDLPAGGTYELDMVYYLPISGPANYSVISGGKEFAFKFEQPELPIGDLNAGSGDGG
FT                   TTEPGTCDTTGLVTYPALPQTDWAGNPSHANQGDKIIHNGVVYQANWWTAAEPGTDGSW
FT                   STVCNI"
FT   gene            complement(229298..230179)
FT                   /locus_tag="VEA_000211"
FT   CDS             complement(229298..230179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000211"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000211"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52899"
FT                   /db_xref="GOA:A7K2M6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M6"
FT                   /protein_id="ACY52899.1"
FT                   /translation="MHTLADIMQQYVENQGLHDLEGMKKTAIDGVWFYRSSKGNHRQPF
FT                   VYQSGIIVLGQGHKNIHIGDTPVQYGPDDYLVVGVPMPLECEAFATNNEPLLGISIDIS
FT                   PTLLHKLVKKLEAEKFSNKCLDTTRCGLKSVHMSEGMLDACKRLMSALCNELDVVMLGD
FT                   LLLEEIVYRTLVSKEGYVLFDLAHQEGSYARVAKALNRVHQAYHEQLSVQTLAEEANMS
FT                   VSAFHQAFRNVTLESPLQYIKKVRLNKARELIQLEGRRVNDAARLVGYTSPSQFSREYK
FT                   RHFNETPRSTKA"
FT   gene            230386..231534
FT                   /locus_tag="VEA_000212"
FT   CDS             230386..231534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000212"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000212"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52900"
FT                   /db_xref="GOA:A7K2M7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M7"
FT                   /protein_id="ACY52900.1"
FT                   /translation="MNFSYVNPTKIFFGQKQIAAIKEAIPSDQKVLVVYGGGSIKKNGV
FT                   YDQVSEALEGHEWLEFSGVEPNPTKETLDKAVAMVKEHGVDFILAVGGGSVIDGSKYVA
FT                   AASKYDGDGWDIMIGKHQVTEATPLAAILTLPATGSESNMGAVITKKETQDKLPFMSPA
FT                   VQPKFAVLDPDVMKTLPERQLINGIVDAWVHVCEQYLTLPTGAMVQDGYAETLLKTLKT
FT                   LGEQFAERDDDMWRANLMWSANQALNGLIGSGVPQDWATHMIGHELTALWGVDHARSLA
FT                   IVQPSLLRNQMQFKRPKLEQMGRNVFGLEAGDDLAERTIEAIEAFYHQLDVATKLENYG
FT                   ESREQAIDAIIEQLNKHGMTVLGENQAITLERSREILELAVA"
FT   gene            231831..232478
FT                   /locus_tag="VEA_000213"
FT   CDS             231831..232478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000213"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000213"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52901"
FT                   /db_xref="GOA:A7K2M8"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M8"
FT                   /protein_id="ACY52901.1"
FT                   /translation="MWLVVVVLAFIHIISIRKGPKWLFYVSKPLPVLCMLGILIQSPAY
FT                   HMPYTHWILIGLSLSLLGDLLLMLPRDKFITGLVLFCSAHLSYSYGFTIMSAWHFTPWL
FT                   PIALFGLGVCFYWLFRPDLGQEKLPVASYILVLMTMCWAAIEYYLSGKTQSSSFAVLGS
FT                   FIFIVSGTVLAFERFGGRSVFSRQVVMVTYYSAQTLMVMSVVAIVVRYPYLS"
FT   gene            232649..233383
FT                   /locus_tag="VEA_000214"
FT   CDS             232649..233383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000214"
FT                   /product="amino acid ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000214"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52902"
FT                   /db_xref="GOA:A7K2M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2M9"
FT                   /protein_id="ACY52902.1"
FT                   /translation="MKENTPVVEFSNVNKWYGDYHALKDINFSVHSGEIVVVCGPSGSG
FT                   KSTLIRCINHLESIQEGQLHVFDQPSHAKSLKPGKIGMVFQHFHLFPHLTVLENLTLAP
FT                   IRTLKLSKQEAEKRARHYLKRVNIEEQASKYPIQLSGGQQQRVAIARSLCMKPDLLLFD
FT                   EPTSALDPEMINEVLDVMVELAQSGMTMICVTHEMGFAKKVANRVVFMDEGQIVEMNSP
FT                   IALFETPQHPRTQAFLNQILSY"
FT   gene            233383..234180
FT                   /locus_tag="VEA_000215"
FT   CDS             233383..234180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000215"
FT                   /product="amino acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52903"
FT                   /db_xref="GOA:A7K2N0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N0"
FT                   /protein_id="ACY52903.1"
FT                   /translation="MIVRVIKPVLQALLQMTLLFIAIVWVLDSGADAMGYQWQWERVPD
FT                   YIAFYEDGEWWPAELIDGLLVTLNISAISLFFTLVLGLVTALLRLSDSKVGNVIGATYV
FT                   EVIRNTPLLVQIYLLYFVFGPVIGLDRFSTAVLALSLFQGAYTAEILRAGLNSIPKGQF
FT                   EAAQTLGLSPFYTYKDVILPQVLQRTLPPLTNEVVSLIKNSSIVSVMAIFDLTTQARNI
FT                   VSETAMPFEIWFTVAAIYLALTLSLSGLSAWLEHKLGASWRKL"
FT   gene            234190..235008
FT                   /locus_tag="VEA_000216"
FT   CDS             234190..235008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000216"
FT                   /product="amino acid ABC transporter amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52904"
FT                   /db_xref="GOA:A7K2N1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N1"
FT                   /protein_id="ACY52904.1"
FT                   /translation="MKLFKATITALLGLAIAMPTIAKEDVATPNVDQIKERGTLRVGMS
FT                   TFVPWAMRNKQGELIGFEIDVAKRLAEDSGLKVEFVPTAWDGIIPALLAKKFDVIIGGM
FT                   SVTPERSKSVLFTEPYSHSGVQVAANKELASGFSEFSDFDSRRVKIAARRGAFTVQIAR
FT                   ETFPKAKILQFDDDAQAFQEVLNGNAHAVIASSPKPEHETVKHSDKLFLPFSERLSKGN
FT                   EAFAVRLGEEDKKAFFNKWIEARTQDGWLKQRYEYWFSTLDWQDQVARGQ"
FT   gene            235090..236010
FT                   /locus_tag="VEA_000217"
FT   CDS             235090..236010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000217"
FT                   /product="amino acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000217"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52905"
FT                   /db_xref="GOA:A7K2N2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N2"
FT                   /protein_id="ACY52905.1"
FT                   /translation="MGEQTTTRTVSTNSNTGSFLSRLNTLDWLLLIICGIGGVWLYHRS
FT                   AVGVHYLWQWKEALELLFTPRADGGLPYFFQGLISTLRLSIWGISFALVLGTLLGLARF
FT                   SRSVWLRTPANTFIQLVRNIPPLVFVFIFYFFISNQFIPLLGLEDLLRNYNGEPNALQS
FT                   FLFGPYNLWENLTSGVLCVGLLSSAYVAEVVRAGLQSIDQGQWEAADSLGLSRWVKYRF
FT                   VIAPQVLKAITPALAGQTISLVKDTSIVSLISIQEMTFVGTEMANSSGYIFEIWLIVGI
FT                   AYFLICFGLSLIFRHIEAKSESISN"
FT   gene            236103..236921
FT                   /locus_tag="VEA_000218"
FT   CDS             236103..236921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000218"
FT                   /product="diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000218"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52906"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N3"
FT                   /protein_id="ACY52906.1"
FT                   /translation="MELKNQSDYERYIKQDNLGEYYVVLNQFTFHSVYQPIFDKHQRII
FT                   GMEALLRIRGIDGSLIRPDVFLANNGLDPYFRLCVEFLSRAMHIRNFARCFAGTPIKLF
FT                   LNVMPQTLLTLTKDMGFKDNGLLYKRLSDLGMSPSDVVFEVVEESCGDTDLLIKAVQLM
FT                   RANGFIFAIDDFGAQHSDIARVQQLCPDIIKIDRSYLLDYCAGETFSIHSAVELAAHMG
FT                   AKVIIEGVEEDVQLQAMYQLDLDYYQGFYLGKPCAIHHWTDSLNIETTVH"
FT   gene            complement(237025..237558)
FT                   /locus_tag="VEA_000219"
FT   CDS             complement(237025..237558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52907"
FT                   /db_xref="GOA:A7K2N4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N4"
FT                   /protein_id="ACY52907.1"
FT                   /translation="MTQDYDHEEYLEGEEIEIEAIGIDVDAHPIELYKLFKIANLVSGG
FT                   GEAKHIIEEGYVAVNGELETRKRRKMYDGDFFEFNQEYYVVVCDAPVTEPETAEQKAEK
FT                   KAKKEAQSARKEKSRQSKPAKASGPKSTGRKAAHKERKAQQNALSQSAKKGKKAEKPQA
FT                   TRDPKSGRNSIDFF"
FT   gene            237785..238738
FT                   /locus_tag="VEA_000220"
FT   CDS             237785..238738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000220"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52908"
FT                   /db_xref="GOA:A7K2N5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N5"
FT                   /protein_id="ACY52908.1"
FT                   /translation="MSQPSRITFVTANLFNFVAPPDAYYDFENIYSLEQWQDKLAWTQR
FT                   QIEKLEADVIGLQEVFSIEKTQAFFSTIGYPYFATVDTPHVEDEYIYSSPVVAIASRFP
FT                   IEKVQAVEFDLATLEPFGISVAPEFSRKPIYAQVIHPVLGHIAVYVTHLKSQRPADSEQ
FT                   PETSSTIIGRWLSTQQRGWEAAMLRDAMQKRYRKEPMPTVLMGDMNQPITPTSVNSALV
FT                   ANTGDSVTELQLKDGWSLQSDALKDERPATHYHFSTGNVLDYILLSQEFDTLSDISVAE
FT                   VVDYQVSNQHLINPIYDRDKNASDHAFVALTAEVKL"
FT   gene            complement(238748..239728)
FT                   /locus_tag="VEA_000221"
FT   CDS             complement(238748..239728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000221"
FT                   /product="fructose repressor FruR LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000221"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52909"
FT                   /db_xref="GOA:A7K2N6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N6"
FT                   /protein_id="ACY52909.1"
FT                   /translation="MTLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQKKVMAVVEEY
FT                   NYKPDHAASSLRAGNSRSFGLIIPDLENTSYARLAKLIEQNSRKAGYQILIGCSDDDPD
FT                   TEQKVAEALVSRRIDALFVASGMPTANEYYLKLQNSGTPVIALDRPMDDEHFCCVISED
FT                   FDAALELTQSVLSEDIKSIGLIGALQDLQVSKERELGFRSASQQGGKTATVGYGQHFSR
FT                   EEGKKVLERWLAENELPDAIVTTSYTLLEGVLDVMLEKPELMSKVRLATFGDNRLLDFL
FT                   PVKINSLPQQFELIADSAMELALNASAKRYKPGVELIPRKIVKRH"
FT   gene            240103..241236
FT                   /locus_tag="VEA_000222"
FT   CDS             240103..241236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000222"
FT                   /product="fructose-specific phosphocarrier protein HPr/PTS
FT                   system fructose-specific IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000222"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52910"
FT                   /db_xref="GOA:A7K2N7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N7"
FT                   /protein_id="ACY52910.1"
FT                   /translation="MLKLNKNDITLSQSATDKFAAIKNIAQSLTDKGLVEQGYVEGMLN
FT                   RENQNSTFLGNGIAIPHGTTDTRSMVKTTGVAVHHFPQGVDWGDGNTVFVAIGIAAKSD
FT                   EHLGILKQLTKVLGADGVEERLRNAKNEDEIIALLHGDVQLEADFDASLIQLMFPASDM
FT                   LQMSAVAGGLLKNTGCADNEFVADLVTKTPTHLGNGLWLIGSDKHVTRTGVSFVSTAND
FT                   CEYEGQKVRALVAFAACNNAHQPILKTLSHIVFNNEHGKLLDASVEQILALFKGEEVTA
FT                   ASSEEGNTAVFKIKNSHGLHARPGAMLVAEAKKFESTIRVANLDGDGKTVNAKSLMKVI
FT                   ALGVKHGHQLQFTAEGPDAPQALESIGNAIASGLGEG"
FT   gene            241246..242217
FT                   /locus_tag="VEA_000223"
FT   CDS             241246..242217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000223"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000223"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52911"
FT                   /db_xref="GOA:A7K2N8"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N8"
FT                   /protein_id="ACY52911.1"
FT                   /translation="MTNKTSKVVTITLNPALDLTGSVNELNVGSVSLVQQSNLHAAGKG
FT                   VNVAKVLSDLGADVTVTGFLGKDNPELFHQLFNDIGVKNEFVEVQGATRINVKLVEANG
FT                   NVSDINFPGVQVTADEIARFEETLFRLAKTHDYFVLAGSLPGGVTAEQCAAWIKALHQQ
FT                   GKKVLFDSSKAALKSGIEAHPWLIKPNDEELGDFVGEQLETPEQCQAAAQTLSDKGIEN
FT                   IVVSMGADGVMWLNQGKWLRAQPPRMNVVSTVGAGDTLVAGLCWGHMQLMPKNDLLRFA
FT                   TALSALAVSQVGVGLTSQEELENIKQQTEVSELYPITNLEQN"
FT   gene            242236..243975
FT                   /locus_tag="VEA_000224"
FT   CDS             242236..243975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000224"
FT                   /product="phosphotransferase system fructose-specific IIB
FT                   and IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000224"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52912"
FT                   /db_xref="GOA:A7K2N9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2N9"
FT                   /protein_id="ACY52912.1"
FT                   /translation="MNIAIITACPSGVANSILAAGLLEQAAAKLTWNAKIECQSSVVEP
FT                   TLLTEADVEQAEVIIIAANTSVDTSRFVGKKVYQAEISEVAKDATTFLQQAVENATLLE
FT                   KATTLAAPITPEATSAAKKIVAITACPTGVAHTFMAAEALEEEGKRRGHQIKVETRGSV
FT                   GAKNQLTDQDIADADLVIIAADIEVPLDRFNGKKMYRTKTGPALKKTAEEMDKAFEQAT
FT                   IYQHSGSANSASAADEKKGAYKHLMTGVSHMLPVVVAGGLIIALSFVFGIEAFKEEGTL
FT                   AAALMNIGGGSAFALMIPVLAGYIAFSIADRPGLAPGLVGGMLASSTGAGFLGGIAAGF
FT                   IAGYAAKLLADKVKLPQSMEALKPILIIPFVATLFTGLVMIYIVGGPVSGIMNSLTDFL
FT                   NNMGSDSAVLLGIILGAMMCFDLGGPVNKAAYAFGVGLLASQTYAPMAAIMAAGMVPAL
FT                   GMGLATFIAKNKFEQNEREAGKASFVLGLCFISEGAIPFAAKDPMRVIPSCMAGGALTG
FT                   ALSMLFGAKLMAPHGGLFVLLIPNAISPVLMYLVAIAAGTAVTGFTYAFLKSKAEAKQE
FT                   VAA"
FT   gene            complement(244058..244822)
FT                   /locus_tag="VEA_000225"
FT   CDS             complement(244058..244822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000225"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52913"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P0"
FT                   /protein_id="ACY52913.1"
FT                   /translation="MQIMRILMERYIKERDNMNKRVLHGLFFVGSFTLVGCTTTDSMST
FT                   EEAKQAVPKINSVSTEVISNWIDSKVLAPEGLSLEQDNLRYISGSADLNSDGNAEHIVL
FT                   LQDRYFCGSGGCAAYMFDNEGNVINRMSVTRTPIVLADSYSNGWQDFIVWSNGSYRLMS
FT                   YNGESYPSNPSLEPKVDRDSNQQAAIANVMATELYQQDGYDIMPADSKTLWTPANVYHF
FT                   TFKHYGDPHSTYKATVDMNSGEVDIVAVPAAE"
FT   gene            complement(244947..248006)
FT                   /locus_tag="VEA_000226"
FT   CDS             complement(244947..248006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000226"
FT                   /product="transporter AcrB/D/F family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000226"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52914"
FT                   /db_xref="GOA:A7K2P1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P1"
FT                   /protein_id="ACY52914.1"
FT                   /translation="MNIAEYSIKNKVISWLFIIILAVGGLTSFLELGRLEDPAFTIKDA
FT                   MIISTYPGATSKEVEEELTYPLEKEIRKLPYIDKITSTSSDGMSQITVSMEMDYGPDEL
FT                   PQIWDEMRRKINDLRPTLPQGVQSLQIIDDFGDVYGVMLMLTGDDYDYVELKRYADYLT
FT                   REIELVDGVGKVDITGDQQEMLFVEISLDRLAALNLDMNVVASLLNQQNNVVSAGEVMV
FT                   NGESLVIRPSGTLNTVEALENLIIHGRDTGNLIRLKDVATISRGIQEKPSNVVLFNGQK
FT                   AINIGISFASGVNVVEVGERLDAKLASLESIKPAGIDMNYFYNQANEVDESVKAFVISL
FT                   AEAVAIVIIVLLFTMGLRSGVIIGVVLLLTVFGTFILMNYNNIELHRISLGALIIALGM
FT                   LVDNAIVVVEGILVGLKKGRTKVQAAVDIVKQTQWPLLGATIIAITAFAPIGLSQDATG
FT                   EFMGSLFWVLCFSLFLSWITAITLTPFLADLLLKEEDKGQDTNEEDPYKGWLFVVFGAS
FT                   LKFALRFRWLTVAGMVALLVGAVVAFGNVKQQFFPPSNTPMFYVDMWMPEGTDIRETIK
FT                   KAEEVESYIRQQDDIDFVSASIGQGLQRFALTYQPEKSYEAYAQFQVRATDRESMFGLL
FT                   HKLDANLAKTFDAPTFQFKLMEFGPSPASKIEARITGPDPQVLRDLAVQVEDILHTDPG
FT                   ARNIRHDWRERTKELVPVFNESKARRLGISKEDLSSTLQMAFGGSTLGYLRDGTHTLPI
FT                   MTRLPEEERVDFESLQNVTIWSPSLQTYIPVDQVIDGVKLDWSEPLIQRRDRKRTLTVL
FT                   ADHDVLSDDTAASLFARVQPKVMALHIPEGYEITWGGEYESSKDAQEGLFGSLPMGYLL
FT                   MFIITILLFNSIKKPLVIWFTVPLAIIGVAFGLLTTNMPFSFTAFLGLLSLSGMILKNG
FT                   IVLLDQINLELESGKEPYLAIVDSAISRVRPVSMAALTTILGMIPLVFDAFFGSMAITI
FT                   MAGLGFATVLTLIVVPVMFAILFRVKPTTA"
FT   gene            complement(248006..249067)
FT                   /locus_tag="VEA_000227"
FT   CDS             complement(248006..249067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000227"
FT                   /product="periplasmic linker protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000227"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52915"
FT                   /db_xref="GOA:A7K2P2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P2"
FT                   /protein_id="ACY52915.1"
FT                   /translation="MKRSLLTISAIALAVLTGCKNENQAVVEQPLFVSTISVDAPVQSQ
FT                   YRAFKGIVVPAEQTPMAFRRAGEIQHVLVKAGDVVKQGQMIAKLDDSKEKQAVNDAEAQ
FT                   YTLAIRQLKRGEDLHARQMISKAELDELTANKELAEANFYNATNQLNYTRLFAPFAGKV
FT                   SDVFKERFERVAVGEPVLNLYQNDLVYVRIELSDNVLAMVDPNSDNMSYKPRATFSGIN
FT                   DTFALDYLEHTSEPNSETQTYEMYLTMPQPKPEILPGTSVSVLVDMVKAGITSIDGYSI
FT                   PVTALQAGSEENEFFVWKKEGDVVTRVPVMISQVNGNGAIVSSGVKQGDVLINSNLRKL
FT                   REGKHVDVVENKQ"
FT   gene            complement(249067..250140)
FT                   /locus_tag="VEA_000228"
FT   CDS             complement(249067..250140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000228"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52916"
FT                   /db_xref="GOA:A7K2P3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P3"
FT                   /protein_id="ACY52916.1"
FT                   /translation="MRKQYLKRTLVGAVVTLSLSGMLTGCNKAISEPSEPLIKPVKLLA
FT                   VKDLEVEDSHAFLARIDATHRAQLSFQVGGEVDELLVRMGQEVKKGEVLATLDPKDLQL
FT                   ALDASQAQFALAKTQWERAKNLYGKKLISTDEYDQKETQYKAALANYEQAKTDLSYTKI
FT                   HAPFDGIVSYTYVNPFQVVAEKQEILNLIDNTTLDVSFTLPVSYAESVSLESLQNSDMW
FT                   VTMDSEPGKRIPGKFKEISTQPNIDTNSYEAIVTITRPEDRNLLTGMTGQVHIAKQHLS
FT                   DAMTLPQSAWVNKKETQGEVWVMDRNTQQVNKVTVSLDASGGVKAGLDNNDYVVVAGVE
FT                   RLVEGQVVKAWVREGGI"
FT   gene            250302..251030
FT                   /locus_tag="VEA_000229"
FT   CDS             250302..251030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000229"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52917"
FT                   /db_xref="GOA:A7K2P4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P4"
FT                   /protein_id="ACY52917.1"
FT                   /translation="MNERKQGRRSAEAAEQTKCLILKVAADMFCELGYERVSLRNISEK
FT                   AGVSHSLIRHHFGSKEKIWQAVSDAMDEFMQCYMAELINEMPENTPSNRKIYLFMVRML
FT                   AFALVNPHPVQMIADAIRQGDDGALLQYFLKSKDEFAAIFTGIFEQYNSENPNAQFDQW
FT                   ESKWQMLIFAHGAISLTPMMQETWPDIADNREKMLIKHWELFNTIMASQFGIAKEDMIH
FT                   PEKLEDIVIDMCCTIDKAVG"
FT   gene            complement(251162..252280)
FT                   /locus_tag="VEA_000230"
FT   CDS             complement(251162..252280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000230"
FT                   /product="aminomethyltransferase (glycine cleavage system T
FT                   protein)"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000230"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52918"
FT                   /db_xref="GOA:A7K2P5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P5"
FT                   /protein_id="ACY52918.1"
FT                   /translation="MTQELLKTPLHALHVEVGAKMVPFAGYDMPVQYPLGVKKEHLHTR
FT                   DAAGLFDVSHMGQLRLLGDGAAAFLETLVPVDIVDLESGKQRYAFFTNEEGGIMDDLMV
FT                   ANLGDHLFVVVNAACKEQDIAHLQAHLPSGVELDIIEDRALLAIQGPKAAAVLARFAPE
FT                   VSDMLFMDIRKVDILGAECIVSRSGYTGEDGYEISVPADKAEELARKLTAEEEVEWIGL
FT                   GARDSLRLECGLCLYGHDLDTTTTPVEASLLWGIQKVRRIGGEREGGFPGADIILKQIE
FT                   TKDVARKRVGLVGQTKAPVREGAELFDADGVKIGVVTSGTAGPNAGKPVSMGYVRADLA
FT                   AIGTELFAEVRGKMLPMTVEKMPFVPQRYYRG"
FT   gene            complement(252541..253164)
FT                   /locus_tag="VEA_000231"
FT   CDS             complement(252541..253164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000231"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000231"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52919"
FT                   /db_xref="GOA:A7K2P6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P6"
FT                   /protein_id="ACY52919.1"
FT                   /translation="MAESIYDEYPSMTLAKEQNDQNIEPLKLGQRIKDIRSKLGITLEE
FT                   ASQRTGLARSTLSKIENEQISPTFQAMQKLALGLQIDMPQLFEPPRKKVATGRRDVTKK
FT                   NEGKPHPTQTYEHELLATQLSNKKMMPFKSQIRARSFDEYKDWVRHDGEEFLLILSGEV
FT                   MFYSEFYEPVVLSEGDSVYYDANMGHMLTSVSEEDAHILWVTAK"
FT   gene            253542..254837
FT                   /locus_tag="VEA_000232"
FT   CDS             253542..254837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000232"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000232"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52920"
FT                   /db_xref="GOA:A7K2P7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P7"
FT                   /protein_id="ACY52920.1"
FT                   /translation="MNKSYPNHSLENFFSTNLSATDDAVFAGIQAESARQNEQIELIAS
FT                   ENIVSKAVMQAQGTCLTNKYAEGYPGRRYYGGCEHVDTVEAIAIERAKKLFNCEYANVQ
FT                   PHSGAQANGAVKLALLQPGDTILGMSLDAGGHLTHGARPALSGKWFNAVQYGVDRETLE
FT                   INYDDVRALAVEHKPKMIIAGGSAIPRVIDFAKFREIADEVGAILMVDMAHIAGLIATG
FT                   AHPSPLPHAHVVTTTTHKTLRGPRGGMILTNHEDIIKKINSAVFPGLQGGPLMHVIAAK
FT                   AVAFGEALGPEFKTYIDSVINNAKVLAEVLQTRGCDIVTGGTDTHLMLVDLRPKGLKGN
FT                   KAEEALERAGITCNKNGIPFDTEKPMITSGIRLGTPAGTSRGFGAEEFKLIGNWIGDVL
FT                   DGLVNNPEGDADVEKRVRKEVKELCSRFPLYQ"
FT   gene            254891..255271
FT                   /locus_tag="VEA_000233"
FT   CDS             254891..255271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000233"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000233"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52921"
FT                   /db_xref="GOA:A7K2P8"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P8"
FT                   /protein_id="ACY52921.1"
FT                   /translation="MDKTLKFTDSHEWVRDNGDGTVTLGISEHAQEMLGDVVFVDLPDV
FT                   EDEVEAGESFSLVESVKAASDIYSPVTGEIVEINEELEDSPELINEEPYEGGWIVKVKL
FT                   SNPSEFDDLKDAEEYLNSIEEE"
FT   gene            255400..258264
FT                   /locus_tag="VEA_000234"
FT   CDS             255400..258264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000234"
FT                   /product="glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52922"
FT                   /db_xref="GOA:A7K2P9"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2P9"
FT                   /protein_id="ACY52922.1"
FT                   /translation="MTELLQSLSTQNEFVGRHNGPSKSDQQKMLDAINAVSLDALIEET
FT                   VPAQIRLEQPMTLAEAKSEADMLVTMKQFAKQNQIKRTFIGQGYYNTFTPNVILRNVLE
FT                   NPGWYTAYTPYQPEISQGRLEALLNFQQMIIDLTGMEIANASLLDEATAAAEAMTLCKR
FT                   AGKSKSNVFFVADDVHPQTLEVVKTRAKFIGFEVLVGSLESLPEQDVFGALVQYPSTTG
FT                   EVRDLTDIIAKAQANKTLVTVATDLLASTLLKPAGEMGADVAIGSAQRFGVPMGYGGPH
FT                   AAFMATRDKHKRTMPGRVIGVSIDTNGNQALRMAMQTREQHIRREKATSNICTAQALLA
FT                   NMASFYAVYHGAEGLRTIARRTHHMTAIIAAGLTKGGFELAHNSFFDTITINTGSKTEE
FT                   LYAKALSADINLRLLPGKLGISCDETTTVADVEALFAVFGVKEDVAALSTEIGGNEFAA
FT                   IPEALRRTTEYLTHPVFNTHHSETQMMRYLKQLENKDFSLTHGMIPLGSCTMKLNAAAE
FT                   MIPITWPEFGSIHPFAPAEQAAGYAALAKDLKEKLCEITGYDAFSLQPNSGASGEYAGL
FT                   IAIQRYHESRGEGHRNVCLIPSSAHGTNPATASMVSMKVVVVKCDEEGNIDIDDLAAKI
FT                   EKHKDNLSSIMITYPSTHGVYEEKVKEVCEMVHAAGGQVYLDGANMNAQVGLTSPGFIG
FT                   SDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPGHIEDGVEGEDFAVSAADMGSA
FT                   SILPISWAYIAMMGEAGLTDATKVAILNANYVMETLRQHYPVLYRGKNGRVAHECIIDI
FT                   RPLKEETGISEEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESEDLEELDRFCDAMIAI
FT                   REEMEKVKNGEWPLENNPLVNAPHTQVDLSAEEWDRPYSRELGCFPSKATKSWKYWPTV
FT                   NRVDNVYGDRNLICSCPSIDNYED"
FT   gene            complement(258507..258908)
FT                   /locus_tag="VEA_000235"
FT   CDS             complement(258507..258908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000235"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000235"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52923"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q0"
FT                   /protein_id="ACY52923.1"
FT                   /translation="MSKTVQQQIGNIALVVENYDDAIEFYTQKLQFTLVEDTNLGGGKR
FT                   WVQVSPPNSNGTNLLLAQASTPEQTHAVGNQTGGRVFLFLQTNDFWRDYELMKKNGVVF
FT                   NEEPRVEEYGTVVVFQDLYGNKWDLLQLN"
FT   gene            259150..259611
FT                   /locus_tag="VEA_000236"
FT   CDS             259150..259611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000236"
FT                   /product="4-carboxymuconolactone decarboxylase
FT                   domain/alkylhydroperoxidase AhpD family core domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000236"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52924"
FT                   /db_xref="GOA:A7K2Q1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q1"
FT                   /protein_id="ACY52924.1"
FT                   /translation="MKKRLNYIEVAPKAIEILYAQEAYFHEQFNQSETMNMIIWELVKL
FT                   RISQINQCAFCIDMHSKDALKLGEKPERIWGLSAWKDMPFYNDAEHVALGWAELLTAGL
FT                   PVDDDTYQLTLNTFGEEAMVNLTIAINAINSWNRIVKAFKPKVGVYKPR"
FT   gene            259716..260456
FT                   /locus_tag="VEA_000237"
FT   CDS             259716..260456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000237"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000237"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52925"
FT                   /db_xref="GOA:A7K2Q2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q2"
FT                   /protein_id="ACY52925.1"
FT                   /translation="MIHLNLEFDILKPQKALAGYVQAIWSASVKPDTTQTVRKQLLSDA
FT                   GTGVVFILQNEVQMDGEWQAPGVVLLPVSILAHQVCLPPGAVMTGVRFHPAVGYQLFGK
FT                   RLEQLLRIQDDHPLASSALATFESLQTARSPSARISTLYRWVQTLIEEYEPQYVGHIID
FT                   QPTGTISQRQRERNFQKWLGITPKHYQRIKRVKHTLEQLRAQPDLTLSELALEQGFSDQ
FT                   AHMTRECKQIARMTPKQFVRKRNL"
FT   gene            complement(260576..261070)
FT                   /locus_tag="VEA_000238"
FT   CDS             complement(260576..261070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52926"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q3"
FT                   /protein_id="ACY52926.1"
FT                   /translation="MSKDFEFTTEYILDKPFFAECYDQTSQPTKFPQAYLKGMLFLIFG
FT                   VVLLEFELLPNGYVGWFFIVLSVIEACSVYFKRTWWLWRQTISSSRGSKVAFEVNADGV
FT                   RYKSGKVDRSLAWNYIDQLEQTDLGFILHLGKQRQYISKSCLNEEVIAFMVEQHAASKA
FT                   S"
FT   gene            complement(261311..261571)
FT                   /locus_tag="VEA_000239"
FT   CDS             complement(261311..261571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000239"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52927"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q4"
FT                   /protein_id="ACY52927.1"
FT                   /translation="MSKSSKLHNEDKLVKKALEIGGKMAKLQGFDLPQSPQPLRVKAIY
FT                   LFLVDAKQITPLPESKLDGASIKHRLAVWIHSALPDNDPLK"
FT   gene            complement(261766..262617)
FT                   /locus_tag="VEA_000240"
FT   CDS             complement(261766..262617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000240"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52928"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8L1"
FT                   /protein_id="ACY52928.1"
FT                   /translation="MKNHYLEIPEERKLRIFREEDEDFYNFWEEMLDEKQSFYQQPLKR
FT                   MKGDAWYSLDAFFTASKYGQHQASPAYIKRALELLNNVYLLANHSDHVVEFSVGHRHFS
FT                   EVGNRSIAGGTMDAWLDEICLAMAARDWRCVELMTIMDESLVRLKDPFDVALVEFVSGV
FT                   FSNSSALPELLQTVMEKSSPQYLESTRVPYVHSLFIPFVNVFVAIIDGDEAHYQEALRD
FT                   ALETHYQFYMNEDVRYSPKGNVSLKLTGLAALAYDKYGWTIPETAYLPKWLVYGEHDLC
FT                   SK"
FT   gene            262983..263597
FT                   /locus_tag="VEA_000241"
FT   CDS             262983..263597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000241"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52929"
FT                   /db_xref="GOA:A7K2Q6"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q6"
FT                   /protein_id="ACY52929.1"
FT                   /translation="MPQANSVVVLDFETTGLSPTLGDRAIEIGAVKLVDGEVVDSFQRL
FT                   MNPGFRVSSFIENYTGITNNMLRSAPSCEEVMASFSEFIAGENLIAHNASFDKRFLDAE
FT                   LERINCGYSGEFACSLLVARRLIQDAPSHKLGELVRYKNIDNDGVFHRALADAQMTAKL
FT                   WLLMVEGLENSGIVKPSFQLMQTVSKTAKGKVDLLLAKSRA"
FT   gene            263771..265531
FT                   /locus_tag="VEA_000242"
FT   CDS             263771..265531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000242"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000242"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52930"
FT                   /db_xref="GOA:A7K2Q7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011918"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q7"
FT                   /protein_id="ACY52930.1"
FT                   /translation="MSRKNNKNLSILLKLNTFIAPYKWRVAAALVALVATASLTLSVGY
FT                   GVRILIDQGFAQQSLQELTNAIQFIVGVTLCIAIGTFFRFYLVSSVGERVSADIRLSVF
FT                   NHVITLHPSYFETNSSGDIMSRLTTDTTLLQSIIGSSFSMAMRSALMCFGAIIMLFATN
FT                   VKLTLIVLASVPLVLVPILFYGRRVRALSRQSQDSMADVGSYAGEAIEHIKTVQSFSSE
FT                   PYERAAFAVEVEKAYEVGRQRVKQRAILISGVIVIVFSAIAGMLWVGGSDVIHGKMSAG
FT                   DLAAFVFYAIMVASSTATISEVMGELQRAAGATERLIEILQVDSDIKAPINHLPIRPDM
FT                   PAEVNFKSVSFNYPSRPNQPAIKELNLTAEQGKVLALVGPSGAGKTTLFELLQRFYDPQ
FT                   QGQVLFGGEDIRQFDPNELRRQMALVPQQPALFSHDVFHNIRYGNPEATDEQVIEAAKK
FT                   AHAHEFIEKLPEGYHSFLGERGVRLSGGQKQRIAIARAILKDPKILLLDEATSALDSES
FT                   EHHVQQALEALMKGRTTLIIAHRLSTIQHADKIAVLDNGELVDVGNHQSLMQSCELYQR
FT                   LVALQFKHLE"
FT   gene            266033..266425
FT                   /locus_tag="VEA_000243"
FT   CDS             266033..266425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000243"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52931"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q8"
FT                   /protein_id="ACY52931.1"
FT                   /translation="MNSEAKQLFSYLCKQYDVLSQELESRAFPEFSETITHPLGHCFVR
FT                   CPVGSQRFSIVAVNFAPSVRGQGVLTAFIDYIKSNPYHYQGVEVAIIENKSLAKRLLSL
FT                   GWKYKSLFGKIFFASKPTLVKDFQSA"
FT   gene            complement(266467..267471)
FT                   /locus_tag="VEA_000244"
FT   CDS             complement(266467..267471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000244"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000244"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52932"
FT                   /db_xref="GOA:A7K2Q9"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2Q9"
FT                   /protein_id="ACY52932.1"
FT                   /translation="MDPLTQGLLGAALPQSASNKRHIVAAGVLGVVSGMASDLDVLIRS
FT                   STDPLLFLEYHRHFTHSLLFIPFGSFLCTLVLYPLFAKRRGLNFRQSWFYCALGYSTHA
FT                   LLDACTSYGTQLFWPISNTRYAWNTISVIDPAFTFPILILLLFAALKRNRNYARVAFLW
FT                   SLAYLTLGVIQRDRAEAAGWKIVQERQHSAVQLKAKPTFGNLLVWKVIYETEDNYYVDA
FT                   VRVGRSIKIYPGESTPKLNVKTQFPWLDPQSQQAKDIERFRWFSNGFVAQDPNNEMRIV
FT                   DVRYSIVPNQINALWGINLSPNASPNVHVEYTAHRGSTTEDRQTFLNMLTDFE"
FT   gene            complement(267805..268263)
FT                   /locus_tag="VEA_000245"
FT   CDS             complement(267805..268263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000245"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52933"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R0"
FT                   /protein_id="ACY52933.1"
FT                   /translation="MLRDYTFDCLVTMPRHELEEFSARMISKMVPEDVMNELFTFDQEE
FT                   VDSEDRMLSARLDAMLRMTAIALSEIQQAFDDSDNAKQNSERMTRLVLWHFYAISFHLE
FT                   EAITLETHCALVEKLLENTPSDVFDWVKTLTELLHTYAEINAKENPQD"
FT   gene            complement(268358..269386)
FT                   /locus_tag="VEA_000246"
FT   CDS             complement(268358..269386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000246"
FT                   /product="phospholipase A1 precursor"
FT                   /EC_number="3.1.1.32"
FT                   /EC_number="3.1.1.4"
FT                   /note="most likely function alternative not yet resolved;
FT                   EC; outer membrane phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000246"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52934"
FT                   /db_xref="GOA:A7K2R1"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R1"
FT                   /protein_id="ACY52934.1"
FT                   /translation="MASKVAGISILSLLAAPVAMGETASAYDLCLLDKIKQSKGEETIK
FT                   SIRAQCELDAVTSTVPADPEIEEPEELQESLVDKRLESERENAFEPFSLVAHRVNYILP
FT                   FTYSDRVNKRAYADTKYGDELRKEEAEFQISFKVPMNYDDLLFDGDGLFFGMTLKSFWQ
FT                   VYTGAASRPFRETNYRPELFYYTPTDWKPLDGSTWLGFGIEHESNGQRQELSRSWNRVY
FT                   ANLTFAKDNFAVSLQPWWRIPEDEKTSPNDPKGDDNPDIEDYMGHFELSSAYKWNGYEF
FT                   TFLGRQNFQTHKGFAELGVSFPIWGKLQGYAQYSTGYGKSLIDYDHNQQRIGVGIAING
FT                   VL"
FT   gene            complement(269619..270122)
FT                   /locus_tag="VEA_000247"
FT   CDS             complement(269619..270122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000247"
FT                   /product="permease"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52935"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R2"
FT                   /protein_id="ACY52935.1"
FT                   /translation="MLFLIGLQAALIGIGATLIMDLWAWIQRRVFGIQSLNYALVARWV
FT                   LYMPKGKLMHAPIMATDAMPGEKALGWFLHYAIGVVFALAHIAAFGHHWLVEPSLVPGL
FT                   ATGVVMLVFPFFVIQPCLGFGFAASKTPTPWKARFLSTLAHLAYGLGLFIAGFAIKVAS
FT                   QYFA"
FT   gene            270207..270614
FT                   /locus_tag="VEA_000248"
FT   CDS             270207..270614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000248"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000248"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52936"
FT                   /db_xref="GOA:A7K2R3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R3"
FT                   /protein_id="ACY52936.1"
FT                   /translation="MDIAEVVKKSGLPTSTLRYYEQLGLIRSIGRNGLRRQYSPEVLNK
FT                   LNLISLGRIAGISLNEMAEMLNHSEGSKPYIDRDLLAKKALEIDEQIKRLKAVRDSLNH
FT                   VASCPYESHMDCSSFQRLMKVVKRYVPKKPR"
FT   gene            complement(270679..271185)
FT                   /locus_tag="VEA_000249"
FT   CDS             complement(270679..271185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000249"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000249"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52937"
FT                   /db_xref="GOA:A7K2R4"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R4"
FT                   /protein_id="ACY52937.1"
FT                   /translation="MAVLEILSIPDPRLKVKAEKVTDVSTVQTLIDDMLETLYATGNGI
FT                   GLASTQVGRKEAVVVIDISDERNDPLILVNPEVVSGENKALGQEGCLSVPEYYADVERY
FT                   TSVVVSALDRDGNPMTIESDEFLAIVMQHEIDHLSGNLFIDYLSPLKQKMAMKKVKKYV
FT                   KAQAK"
FT   gene            complement(271406..271618)
FT                   /locus_tag="VEA_000250"
FT   CDS             complement(271406..271618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52938"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8M1"
FT                   /protein_id="ACY52938.1"
FT                   /translation="MLLWNLSSLVVFSLILMFLGISIFELIAELGWFSIIIVVLTLITV
FT                   CLGYFIFKSGEKMAIKVLLKAQKSA"
FT   gene            complement(271897..272226)
FT                   /locus_tag="VEA_000251"
FT   CDS             complement(271897..272226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52939"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R6"
FT                   /protein_id="ACY52939.1"
FT                   /translation="MKINIFKKLQVVFLVVSASLMVGCSSIDAHAGGGYGKPFSGTALS
FT                   VARQPCYLRADITSIALYPLSLIDIPLSLATDVVFLPVDLIMVATPTTSYGGVVSLGCP
FT                   SGSMI"
FT   gene            complement(272540..272791)
FT                   /locus_tag="VEA_000252"
FT   CDS             complement(272540..272791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000252"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52940"
FT                   /db_xref="InterPro:IPR021376"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R7"
FT                   /protein_id="ACY52940.1"
FT                   /translation="MNPILAMLKENNISDEQINELFQALTQNPLAAMATISQLGLPQDQ
FT                   LQALMAQVMQNPVLIKEAVEELGLDFSKVVEAKAKLQQ"
FT   gene            complement(272892..274337)
FT                   /locus_tag="VEA_000253"
FT   CDS             complement(272892..274337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000253"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52941"
FT                   /db_xref="GOA:A7K2R8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R8"
FT                   /protein_id="ACY52941.1"
FT                   /translation="MSFKYLTLLLATTSMNSFADVELPSGDDWLNHVTNGLAPYWMMES
FT                   AHGQPAGNFPTFRCDNGVILDPQKPCEELNKGWISPHFDREYTRMKSRQTYAYGVLFHL
FT                   TGDKQALELAKKGAYYLIDHLQDEKNGGFVSFTRSGKPGMEWQQRTSQDQAYALVGLAM
FT                   YYYLTQDPKVEQALIDQQAFIFKQYRRSDDRGLAWVLKDGDGESEKQQELVAQLDQING
FT                   YLLLTAPLLPETAQAKWKQDLEWLTQVVLDNYHSDKEQRFYGAIHHKAVMMPDAKHNDF
FT                   GHTIKAYWMTYLTGQLLEKSNWTEFGFKGMKHTLKQAQYQQNFEQVKALFSLEWQSQWT
FT                   QESIPAWQSRPHKHYSSSWEWAELDQAAMTVSLVDGSMKETLQYTLPTFMDVWVDHQYG
FT                   GVGLNPKSTKAFHWGNGYHQFEHALVGYLYAQQMAKQPAKLYYARPAESKMPLNPYYFN
FT                   ADIKALSSQSDGVTTATFTNIRP"
FT   gene            complement(274516..274986)
FT                   /locus_tag="VEA_000254"
FT   CDS             complement(274516..274986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000254"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52942"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2R9"
FT                   /protein_id="ACY52942.1"
FT                   /translation="MNKLIVFTGGPGAGKTSVIEQLKTQGFICSPETGRHVIQRQVANH
FT                   GSALPWNDKQAFRDEMMKAEVSNYRAFNVRQAEVFFDRSIVDVYGYSKLEQLPISHELI
FT                   THCQTLRYQSQCSFFHRGRRYSATMKSESKIFLKRSPRINRWSTLITSLVIN"
FT   gene            275024..275137
FT                   /locus_tag="VEA_000255"
FT   CDS             275024..275137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000255"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52943"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S0"
FT                   /protein_id="ACY52943.1"
FT                   /translation="MYSQENWHHLAFEIDMAFGTPALREISSGMFWDRNEQ"
FT   gene            complement(275280..276626)
FT                   /locus_tag="VEA_000256"
FT   CDS             complement(275280..276626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000256"
FT                   /product="putative magnesium transporter MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000256"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52944"
FT                   /db_xref="GOA:A7K2S1"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S1"
FT                   /protein_id="ACY52944.1"
FT                   /translation="MMIDSSQLQINRKVPHLLAEIIKAIESTEDLSFLKDYQEAQIANI
FT                   LESVNIAYRKRVIEAVPPEKYWTVLNLLRYDTAKHIHQSLNKELQHERLAYITDSELII
FT                   FADFLPTEFVDEYLIDQSEESVAHIQQALSYEDNKVGRYAEPHFLVANPKNSVGGIKTE
FT                   LLKRGQSPVRLIIVRDVGGVIGTIEPQTLLLHENHTKLTDLTVVTPILEDIQTIQSVSK
FT                   QVSIDGGAHWFPIMAGGKIMGVLSMATIAITLRELSLQAVVAENVRSEEDLFTPLTVAT
FT                   RLRALWLVINLLTAFVASAIIGIFDNVVEQVVALAILMPVVASMGGIAGSQTLAVAIRG
FT                   IALNHLHQSNLKLLVNKELKIATINGLIMGLVIAGVVYMVFDSWPLALIICCAIFLNSL
FT                   AAAASGTLIPFTLKKFNIDPAVAGSVVLTTVTDVVGFFAFLGLGAIFLI"
FT   gene            276839..277714
FT                   /locus_tag="VEA_000257"
FT   CDS             276839..277714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000257"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52945"
FT                   /db_xref="GOA:A7K2S2"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S2"
FT                   /protein_id="ACY52945.1"
FT                   /translation="MAPVFFLTQQAALPSRKVLRKVIQFATALAQPIVVLVEDHRRSED
FT                   HAFAHFLSFNSDHIEKRQAEFEAWTSKFKDFVIELCEEEEVETPTLSYGHFKGSHWIAQ
FT                   VAKRLVDHTDLLLVGNFNKHDIQTLLTELAKNDCDLLLLSERSWPSHANMLCAIDPLHR
FT                   GDAKSVVDKAIVSRGSKLEKTLSGKMTLVYCRYVAPYLSRYRAEILSNQKAGITDFITA
FT                   QKLTRVPLLLPEGNPETALPKAVKQSQAAILIMGACKRSMSSQFWSGSTVDTLLDQPPC
FT                   DLLLVNSTKD"
FT   gene            complement(277760..278149)
FT                   /locus_tag="VEA_000258"
FT   CDS             complement(277760..278149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000258"
FT                   /product="MazG-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000258"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52946"
FT                   /db_xref="GOA:A7K2S3"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S3"
FT                   /protein_id="ACY52946.1"
FT                   /translation="MKKFDELYAIATRKSQYDQTNTWFKGVETYLEAIGKEVDEVREEI
FT                   REDRLCHLEDELGDVLWNYLNVLKALEREKGIEPEKVLERACNKYDQRVSAIESGRSWD
FT                   EVKQQQKQALNAEHEAAQLETMKSQ"
FT   gene            complement(278176..278604)
FT                   /locus_tag="VEA_000259"
FT   CDS             complement(278176..278604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000259"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52947"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S4"
FT                   /protein_id="ACY52947.1"
FT                   /translation="MSANSHFHSTHEAHYQCAVCSSIDANPNSLAVNYQCLADGSVVGE
FT                   FHVLPRHQGYTDLLHGGIASSLLDGAMTHCLLFRNIQALTAQLDVRYHAPIELDEHVTI
FT                   TAHCEGERRGIYQLVAQLLVNNEVRVTAKGKFIRPKKA"
FT   gene            278816..279202
FT                   /locus_tag="VEA_000260"
FT   CDS             278816..279202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000260"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000260"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52948"
FT                   /db_xref="GOA:A7K2S5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S5"
FT                   /protein_id="ACY52948.1"
FT                   /translation="MKFLHTMIRVVDLDKSIEFYTKVLGMSVLDRFENQEYRYSLVFVG
FT                   SPDQPDGATIELTYNWDTDSYDLGNAFGHIALGCEDIYAACEKIKALGGNVTREPGQMK
FT                   GGETHIAFIKDPDGYPIELIQTKQ"
FT   gene            279214..280314
FT                   /locus_tag="VEA_000261"
FT   CDS             279214..280314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000261"
FT                   /product="N-ethylmaleimide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52949"
FT                   /db_xref="GOA:A7K2S6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S6"
FT                   /protein_id="ACY52949.1"
FT                   /translation="MTDALFQPIQLGSLSLKNRIVMPPMTRSRASQPGNVANDMMATYY
FT                   AQRAEAGLIVAEGTQISPMGQGYAWTPGIYSPEQIAGWKKVTDAVHEKGGVIFAQLWHV
FT                   GRVTHPDNIGGEQPISSSALKAENVKVFIDNGTDEPGFVDVVEPREMTKKDIKNVIEEY
FT                   RQAALNAIKAGFDGVELHAANGYLVNQFIDSEANHRTDEYGGSIENRLRFLGEVVEAMT
FT                   QAIGAERVGVRLAPFTSLNGTVDSTPVDTYTAAAALLDKLNMVYIHIAEVDWDDAPDTP
FT                   HDFKTAVREAYKGKLIYAGRYNAEKAQHAIESGLADMIGFGRPFVANPDLPSRIKHGYP
FT                   LAEHDPTTLFGGGEKGLVDYPAYHAG"
FT   gene            complement(280434..280709)
FT                   /locus_tag="VEA_000262"
FT   CDS             complement(280434..280709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000262"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52950"
FT                   /db_xref="GOA:A7K2S7"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S7"
FT                   /protein_id="ACY52950.1"
FT                   /translation="MTENTIQEKIASFTCIEEALDYFEIEFDSRFIENNRTELVKRFNG
FT                   YLILTKPDDWFSGRRALKNAYCKVQRSLLSKTTRSACRGCTSCQRR"
FT   gene            280951..282801
FT                   /locus_tag="VEA_000263"
FT   CDS             280951..282801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000263"
FT                   /product="putative lipopolysaccharide modification
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000263"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52951"
FT                   /db_xref="GOA:A7K2S8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S8"
FT                   /protein_id="ACY52951.1"
FT                   /translation="MTYRAEVDGLRAIAVTLVILFHAGVEQFAGGFIGVDVFFVISGYL
FT                   ITTIVINDLENQKFSLGDFYERRIRRILPLLLVVIAVSYLMSWWLFLPQAHKDVGQFAV
FT                   SSILSSSNILLYLKGHNYFGLEDQANPLFHTWSLGVEEQYYIVIPLLLMLLARGKNAFF
FT                   LTFFIAVFALSLMTIVYASNDPDFAFYMIFSRAWELATGSLLALVMRKAQVQSNDTLAT
FT                   IGIVLILASALLFEKSQDGAGITLLVPVIGSALVILFASKDNLCGKLLSLKWVVFVGLI
FT                   SYSLYLWHIPLFVFYRYVLDATQDVNIPLYVVTLFVLSYFTWRFIEKPFRSRKAMSMRT
FT                   VSAVIVLLTLPLLTFGVIGHQNGGFPERSAFFEAMRVNNGYGLDCNGNTDVNDVCSSAP
FT                   QPTIAVLGNSHSMVYVKRLSEVTPTGVVQLTQDSCAVGYVDTIKDAGSISCRQFFKQAV
FT                   DTILRTPSIRRVVISSNFNKELSQADYEASLTGLLNELEGKEVVVFGPTPSAPFAVGEC
FT                   LWKARLFGETKESACDFSPKQHHPQNVEKLVNYFEQFEHVEFVDLTEAICRNGVCRMKV
FT                   GANNAMYTDDSHLSYKGAELVLGHYHSSANEAQQFTYDRQ"
FT   gene            complement(282882..283352)
FT                   /locus_tag="VEA_000264"
FT   CDS             complement(282882..283352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52952"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2S9"
FT                   /protein_id="ACY52952.1"
FT                   /translation="MKLYRLTQKKFADTPFSPVGAKLFGGRWNSKGTEALYFSESESLC
FT                   SLEVFVHVNNDPAITKLYDLYRIEMPEYLIATLDEEDLPVTWRAIPASESTQYIGDQFL
FT                   NDPHPEFAALQVPSTISPRDKNYVVNPNHPKMKEIIKKAEKLDFAFDPRIFK"
FT   gene            complement(283354..283806)
FT                   /locus_tag="VEA_000265"
FT   CDS             complement(283354..283806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000265"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52953"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T0"
FT                   /protein_id="ACY52953.1"
FT                   /translation="MATAALKSFKPKQSHKANFWLMLGIEDAETGRIDAVHKGFEPKVY
FT                   RNIVDRVKLSQSEFQHVTLIPVSTIKRRLKNDERFNTQESDAIYRLAMLLKLATELFDD
FT                   EERALKWMRENVYGLGGKRPLDMVSTTVDFEIVKDLIGRLEHGVFS"
FT   gene            complement(283972..286143)
FT                   /locus_tag="VEA_000266"
FT   CDS             complement(283972..286143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000266"
FT                   /product="catalase/peroxidase"
FT                   /EC_number="1.11.1.6"
FT                   /EC_number="1.11.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000266"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52954"
FT                   /db_xref="GOA:A7K2T1"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T1"
FT                   /protein_id="ACY52954.1"
FT                   /translation="MSNTNGGSVGKCPVMHGGQTSTDKSVMDWWPNALNLDILHQHDSK
FT                   TNPFGQDFNYKEELKKLDVEALKKDLKELMTDSQDWWPADWGHYGGLMIRMAWHAAGSY
FT                   RIADGRGGAATGNQRFAPLNSWPDNANLDKARRLLWPIKKKYGNKLSWADLIVLAGNMA
FT                   YESMGFKTFGFGFGREDIWHPEKDTYWGSEQEWLATSDADNSRYSGERDLENPLAAVMM
FT                   GLIYVNPEGVDGNPDPLKTAHDMRVTFARMAMNDEETVALTAGGHTVGKCHGNGDAANL
FT                   GPEPEAADVHEQGLGWINHKTRGIGRDTVTSGIEGAWTTHPTQWDYGYFHLLFKYDWEL
FT                   KKSPAGAWQWEPIDIEEEDKPVDVEDGSKRYNPIMTDADMALKMDPEYRKIAEKFQNDP
FT                   AYFDDVFARAWFKLTHRDLGPKSCYFGPDVPSEDLIWQDPTPAGKTDYDVDLVKTKIEA
FT                   SGLSISDLVSTAWDSARTYRGSDRRGGANGARIRLAPQKDWQGNEPERLSRVLAVLEKI
FT                   AAEEGCSVADTIVLAGNVGIELAARAAGHDVSVPFAPGRGDATQEMTDVESFEVLEPVA
FT                   DGFRNWLKKDYAVKPEELLLDRAQLMGLTAPEMTVLIGGMRVLGSNYGGGKEGVFTDRV
FT                   GTLSNDFFVNLTDMAYTWKPVSANQYEIRDRKTDAVKWTATRVDLVFGSNSILRSYAEV
FT                   YAQDDNQEKFIHDFIAAWTKVMNADRFDL"
FT   gene            complement(286329..287729)
FT                   /locus_tag="VEA_000267"
FT   CDS             complement(286329..287729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000267"
FT                   /product="glutamate synthase [NADPH] large chain"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52955"
FT                   /db_xref="GOA:D0M8N8"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8N8"
FT                   /protein_id="ACY52955.1"
FT                   /translation="MSFTAEKDEDAYLCQCKHTSNAPFCDGTHKRFSSEQVGKEGPEKK
FT                   REKSDKPTASATQEEPTLEFIHQLAREGLSKLGHHGPMAAMGVPRHLLPHWDAIQIMVA
FT                   QMATQPLLEDVPVSTELIVGPNARKPLKLAIPLLVSDMSFGALSEEAKIALAKGAELAG
FT                   TGICSGEGGMLPEEQAANSRYFYELASAQFGYDESKLLNVQAFHFKGGQGAKTGTGGHL
FT                   PANKNVGKISQVRGIPEGQPAISPPTFKDLHTTHDFRKFADRVRGITGGIPIGFKLSAN
FT                   HIEQDIQFALDAGADYIILDGRGGGTGAAPTMFRDHISVPTIPALARARKYLDEKGASD
FT                   RVTLIITGGLRVPMDFVKALALGADGVAIANSAMQSIGCVAARICNTNNCPAGIATQNA
FT                   DLRQRLDIEKSSQQLKNFFESSVELMQVMARACGHHALNEFSRHDLATWDHNMARLSGI
FT                   KYSGMDLN"
FT   gene            288028..288507
FT                   /locus_tag="VEA_000268"
FT   CDS             288028..288507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000268"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52956"
FT                   /db_xref="GOA:A7K2T3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T3"
FT                   /protein_id="ACY52956.1"
FT                   /translation="MTIATRLDEYLTEHNIHFQTVNHSHSHSSLQSGVAAGVPLMNIAK
FT                   GVILEDHEGHHMMAVLPANNKISLSRLNDEFNATFHLVKERMVYRLFTDCEHGAIPPIG
FT                   SPYHMSTVCDERLANLEHVYLEAGDHETLIKLDRKAFKELMNDCKYLRFSSEVLH"
FT   gene            complement(288677..290089)
FT                   /locus_tag="VEA_000269"
FT   CDS             complement(288677..290089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000269"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /EC_number="1.2.1.68"
FT                   /note="most likely function alternative not yet resolved;
FT                   probable coniferyl aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000269"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52957"
FT                   /db_xref="GOA:A7K2T4"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T4"
FT                   /protein_id="ACY52957.1"
FT                   /translation="MNAIAEVEVDSSLQQSLERLKAAYAAEPYPSLDERKQRLVLLKQA
FT                   LIANKQALVEALSEDFGYRSEFDTAMTDVLPTVSHINYTIKQLKKWCKPSKRESGLLLA
FT                   PSKVTVQYQPLGVVGIISPWNFPVILSLAPLVTALAAGNRVMMKLSEFTPKTNKVIVNI
FT                   CRELSEYVEVFEGEADVAQSFSQLPFDHLLFTGSTNVGRAVAKAAADNLTPVTLELGGK
FT                   SPVIIAEDADMKKTVDAILFGKCINAGQICVAPDYAFVPQERVEEFITLFLKRFEKLYL
FT                   KSNKNQKLTHIINQRQYDRLTALLEDAKAQGASIHTVEAPPQQERLLYPHLITDVSTDM
FT                   RIMQEEIFGPFLPIKPYKAVDEAIDYINQHQRPLALYVMSDDKSTIRHIVRNTHSGGVG
FT                   INDTVLHVGAEDAPFGGVGESGIGHYHGVEGFRTFSHAKTVLHTPKWLPRTGALMRRRA
FT                   MAIKAIQKIFVR"
FT   gene            complement(290215..290745)
FT                   /locus_tag="VEA_000270"
FT   CDS             complement(290215..290745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000270"
FT                   /product="putative ribosomal-protein-serine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52958"
FT                   /db_xref="GOA:D0M8P1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8P1"
FT                   /protein_id="ACY52958.1"
FT                   /translation="MQASFSVSDRVSIEPLTTKHATVLLEVVNTYRNSLSGYLPWTDFV
FT                   TNRREAVNYISQRVNSKALDAHWCAIYFDGQFSGVIGIKGVDSHTRVTEIGYWLANNGR
FT                   GHRVIDQVLAVLIPFLKQKGHAQFIQFHCMEDNIASISIAERAGATLKEYVDHEFETLD
FT                   RSQRLGIYELRLT"
FT   gene            complement(290902..291360)
FT                   /locus_tag="VEA_000271"
FT   CDS             complement(290902..291360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000271"
FT                   /product="NUDIX hydrolase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000271"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52959"
FT                   /db_xref="GOA:A7K2T6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T6"
FT                   /protein_id="ACY52959.1"
FT                   /translation="MIPVQATHTSGVVISKIDGVDKMLLLKRVKGGYWCHVAGGVEAGE
FT                   TGWQTILRELKEETQIDDVELHTADFLEQFYEAKNNRIMVIPCFVLFCPPNQSVVLNEE
FT                   HTEYCWCTLEEAKRLAPFANQHHLYEHVWRHYVDVESLTPFTLIEQTD"
FT   gene            291545..292450
FT                   /locus_tag="VEA_000272"
FT   CDS             291545..292450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000272"
FT                   /product="permease"
FT                   /note="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000272"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52960"
FT                   /db_xref="GOA:A7K2T7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T7"
FT                   /protein_id="ACY52960.1"
FT                   /translation="MSNSFNTLVPIGVRFMVLSAFGFALMSATVKHVSLHGIPVFEIVA
FT                   ARALVSLVISYLDVKRKRISVWGNNKPLLFARGAVGTMALMCVYYSVTTLPLAEATIFQ
FT                   YIHPVFTALLAVFFLKERIQPSTFLCIALCLLGIYIMVSPETGQEAERTLPMFSVMIAI
FT                   LGAFGSSIAYVIVRKLSQTEDSSVIIFYFPLVALPASLLLIGDDFVMPDLYLTFMLVLV
FT                   GVFTQVGQLGLTKAMQTQQAGKASAYSYIQIVFSVLLGIIFFGEIPLIWTYIGGALIVA
FT                   GALINVFGHHLRLPFVKHSA"
FT   gene            complement(292533..292847)
FT                   /locus_tag="VEA_000273"
FT   CDS             complement(292533..292847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000273"
FT                   /product="molecular chaperone SugE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52961"
FT                   /db_xref="GOA:A7K2T8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2T8"
FT                   /protein_id="ACY52961.1"
FT                   /translation="MAWGILFIAGLCEVAWAVGLKYSQGFTKLAASGFTVTFMVLSFWL
FT                   LGIALRTLPLGIAYGVWVGIGAIGTAIVSIYIFNEPATLIKLLSLLLIVAGIAGLKLSA
FT                   "
FT   gene            complement(292998..295103)
FT                   /locus_tag="VEA_000274"
FT   CDS             complement(292998..295103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000274"
FT                   /product="neutral protease precursor"
FT                   /EC_number="3.4.24.25"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52962"
FT                   /db_xref="GOA:D0M8P5"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8P5"
FT                   /protein_id="ACY52962.1"
FT                   /translation="MGSVSNYQSRLFVTAMLASPLLFSTSLSAAQSERLEQNHGLVVAL
FT                   EKRNLAATQNIDRVLGLQNGNRVQKLKTNKGKNGGTHSRYQQMFKGVPIWGKQIVVHRD
FT                   KQGQIKHINGTLVKDIARDINDMVPRLSLSQVMSSTQKPYRENGYQIENQRQGLRIYVD
FT                   KSDVAHLAYIVQFFADNEHGGKPTRPTFLVDAKTGNILLQYEGLAYVEANGPGGNQKIG
FT                   RYHYGVDFESLLVQQSGDTCLMDIPGVVKTINLNGRTSGNTHTFVCPTNSVKEINGAYS
FT                   PLNDAHYFGKVVYDMYKDWLNTAPLTFQLQMRVHYRKRYENAFWNGSSMTFGDGASYFY
FT                   PLVSLDVSAHEVSHGFTEQNSDLIYSEQSGGINEAFSDMAGEAAEFYSRGSNDWKVGYD
FT                   IRKAANAALRYMDNPPLDGRSIDHASQYVSGMDVHYSSGVFNKAFYLLAVEYNWGTRQA
FT                   FEVFAYANQNYWTPSETFDSAAAGVLAAAQSLNVAANDVADAFAQVGVSVDGGVVEPPS
FT                   STCEAIALNNGVSSNIDSSSTGEWHCFTIDVPTNSSDFTVTTSGANGDADLYVKLGSEP
FT                   SLTSYDCRSYSSNSNEACSITSPNEGTWHIGVYAYSSYSNLNVEASYVGQEAPPPSDEV
FT                   TTQSINNGKTWTAIITGSGLMNGVWNVISNTPCDNDNECSLSGIGKKTSEVSFTLTDGT
FT                   VFIIAKP"
FT   gene            295456..296820
FT                   /locus_tag="VEA_000275"
FT   CDS             295456..296820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000275"
FT                   /product="succinyl-CoA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52963"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U0"
FT                   /protein_id="ACY52963.1"
FT                   /translation="MKTIKTSIALLVGAALLSGCNDDTEYVNVQPKEVKIATYNLSFDR
FT                   ATFEALVSEMQIEPAQQTVLVTAYLDGSIAAEDKTTAEKVIQIRNVAAIIQKNRPDVLM
FT                   MAEYNNDGTGENKAALEGFQKNYLSVAQSINGAGGEANLEPIEYPFAESYSTNTGLLSE
FT                   FDLDNNGTAGQMPGDAWGFGMYHGQYAFALMSKYKIDTANTRTFQAFKWKDMEGTKIPT
FT                   ITICDGSQKIPDGMKCGDEWYSAEEWDQVRLSSKNHVDAPIIIPTRNGEEVVHLLMSHP
FT                   TPPVFDPGKNKAQNAAEVEFWHHYIQGKDYFYDDAGKKGGLASGAKFVMMGDQNLDPVA
FT                   GDGISSVMQELHNDPLVNQTVMNGELYPTSFGAAEHAVDRSSTHPYPNRITSTFGLGVD
FT                   YALPSANLNVVDSGVYWSASYEEGRKLFNDARIGKYGDGKDVSSDHRMIWIKAQF"
FT   gene            complement(297111..297644)
FT                   /locus_tag="VEA_000276"
FT   CDS             complement(297111..297644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000276"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52964"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U1"
FT                   /protein_id="ACY52964.1"
FT                   /translation="MVSLRSYIPPPWVLVLIGLVLNIGAIVLTSLVLDRLGKQYSQLAE
FT                   QKAENLYSIQLAWNSVETLERKREALLLHLHIGQSAAIPSEIEQIVEGHLSSWTHHESD
FT                   KIQIDKLPQLMSKINQAQASYRDRIDDYYIENVELNELMAKQDEKIAWYKNIGLFLQVF
FT                   GLALILARDLARKP"
FT   gene            complement(297638..298024)
FT                   /locus_tag="VEA_000277"
FT   CDS             complement(297638..298024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000277"
FT                   /product="glutathione S-transferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000277"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52965"
FT                   /db_xref="GOA:D0M8P8"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8P8"
FT                   /protein_id="ACY52965.1"
FT                   /translation="MITALYASILAILIIWLAVQVIKQRRLNQVAYADGGVEALQIARS
FT                   AQSNATEYIPITLILMALLEFNSAYPTWIHLTGIIFVIGRIIHARGILKEDLKRRVRGM
FT                   QVTFLVILSLVVLNMIYLPYDKLW"
FT   gene            complement(298222..299127)
FT                   /locus_tag="VEA_000278"
FT   CDS             complement(298222..299127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000278"
FT                   /product="RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000278"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52966"
FT                   /db_xref="GOA:A7K2U2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U2"
FT                   /protein_id="ACY52966.1"
FT                   /translation="MNNTRYGTFMAAFSFVIWGLLPIYYRYLPNASMDELLAWRIIGSV
FT                   PVGFLIVLGITRRGPSWKEIWCDKKSLWYTFVASSLMCISWSAFTWALTHHRVIDASLG
FT                   FFIGPLVSVALGVFILGDKLSKGKLIAIVLATIGVMYQVIHYGQLPVIALTMGLFFALY
FT                   GLYKKKITYDWSTTLFVEALLLTPVAVAYLFYKQWTVGELASGVDITTLLLYFGSAPIT
FT                   LLPLIFYSIAIRITNLSTVGLMQYIEPSLQFVLAVMFFGELFDEVKAVTFAFIWVGLLF
FT                   TIFESIVKGHKRKKLANHPL"
FT   gene            complement(299229..299951)
FT                   /locus_tag="VEA_000279"
FT   CDS             complement(299229..299951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000279"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52967"
FT                   /db_xref="GOA:A7K2U3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U3"
FT                   /protein_id="ACY52967.1"
FT                   /translation="MEFDSINLLAIGLIFLGSYVQTAIGFGLAIVAAPLLILWAPEYVP
FT                   APICLVALFISLMNAMKHRSSVEIGGLKMALIGRVLGSVAGGLLLFFVSTQALTLWIGF
FT                   LVLFAVVVSVLPFRVEPTPARMTLAGFFSGLFGTSSAIGGPPMALLLQHQEANQLRGNL
FT                   SAFFVFSSIISLVVQIPAGFFTLHHLVITIPLLPAAALGYWLAMKTTQSLPKEKIRFGA
FT                   LMLCFVSGFTAVVQALNQ"
FT   gene            300398..300928
FT                   /locus_tag="VEA_000280"
FT   CDS             300398..300928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000280"
FT                   /product="MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000280"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52968"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U4"
FT                   /protein_id="ACY52968.1"
FT                   /translation="MRKQTGFTLIELVVVIVVLGILAVTAAPRFLNLQSDAREARLEGM
FT                   KGAIASALGVGYGKMAITGLESKSYVSNFVDSALMADLPFDGCNIGGSKRCVFLYGYPD
FT                   SDSESMKLLVQGLNEEGSDWKTFHHPAGSTTREMVIAAVDEKRASLTQCGILYGPPQAP
FT                   NESYTLKILPCPQ"
FT   gene            complement(300977..302005)
FT                   /locus_tag="VEA_000281"
FT   CDS             complement(300977..302005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000281"
FT                   /product="chemotaxis protein CheV"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000281"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52969"
FT                   /db_xref="GOA:A7K2U5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U5"
FT                   /protein_id="ACY52969.1"
FT                   /translation="MHQTFSDAYFGWIIGFMSNVTSTILTESGTNELEIIEFHLEKTLP
FT                   DGSTKTCYYGINVAKVREVIRVPETTDYPNAQPHMIGVFSSRDVLTPLVDLAGWLGVPT
FT                   RQDLERKFVIVTDFNKMTNGFLIDSISRIHRISWNDVESPSQFLEAGEQDCVVAVVRKE
FT                   GNLIMILDFEKIIADINPELSMEKYDVKGDKSVDLNQRMVGKRNAKTIMVVDDSAFIRS
FT                   LIQDTLASSGYNVITCKDGGEAHEKLMSLIEVAKEENLPVKELLDAVVTDVEMPRMDGM
FT                   HLVKRLRDTEAFHEMPIIMFSSLMSEDNRAKALSLGANDTITKPEIGRMVNMMDKYVFN
FT                   FA"
FT   gene            302436..303044
FT                   /locus_tag="VEA_000282"
FT   CDS             302436..303044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000282"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000282"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52970"
FT                   /db_xref="GOA:A7K2U7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U7"
FT                   /protein_id="ACY52970.1"
FT                   /translation="MNNVLIIDDQPLYSEALTSLVESVIITAEVIQSKDSAEVMDLVRN
FT                   TKIDFIILDVVLGDRDGMRLAKNILATGYQGKLLFISSRDYSSLSKAAYEMGAHGFLNK
FT                   NETKEAITDAIVSVSRGYSMFKSTHAPSNGDVTLSNREAMVFHYLAQGYSNKRISEQLS
FT                   LSAKTISTYKTRILKKYHADSLIELLHTIPSAENIQCDR"
FT   gene            complement(303041..303928)
FT                   /locus_tag="VEA_000283"
FT   CDS             complement(303041..303928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000283"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52971"
FT                   /db_xref="GOA:A7K2U8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U8"
FT                   /protein_id="ACY52971.1"
FT                   /translation="MNKDLDLNLLKILVLLEKHRQLKPVAKALGKSEASISKYLARLRI
FT                   QLGDELFIRHPHHLEPTNFLMRQLPKIADALDNLETCLVRSEFKPEKYSKDITVCLPQT
FT                   AQYSFGHLLAMDLMTLFPKAHITVATITEYTVDEILLGKVDAQLHYFNDELPKSIHQKF
FT                   IGYAPAVVVVPEELGITTLGEAAKLPFIMLEIIGWKEKEQLAKRAMENHGMVINRIAAL
FT                   DNVSSVLKLLKQKKAATVFLEYQAPIEGYRFIRIPESYYPNGWPKVVLQMKQSHRHDAM
FT                   HQILTDAIAKYMKN"
FT   gene            complement(304065..305426)
FT                   /locus_tag="VEA_000284"
FT   CDS             complement(304065..305426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000284"
FT                   /product="putative two-component response regulator and
FT                   GGDEF family protein YeaJ"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000284"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52972"
FT                   /db_xref="GOA:A7K2U9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2U9"
FT                   /protein_id="ACY52972.1"
FT                   /translation="MNVRSFVSSFAVAMLLFIVSVTMIGAVLISYEEKQFNTYANNLAK
FT                   TKQKVILLGLLTEAQLAQYENFSIEQIEVLTDFSFQDAIYALKPYKNLDYVETVARKAL
FT                   HQAEAHLSNVYDREDAILYFRSYTSDKLILERPIPALEGSKETFDIEWCRVNYACILAA
FT                   WKEQLSDRVLISKPFKTTYSDEMALSIMSPVYYRGKLVGEFSEQLYLSSLYNEGKAVDV
FT                   EVSNGNKQIIIYFPSYPLAHFAYTQSYVADNNNLVIYQYPFSKIVVDYSFILVIYSVVA
FT                   FAYYRKANESKQSKIQLENALSDVTQDDLTGLLNRRVFKEERFKHRMEVEPYSIIAIDG
FT                   NRIKKINDRYGHHVGDEVIVIIADSMRKVFRNSDYLVRTGGDEFIVILPGCSMSKASML
FT                   AKKLRGVVKHNRLNTLDIEISVSTGVAVREEDETLQEVIVRADEELYEMKKQRV"
FT   gene            complement(305433..305582)
FT                   /locus_tag="VEA_000285"
FT   CDS             complement(305433..305582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000285"
FT                   /product="response regulator VbsA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000285"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52973"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V0"
FT                   /protein_id="ACY52973.1"
FT                   /translation="MKKLNCLIFDDQMFICVAISDKTVSTKKRRFLDKFNVNDVIELAK
FT                   VVGT"
FT   gene            complement(305587..306741)
FT                   /locus_tag="VEA_000286"
FT   CDS             complement(305587..306741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000286"
FT                   /product="response regulator VieA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000286"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52974"
FT                   /db_xref="GOA:A7K2V1"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V1"
FT                   /protein_id="ACY52974.1"
FT                   /translation="MNTQLNVMVIDGHPLQTKILTQILGHSGASVSTFNCVDTASQCAQ
FT                   EQYFDVIFCDLQMPGKGGIDILEVFDQIQYHGQVVLVSLLEQSIISAVREMCEGFSFEI
FT                   LGELPKPYDEMQVVKLLNQIKDERTRKTAFAQPLVLQDQEFLFALGEGRVKNYYQPLVD
FT                   AHSGELLGYEALARWVHPIYGVLLPNHFLPIVKRCHLSSELFQSVLINTIYDINNRGLT
FT                   QKVSINVDHENLNDPDFSHRFIQQCSESGVDPSQITIEITEREAFQASTSIYKNLIKLR
FT                   MKGVTVSIDDFGTGSSTFEKLAKLPFNEIKLDRVFVYGASEDLKKKSIVIAICALAKSL
FT                   NIRIVAEGVEDEVTYKTMRECGIDICQGFYIDKPMPLEVITILK"
FT   gene            307420..308364
FT                   /locus_tag="VEA_000287"
FT   CDS             307420..308364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000287"
FT                   /product="50S ribosomal subunit maturation GTPase RbgA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000287"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52975"
FT                   /db_xref="GOA:A7K2V2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V2"
FT                   /protein_id="ACY52975.1"
FT                   /translation="MVNNSIQWFPGHMHKARKEIEEAIPQVDVIIEVLDARIPFSSENP
FT                   LISQIRGDKPVVKVLNKRDLADPELTQLWIEHLEQEQHVKAMAITTSEPQEVHRIMELC
FT                   RKLAPHREEIGKNIRTMIMGIPNVGKSTIINTLAGRTIAVTGNQPAVTRRQQRINLQNG
FT                   IVLSDTPGILWPKVENPHSGFRLAATGAVKDTAMEYDEVAFYTIEYLAAHYADKLKERY
FT                   QIEELPESDIEIMEEIGRRRGALRAGGRVDLHKVSEILLHELRQGTLGQITLERPEMIT
FT                   QELIEVEIETARKEEEKAKRKEERRKRYLRNKR"
FT   gene            308704..309885
FT                   /locus_tag="VEA_000288"
FT   CDS             308704..309885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000288"
FT                   /product="8-amino-7-oxononanoate synthase/CqsA"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000288"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52976"
FT                   /db_xref="GOA:A7K2V3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V3"
FT                   /protein_id="ACY52976.1"
FT                   /translation="MSETIQSKPLPSFIEERLDFHIQDLIEPNENKKHLVLGKRPPCNA
FT                   VVMQSNDYLALSHNKEIQNAHRDAISQHDDNVVMSAIFLQDDESKPAFETQLASFVGMP
FT                   SCLLSQSGWAANVGLLQTICAPNIPVYIDFFAHMSLWEGARIAGAQIHPFMHNNTNHLR
FT                   KQISRHGSGIIVVDSVYSTIGTIAPLRDIYEIAQEFDCGLVVDESHSLGTHGPQGAGLL
FT                   QELDLTHMVDFVTVSLAKTFAYRAGAILGAEKLAKTLPFVAYPAIFSSTVLPQEIIRLE
FT                   KTLDVIKKADDKREILFKRAKSLAVGLKRIGFTIRSESQIIALECGNERNTERVRDFLE
FT                   ERNVFGAVFCRPATGRNKNIIRFSVNADMTAAEVDHVLSACQEAFVHPDLEFV"
FT   gene            complement(309989..312034)
FT                   /locus_tag="VEA_000289"
FT   CDS             complement(309989..312034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000289"
FT                   /product="sensor histidine kinase CqsS"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000289"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52977"
FT                   /db_xref="GOA:A7K2V4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V4"
FT                   /protein_id="ACY52977.1"
FT                   /translation="MDSIRKVYQYAEPNLTLVGWMGFLGFPLYYFVWDFVFPQAYENLP
FT                   LRLFCSLLFFGIIFRNRLSSTWRKYIHIYYQVTITICLPFFFFYMLLMNDWSNVWVMSF
FT                   MSAIFLHILLVHVTRVMFAQTFAGIGLATFFAWVAKGFHLDLTMDWTHVPIFLFIYVFG
FT                   NLFYFRNQVEHEAKVSLAKSFGAGIAHEMRNPLSGLCTSIDVIQSVLPSKKEAEKDQYL
FT                   MSGEDVTLLREVSEDAMNIIQSGNETIDLLLTSIDENRVSRSSFQKHSAHSVVEKAIES
FT                   FSYKRATDRFAISLDARSEFDFLGSDTLLKYVMYNLFKNAFHHRTSEDFHIHVSMTSTE
FT                   HSNQIVVTDNGAGIAPDVLRNIFQDFYTTGKSGSYGLGLPFCKKVMRSFGGNIECQSQL
FT                   GEWSQFTLTFPPITSDIVTEIKNDLTKLKTILTVTNQDILVSKVTDISRFMGFESTILD
FT                   VNQVLKKKEYEFEFDLIFIDLESLDARANQLDRLESLLSFTEARIVYLFEHHPTQRACK
FT                   AAYEPIWVETQAWLLNTKPTIDRLLYDSSYVSTPTASVALDTSNKRTIMVVDDNESLRK
FT                   FTAMLLEKQGFEVIQKEDGQQALDTLEQENVDLILMDIEMPIMDGVEASRRIRSSDKNY
FT                   ASVPIIAHTGDSSPVTLDKIGSSGMSDFIVKPADKNRLFDKIANWI"
FT   gene            312402..313019
FT                   /locus_tag="VEA_000290"
FT   CDS             312402..313019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000290"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000290"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52978"
FT                   /db_xref="GOA:A7K2V5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V5"
FT                   /protein_id="ACY52978.1"
FT                   /translation="MEPLQIKNVIFDVGNVLVRWSPVEIVRLTFGHSIEAEKMAQLLFS
FT                   SQIWKDLNKGIISETEAKLCYQREHQMTAEEMDRFFYYVKHTQILLYGSVELLKRVKSA
FT                   GYRVYALTDNVNEIVEHLRATYEFWPLFDGAIISSEVQLIKPQPEIYQALLSTYQLQAE
FT                   ETVFLDDMPYNVEGARAVGMEAIQFENAQQCESELKAMGLCF"
FT   gene            complement(313106..313654)
FT                   /locus_tag="VEA_000291"
FT   CDS             complement(313106..313654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000291"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52979"
FT                   /db_xref="GOA:A7K2V6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V6"
FT                   /protein_id="ACY52979.1"
FT                   /translation="MDLRLAEYKDYERIAHLHADSWKRHYRGILSDNYLDKEAIDDKLL
FT                   IWQTRLTNPPFNQHIVLAEEGGLLLGFVCVFGNHDFERGTFIDALHVDDSYRGRGIGKQ
FT                   LLLAVAEWQQQYFKDTGLYLEVVSQNISAIEFYRHIGGQECQERTWRAPGGTEVLEKVF
FT                   RWKNAQSLVSGIEENVIYS"
FT   gene            314062..315051
FT                   /locus_tag="VEA_000292"
FT   CDS             314062..315051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000292"
FT                   /product="fatty acid desaturase"
FT                   /EC_number="1.14.19.1"
FT                   /note="most likely function alternative not yet resolved;
FT                   delta-9 fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000292"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52980"
FT                   /db_xref="GOA:D0M8R3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8R3"
FT                   /protein_id="ACY52980.1"
FT                   /translation="MAFSFTNLSITAGYHRLWSHKTYEAHPILRAIFAIGGAFSLQNSA
FT                   LHWSSDHRVHHKHVDNNDKDPYSAKRGFWYSHIGWMLRDYNKSQENEYTNCRDLKRDKI
FT                   VMWQHKYYVPLALLTNIGFPVALGIIYGDIWGMLLVVGAARLFMSHHTTFFINSLAHVW
FT                   GKQTFTDKNTARDNGVLAFFTFGEGYHNFHHIFENDYRNGVYWWHYDPTKWLIKSCSWL
FT                   GLTSKLRTTPTFRIEKARATQLLKKAKEKLGAKPNTQTILDQLQHEFDSLVHHMQEYYE
FT                   MRKEVLGAKTASVVKKYECSVTKIKYQQIKAEFERQQRSWNLMVRRYA"
FT   gene            315407..316774
FT                   /locus_tag="VEA_000293"
FT   CDS             315407..316774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000293"
FT                   /product="anaerobic C4-dicarboxylate transporter DcuC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000293"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52981"
FT                   /db_xref="GOA:A7K2V8"
FT                   /db_xref="InterPro:IPR004669"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V8"
FT                   /protein_id="ACY52981.1"
FT                   /translation="MLELLIGLVVTIAVGYFIVKGYKAAGVLLTAGIALLLMTGVLGHD
FT                   VLPSKITSTGNMVTDALEYVKYMLQYRGGGLGMQIMLLCGFASYMTHIGANNVVVKQFS
FT                   KPLSVIKSPYVLLVAAYIVACLMSLAVSSATGLGVLLMATLFPMMVAMGISRPAAVAVC
FT                   ASPAAIILSPTSGDVVIAAEKSGLALDVFAVQTVLPVSICAIIVMAAAAFFWNKYLDKK
FT                   ENTPMEKIDVSEIKADAPAFYAALPFLPIIGVFLFNGRTIPGLSLDIYTIVVGSIFLGA
FT                   LIHYVVNKFDGKKSLEDLDSCYAGMADAFKGVVMLLVAAGVFAQGLMSIGAIDNLLHLA
FT                   DNAGAGGVALMLILTALTVAAAIATGSGNAPFYAFVELAPSLAAKMGLNPAFLIIPMLQ
FT                   ASNLGRTISPVSGVIVATSGMANISPFEVVKRTSVPVLAGLITVIIGTMVLVPMSA"
FT   gene            317001..317591
FT                   /locus_tag="VEA_000294"
FT   CDS             317001..317591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000294"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000294"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52982"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2V9"
FT                   /protein_id="ACY52982.1"
FT                   /translation="MTAFIVFIVIVLLVVVYAVSIYNKLVTLQNRFKNSFAQIEVQLKR
FT                   RYDLIPNLVNTAKGYMEHEKETFERVIQARNQAIAGLKAASDAPGSDAAISQLNQAEGM
FT                   LQSALGKLNVVVEAYPELKANETMSQLQEELTSTENKVAFARQAFNDAVTSYNTYKQTF
FT                   PPVLFSNAFGFQDGKLLEFSDSAEIQAAPKVEF"
FT   gene            317591..319480
FT                   /locus_tag="VEA_000295"
FT   CDS             317591..319480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000295"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000295"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52983"
FT                   /db_xref="GOA:A7K2W0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2W0"
FT                   /protein_id="ACY52983.1"
FT                   /translation="MDFFDHQDTARQRTGLLVFLFSLAVVTITGLVSVLSIGIYYGVTG
FT                   EHFDQETALTYVLLCFAGVLLVVAISSMVRLSALTSNGGRGVAESIGGKLISSNTLDAK
FT                   HRQLLNVVEEMAIASGIPVPPVYVMQEERGINAFAAGMSIDDAVIGVTQGALDSFSRDE
FT                   LQGVIAHEFSHILNGDMRLNTRLIGVLFGITCIAHFGHLVLDNTHHTSRVSRSSSDSDK
FT                   GFAVIMLIAIICLVLGWIGTLFGSMIKAAISRQREFLADASAVQFTRNDQGIAGALKKI
FT                   GSHMAGSSLNTKASDEMSHMMFGQSKLSGFSGLFATHPPLEERIRRIEPGWDGSFSQSS
FT                   HRPTTSFENDNVSGFTSGTSTQPEKPTTAELSEVGQQLLNQLPSELVDIAREPYSARFI
FT                   AFALIFDGSELQREMIKSHIPNVSQAQLLPWLDYDLPLHLRFPLLELSIPALKSLSEGQ
FT                   KNRLCQVLRELSQTDDHYSLAEWCVINLLEKQLLESYGCTKQIQSLKQLKESVFWLLRE
FT                   LAWVSHSQPEDAQRAFSSALTCLGFNDAELQPANKNWGLNRAALELLLQLKPKSRRLFV
FT                   KACRLAIKSDGKVTVAEGELYRVIACFLEVPEPPLTVSVNTGQTLPSQTQQAN"
FT   gene            complement(319549..319905)
FT                   /locus_tag="VEA_000296"
FT   CDS             complement(319549..319905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000296"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000296"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52984"
FT                   /db_xref="UniProtKB/TrEMBL:A7K2W1"
FT                   /protein_id="ACY52984.1"
FT                   /translation="MKLFLLLMASVSAGVASADHIHSFMLGLSIASLAVGSCYFFAFRS
FT                   SRFPQLALFLLICGMLSKLTITVVGVMWGMSAELITSPIVFALSYLFFSLAVTYLWFSY
FT                   RESITKIPDRFKSA"
FT   gene            320477..321715
FT                   /locus_tag="VEA_000297"
FT   CDS             320477..321715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000297"
FT                   /product="oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000297"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52985"
FT                   /db_xref="GOA:D0M8R8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8R8"
FT                   /protein_id="ACY52985.1"
FT                   /translation="MKMSKIDKAMRILLAGFCINLCLGILYAWSVFNKALVTESGWSAA
FT                   EASAPYATATITFSICLLVAGILQDRMGPRMILILGTVLTGLGMIASGFVDTPLMLNIT
FT                   FGVITGAGIGFGYACLSPSAMKWFHASKKGMVNGIIAAGFGLAAIYLAPVTSSLIDSMG
FT                   IQTSFMVLGVGILAIAVPLAATINNPPADYTPAEPKVKEGQAPKAVQKSDDLTWKAMLK
FT                   TPQFYSLWIMYAFAASVGLMIIGNITTIASVQANLPNAVYLASILAVFNSGGRVAAGML
FT                   ADKIGGVRTLLLAFVLQGVNMVLFATFDSEFTLIIGTAIAAVGYGTLLAVFPTLTAEFY
FT                   GLKNYGTNYGVLYTAWGIGGAIGAAVVGFSMTNGEGYTLAYTISSAMMAVCIVLAFITK
FT                   PLSEAKVAQLKNA"
FT   gene            321783..323396
FT                   /locus_tag="VEA_000298"
FT   CDS             321783..323396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000298"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52986"
FT                   /db_xref="GOA:D0M8R9"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8R9"
FT                   /protein_id="ACY52986.1"
FT                   /translation="MESPIELAPDYYLENFFKLTHHAVTWYSDLLAEEEHAWLCSFDSL
FT                   SKHAQCLLVRLYSRKGCWFRSDKLSYQEIPSINEALAELSQHEFVALSPTLSHQELASN
FT                   LLTKPEISALYPELPKSLKKDALVERLSNTEFDRFEQLEFTIIKLNSAHMIDVLLTLFF
FT                   ANTHQDLSQFVLDDLGLHQFEQYQLSKVRRFFDSREQIDRLIELSQLANLYWQFDRKDK
FT                   ANLDLLIEAMPQPVNHHYVDRKREHMLNDIARDYERLNDLETALSLFSQTQLAPSRERR
FT                   ARIYDKLNQDDLFSDIVTEILQSPIDVSELEVAQKLEQRLKRKQGAKVPRVAKPLCSEY
FT                   HIELDLSQQRVELASKAYFESLGWTVFYAENALLNALLGLTFWDAIFAPIEGSFINAYQ
FT                   HRPLDLYHSDFVTKRQALIDTAFAELEAGNTQTLLTKYDEKFGISNPFVHWNLISKELL
FT                   ETALNAIPTNMLMALFKIQLSDLKLYRNGMPDLIAFKENEFEWIEVKGPGDKIQDNQWR
FT                   WIKEFTRLNVPFAVCYVAAT"
FT   gene            323563..324210
FT                   /locus_tag="VEA_000299"
FT   CDS             323563..324210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000299"
FT                   /product="accessory colonization factor AcfA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000299"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52987"
FT                   /db_xref="GOA:A7K4I7"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I7"
FT                   /protein_id="ACY52987.1"
FT                   /translation="MNKTLLALLVTCSVSVSAAPYVGLEYGLGTTDHDLEPHFSTDNVT
FT                   LNPEIEDGIFSGFVGYAFNDNWALELGYSQFDLDDNRSKNLGIKQIDGKDYHHEMDWDA
FT                   SIKAKQVSLSPVFSYALNNKWTTKFKAGLTYTEYNAKVSKHQEYELVANDDVEMNNTLF
FT                   HNTEKNNELGAMFSLGAEYRIFPQLTIGANAKYQLDSYANTASFNVGTTYYF"
FT   gene            324226..324561
FT                   /locus_tag="VEA_000300"
FT   CDS             324226..324561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000300"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52988"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I6"
FT                   /protein_id="ACY52988.1"
FT                   /translation="MKKMILASMFALLSSSAFAAFNGPEVSVINSVKEAHNATDDSAVM
FT                   LTGHIVQSLGNETYLFKDETGEIEVEIDNEDWMGLDVGPNDKVKIRGEVDSEWTTTQID
FT                   VETIQKL"
FT   gene            complement(324639..325541)
FT                   /locus_tag="VEA_000301"
FT   CDS             complement(324639..325541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000301"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52989"
FT                   /db_xref="GOA:A7K4I5"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR022862"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I5"
FT                   /protein_id="ACY52989.1"
FT                   /translation="MKKTIRAILNGKKAGNPELRDAIMKMRDKGVDVQVRVTWESQDMP
FT                   RLVKEAVDEGIERIVVAGGDGTVNEAASAIIQIEEEKRPELAIIPLGTANDFATAIQVP
FT                   ASIKASLSLAVEGQSALVDCVKANDRYFINVATAGFGAEVTAETPVELKNFLGGGAYTL
FT                   TGVVKALGFKPYDGTITIEGGAYQGEMLLGAFCNGRLAGGGQELASKAMINDGLMDLTL
FT                   VRPFLPHELPKVIEEINNPSEKGEFVKHTRASWLEIDFPNPLPLNLDGEPYHSRTIRFD
FT                   VQPKSIRLVLPQDCPCLVS"
FT   gene            complement(325550..326455)
FT                   /locus_tag="VEA_000302"
FT   CDS             complement(325550..326455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000302"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000302"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52990"
FT                   /db_xref="GOA:A7K4I4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I4"
FT                   /protein_id="ACY52990.1"
FT                   /translation="MKPTDLNLIPIFIAIYEEGNLSKAAARLSITQPAVSKALARLRDI
FT                   YDEPLFHRCTKGVEPTSFAMDIYPALLTSVQNFTSTLTASSEFDPKVSNRVFSIACVSV
FT                   ASFELLPQVMKQIRELAPHIALEVHPLFTEDFESDLRLQRYDLIIDIAPRARTVLKVET
FT                   VLTERLVVVCSEEHPRLKNEITAEQFFEEEHVVVSQWQSRKSLLNADDIVDLDKRKIKY
FT                   RASGVLEMLPVICGSEYIGLMPESMINLFNNTYHVKSLFMPFDEQTYELCTIWHPSRTN
FT                   DSAHQWLRSQIKRAGKTINQ"
FT   gene            complement(326629..327054)
FT                   /locus_tag="VEA_000303"
FT   CDS             complement(326629..327054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000303"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase"
FT                   /EC_number="3.5.4.26"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000303"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52991"
FT                   /db_xref="GOA:A7K4I3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I3"
FT                   /protein_id="ACY52991.1"
FT                   /translation="MSHEFMRRALEVSKNALPECQPNPPVGCVLVKDNQIVSEGHTQAI
FT                   GGNHAEVEALNAYQGSLESVTAYVTLEPCSFVGRTPACAVTLVKSGIGKVVVAMLDPDP
FT                   RNSGRGIEILKQAGIEVEIGLCGEEVSEFLTPYLGKS"
FT   gene            complement(327104..328420)
FT                   /locus_tag="VEA_000304"
FT   CDS             complement(327104..328420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000304"
FT                   /product="BatD"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000304"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52992"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I2"
FT                   /protein_id="ACY52992.1"
FT                   /translation="MMMNAHRVTSFALPARIVAWLVVCLSLFVSRHVFAQDIYDLQRNH
FT                   GVELQAWVGQQPTAGEKRKTPSFSVNEQVILTIEVATPRWFTGGTRIGSIEMPNVIAKQ
FT                   RNQLATNFTEHKGGQTWSRQRWEVTLYPQASGDFVIPPVAVGVQVSAPDGEKVSGTLYT
FT                   QPIKFKTVLPSGLLSGDTPWFSATHVDVKQEWETSTESLKVGDAITRKITISAQDSLSV
FT                   LLPDLLKGESTTRYQAYPQPHRLTDTQTRGDYQSTRTEESVYVIQQGGELTLPDYEFRW
FT                   WNSKTQQVETVVLEGKTFAAKHTLKSFIKTYFAWIVSTLVLLGFVTVSLVAIKRYYRNR
FT                   PTPEWLTFHRLLKAKRWAEARTLLYKQLRLNTAELEMTKADTSESWQKSASRMQNGENS
FT                   AHLMKSMWRKIQTKQQRFKLRIPRALPELDKVIGRDGNE"
FT   gene            complement(328417..330147)
FT                   /locus_tag="VEA_000305"
FT   CDS             complement(328417..330147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000305"
FT                   /product="TPR domain protein in aerotolerance operon"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52993"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I1"
FT                   /protein_id="ACY52993.1"
FT                   /translation="MFDSLSWTQFFTQFHFIRPLWLLALIPMFFLVWLRWREESKPSWK
FT                   DILPEHLRNALTIGEQGWRKQLPLKLLMLIVLIAIVICAGPTWQRESSPFGEDKASLLV
FT                   VLDNSDSMLQKDLPPSRLERSKQKIRDLLAARKGGKTGLVVFAGSAHVAMPVTQDSKVF
FT                   DPFLAAITPEIMPVQGKLAEKALPLIDQQLQGQPGSTVLLVSDGVNPATIKQYQAYFSG
FT                   KPYQLLILAAGNTDIVSNNPMDLDSLQKLASQTNGRLVEVTVDNSDVEQLNRYVERNMQ
FT                   LNGESSMPWKDMGYQLLFPIALIMMLWFRKGWLVQWCVIVMVSGTLLMPTSAMAENISV
FT                   KAEQPQAVQKVTTFDKVAQWWWDLWLTPDQQGQRLFNQQAYLEAAKHFVDPLRKGTAYY
FT                   YASEFELAHSAFLEMQNDPSEEVRDYGLYNAASALARQREYLAARDLLKSLASKPTLSE
FT                   SLRPDVEHNLKVIAGIVDEINQMSESQAGTEQEASTELGDNPQTSEGADEQTSAELMIK
FT                   ETLSADDILGSQELADKWLKRVEADPKYFLRAKFQIQLRSPTTGNSTTTTEHNTEEAAQ
FT                   "
FT   gene            complement(330140..331210)
FT                   /locus_tag="VEA_000306"
FT   CDS             complement(330140..331210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000306"
FT                   /product="protein BatA"
FT                   /note="Bacteroides aerotolerance operon"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52994"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4I0"
FT                   /protein_id="ACY52994.1"
FT                   /translation="MNDLLVSLTGLSGFEFAHPMWFLILPLPLVVYYLVPAYRTKQMAI
FT                   KVPFFSQLVEAIGETPSEGASQLTPSWWQRATLILSWLLVVCAMAKPTVLGEPQVRESL
FT                   GRDVMVVVDLSGSMAEPDFTSRTGEKISRLDAAKEVLTEFVQSRKGDRLGLVLFGDAAF
FT                   VQTPFTVDQKVWLELLNQTDVAMAGQSTHLGDAIGLAIKVFEQSDKSRGALEQDQNREK
FT                   VAIVLTDGNDTGSFVEPIDAAKVAKAKGVRVHVIAMGDPETIGETALDMDTIHRIAKES
FT                   GGEAFEALNRDELSAAYDEIGKLEPQLYESTTYRPKQSLHHYLMALVVIMHLLAFSVAT
FT                   LKRRAATRSSLGESDV"
FT   gene            complement(331203..331781)
FT                   /locus_tag="VEA_000307"
FT   CDS             complement(331203..331781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52995"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H9"
FT                   /protein_id="ACY52995.1"
FT                   /translation="MSGLPTPPSTYILRDLHDVAVPPSVSWYPQTIGWKILAAVALIAL
FT                   LYVVYRLARQWWHNRYRKEALLAISQIKPSDKGMPKTLFSVLKVVLIHVDSRNAKLFDA
FT                   VFLRKLDALYPQTGDSLANSQVVFNDELSKRWLQSIVDPSVTLTNEERVTLIARAKNWV
FT                   SEHRCNAQKDITKKSPLLKRKANQGGQHE"
FT   gene            complement(331782..332744)
FT                   /locus_tag="VEA_000308"
FT   CDS             complement(331782..332744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000308"
FT                   /product="DUF58 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000308"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52996"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H8"
FT                   /protein_id="ACY52996.1"
FT                   /translation="MAKPTLAPKSQGMDPRLYCDYARLVRLQAQAESFSLLPHLKAGSV
FT                   LSGHHNSLFRGRGLNFEELRHYQLGDDIRNLDWKVTMRTGKPHVRSYTEEKDRNVIVCV
FT                   DQRSTMFFASTQVMKSVVAAEIAAMCGWRVLKDGDRVGFVIASQQALFHSKAQRSQNDL
FT                   LAQLKRLAKANQSLNVDSRNSEKVTFSQWIELIKRMKLKQSTLIFISDWSDCEEHHLDH
FT                   LKQLQQHNNVLAVMVSDPLEQALPDDLAKSKWVVGDGQYQLNLDSKAKVEAASAKLEAR
FT                   TSLQRQSLSQLMAMKHLPHIELDTTGEHIKQFQKLVGGR"
FT   gene            complement(332757..333740)
FT                   /locus_tag="VEA_000309"
FT   CDS             complement(332757..333740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000309"
FT                   /product="MoxR-like ATPase in aerotolerance operon"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000309"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52997"
FT                   /db_xref="GOA:A7K4H7"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR016366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H7"
FT                   /protein_id="ACY52997.1"
FT                   /translation="MNHAQQAIKELIEQTEKSVIGQSHVVRALVIGLLTNGHILLEGLP
FT                   GTAKTRSVKSLANLLNTSFGRIQFTPDLLPSDVTGTEVYQELDGKPQLHFQPGPIFNSI
FT                   VLADEVNRAPAKVQAALLEAMAEGTITVGDKTHVLPDLFMVLATQNPVEQEGTYPLPEA
FT                   QMDRFIMKVTVDYPEDEAERDIIRLVRSEELGAETSSEIITPKHIEPDVVLEARRQLPD
FT                   IVVSDLVENYIVALVMATRKPERYADSNLAKWIEIGSSPRASIALDKCARAYAWMQGRD
FT                   HVTPDDVRAMVPSVLGHRFSLTYDALADGVDHQRVVQELLDCVEIG"
FT   gene            complement(333826..335127)
FT                   /locus_tag="VEA_000310"
FT   CDS             complement(333826..335127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000310"
FT                   /product="arylsulfatase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52998"
FT                   /db_xref="GOA:D0M8T1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023867"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8T1"
FT                   /protein_id="ACY52998.1"
FT                   /translation="MSKISPRHSTTMPIVPLKTASKATVPGAYDRRFHVMAKPGGAKCN
FT                   IDCQYCFYLHKENLLHQEKQPKMDDATLEAFVKSYIESQDGEEIVFSWQGGEPTLLGLD
FT                   YFRNVVALQKKHQPQGVRIENDLQTNGILLNDEWCAFLKEHNFLVGLSIDGPRELHDKY
FT                   RKTRSGKPTFDLVMKAVDKLQAHGVKFNALVTVNRHNAKYPLEVYRFLTQELGVTYIQF
FT                   APVVEANDFQTTAPQFWNEQMIPTKGSDLAKPGHPMSVVTDWSVDPEDWGHFLMATFEE
FT                   WVNNDLGRVLVNLFETAVAQVMGKPSQLCVTAEFCGKGLAIEHNGDVFSCDHYVYPEYK
FT                   IANIHEHSLNDMAFSTRQYTFGMAKRESLPTYCKQCPYLPYCWGECPKNRLIKTPNGEA
FT                   GLNYLCSGIKMFFDYALPMLVGLAQLLQSEEAQR"
FT   gene            complement(335242..336768)
FT                   /locus_tag="VEA_000311"
FT   CDS             complement(335242..336768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000311"
FT                   /product="arylsulfatase"
FT                   /EC_number="3.1.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000311"
FT                   /db_xref="EnsemblGenomes-Tr:ACY52999"
FT                   /db_xref="GOA:A7K4H5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H5"
FT                   /protein_id="ACY52999.1"
FT                   /translation="MKNATKTSSKKLVLNACTLALGAASAVAHAADKPNILVIFGDDVG
FT                   YWNLSTYNQGMMAYNTPNIDSIAKEGAKFTNFYAQQSSTAGRSAFITGQMPKRTGLSKV
FT                   GLPGAPQGISEKDPTIATVLKQMGYATGQFGKNHLGDRDEHLPTNHGFDEFFGNLYHLN
FT                   AEEEPENVDYPKDPEFKKKFGPRGVIHSYADGKIEDTGPLTRKRMENVDGEFLDAAETF
FT                   IEKQVKADKPFFTWFNTTRMHNFTHVPEEYQGKTGAGFYADGVKQHDDQIGQLLNKIKE
FT                   LGVDDNTIIVYTTDNGPMVDLWPDAGMTPFRSEKNTGWEGSFRVPMLIKWPGNIEAGKT
FT                   FNGMMSLEDFFPTLVAAAGDTKVKDELLKGKKVGDMDYKVHLDGYNQLPYLTGKSDKSA
FT                   RNEFVYWSDDGDLVALRQGKYKFHFMIQENETGMDVWRKPFTKLRVPLIFDLSIDPFER
FT                   GDQGMGYSRWMYERSFLMMPAVEKVKEVMGTFKEFPPRMEAGSFVPKSSK"
FT   gene            336909..337766
FT                   /locus_tag="VEA_000312"
FT   CDS             336909..337766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000312"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000312"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53000"
FT                   /db_xref="GOA:A7K4H4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H4"
FT                   /protein_id="ACY53000.1"
FT                   /translation="MDLNLIQTFLVVAEFQSYTKAAEQLGLTQPAVSAAIKRLEQVVDK
FT                   QLFVKKGRGIALTSTAYQLLPQFQQAVNIIDNAISDKNHFEVCCSEILLHIMDPIKNTI
FT                   FYESPPEKFLLFELLRQQKVDLVIDTVITKDAAFIIEDAYEEEAVIICRENHPRVQGSL
FT                   SKEQFYEETHCLFSGKWNNMSGFEQLSQETIQERKVDLITSSLAGMALYVAQRDCLGLV
FT                   SQSFANKWSKALKLQVLQCPISICAIPYKFVYHKREMNNPAHIALREKIKANLTVAHYE
FT                   PVSL"
FT   gene            complement(337889..339436)
FT                   /locus_tag="VEA_000313"
FT   CDS             complement(337889..339436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000313"
FT                   /product="arylsulfatase"
FT                   /EC_number="3.1.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000313"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53001"
FT                   /db_xref="GOA:A7K4H3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H3"
FT                   /protein_id="ACY53001.1"
FT                   /translation="MTAKYGVKRRLAILAAALIGATSSSIAAEKPNILVIWGDDIGQSN
FT                   LSAYTFGLMGYKTPNIDSIAKEGMMFTDYYGEQSCTAGRSTFITGQTVLRTGLSKVGLP
FT                   GADLGLKEEDATIAEMLKPMGYMTGQFGKNHLGDKDEHLPTNHGFDEFFGNLYHLNAEE
FT                   EPENVDYPKDPEFRKKFGPRGVIRSYADGKIEDTGPLTRKRMETVDEETLDAALDFMDR
FT                   AVKAEKPFFVWWNATRMHFRTHVKEENSGKTGISEYADGMVEHDNHVGQLLKKVDDLGI
FT                   KDNTIVFYSTDNGPHMNSWPDAGTTPFRGEKNTNWEGAYRVPAMVRWPGKIKAGSVSND
FT                   IMHHMDWMPTFVAAAGDDGIKEKLLKGYSANGKKFKVHLDGYNFLPYLTGKEEKAPREE
FT                   IFYFSDDGDLTALRYNKWKLVFMEQRAKGTLRIWAEPFTTLRVPKIFNLRMDPYEVADI
FT                   TSNTYYDWMLDRAYMLVPAQAYVGRFLETFKEFPPRQKAASFSLDQVMEKLKENPNK"
FT   gene            339869..340138
FT                   /locus_tag="VEA_000314"
FT   CDS             339869..340138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000314"
FT                   /product="signal transduction response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000314"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53002"
FT                   /db_xref="GOA:A7K4H2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H2"
FT                   /protein_id="ACY53002.1"
FT                   /translation="MINRPPDKKLVQLTSVQFELLRTLTHYQDQVLSKPFLYETVLKRT
FT                   FSEHDRALDMHISRIRKRLASEGIKADRIQTVHRQGYVFKHAKK"
FT   gene            340228..342582
FT                   /locus_tag="VEA_000315"
FT   CDS             340228..342582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000315"
FT                   /product="fatty acid cis/trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53003"
FT                   /db_xref="GOA:A7K4H1"
FT                   /db_xref="InterPro:IPR010706"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H1"
FT                   /protein_id="ACY53003.1"
FT                   /translation="MNLRLIFILCIATLFAGCATYAGLNYDQLFGPQLVRERTADVATP
FT                   QANFFQSEVKPIMDNRCVVCHACYDAPCQLKLSSVEGIDRGASKALVYEGTRLTAAAPT
FT                   RLFEDAETTQEWRDAGFHPVLNERDQSMVANIDAGLIARLLQQKERHPLPDQVQLEGFD
FT                   FSIDREQTCPTIEEYEQYEKDNPTWGMPFGMPNLSNSEYHTLMTWLENGAIMNVHQPIS
FT                   EQEQAQIDKYETLLNRADLKNQLMARYIYEHLFLSHLYFSELTEDPRFFTLVRSSTPPG
FT                   QPVKRISTRRPYDDPGVERVFYRIIPEQGTIVDKTHMPFALNKQRIENWNTWFIDADYT
FT                   VNQLPSYEPEVAANPMTSFIDLPVKSRFKFMLDNAQNTIMAYIKGPVCRGQLALNVIND
FT                   RFWIFFLDPDKADIPEVNEFYRSQADNLRLPAEQESNTLPVTNWVKYARQQARYLEAKS
FT                   EFTNNWFKEGENLSTDVIWDGNGTNHNAALTIFRHFDSASVVQGLVGEQPKTVWILDYA
FT                   LLERIHYLLVAGFDVYGNFGHQLMTRMFMDFLRLEGESNFISLLPTDMRHELQSSWYKD
FT                   QSPQLSDFLQRNVKPFNQPTSVEFKTDDPKTELVELLRERVSDVLLPRYEVKDTELSAQ
FT                   SEQQLQRIGQVRGEGLKTVPQITMLMVRSQSGKDELFTLLHNNAHTNISSLFDEESNRD
FT                   FANDDMTIVRGVVGSYPAAFFSINENQVKEFVDQFSAIQNESDYVKLLDNFAIRRSSEK
FT                   FWPFSDRLHNWYRTKQPIEFGLLDYNRFENR"
FT   gene            342601..342792
FT                   /locus_tag="VEA_000316"
FT   CDS             342601..342792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53004"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4H0"
FT                   /protein_id="ACY53004.1"
FT                   /translation="MGIRDNIAALEQQIYVACSEGDYETVNMLEHQLEYLRGKVEHPFD
FT                   DDPYALDTRFEWEDDMTE"
FT   gene            complement(342842..345805)
FT                   /locus_tag="VEA_000317"
FT   CDS             complement(342842..345805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000317"
FT                   /product="sensor protein TorS"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000317"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53005"
FT                   /db_xref="GOA:A7K4G9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014302"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G9"
FT                   /protein_id="ACY53005.1"
FT                   /translation="MLLATASIGRKLLLSFIAMAMLVMLSALIGVSGFSLVAKTERNVV
FT                   DSAIPAMIEARQVSELSTRIISSVQLLSNARNEQERKESGRVLFEQLESLLTHIKELGS
FT                   ESFDSQLLEDLENNVQNVIDNLAELGVSVERKLWLAKEIDTRVEEMRLLSEELEQLTRT
FT                   QVQNTSTIAVANVTHIYDLLESNKKSQVYQALDALVEVDLDLTERLHELHLLAFKMLNQ
FT                   IEEARTLTNIERIQQVQSDFESNLKIMKRRVLAVEDPTRSKQMSQLLTELGKRQVVFTI
FT                   LMQQYENNEQSQQLMQKTLELFSELNGTVNKLVDDSNKTTTVAVDELTSTLKFAQWSLT
FT                   VISIVGLIVLVLILWRVVYLSVVKRLAEYSAALLSVAQGNLAVELEVKGKDELAHMGQA
FT                   IITARNTAQALKVVAEGEAQAKRELEEHKEHLEELVEQRTSQLKQANRRLNEEVLNHAK
FT                   ARKQAEQASRAKSAFLATMSHEIRTPMNGVLGTARLLIDSGLNPIQKRYAEIINRSGKT
FT                   LLAILNDVLDYSKIEAGHLEIRHMGFDLHQMVEDTFQLMNSRAQEKRLLFSYHIESDVS
FT                   RYWKGDVTRISQVLNNLVGNAIKFTDEGEIDIYVSLNPEDESQVLFEVSDTGIGIAKKD
FT                   QRTLFDAFTQAEGGMSQTGGTGLGLAISKRIIEAMGGILEVDSEEGHGSRFWFSIPLEE
FT                   SEPVETGAVATARCKVKAKVLLVEDNEVNRVVAEGFLESMGHQVVMAENGSQAEQLIST
FT                   QDFDIALVDINLPDCDGTELIQRLKQIECNKPANKALAATPMIAVSAHVFAEEVERYLA
FT                   AGFDGYLPKPLAKEALAALIQDVLDGKPLLLPQNADCTPFDQTSPQEQAIQSKVVQVPK
FT                   TEESDVVIINPSVIESDMKILGREKMLHIINLFRTTSADVLSKLQASAGGNDSKEVKNL
FT                   AHKLKGSAGSLGLTALMNSCQAIEAAPQPLDTYMATKDQLASQVSESIQALDELMAK"
FT   gene            345894..346898
FT                   /locus_tag="VEA_000318"
FT   CDS             345894..346898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000318"
FT                   /product="periplasmic protein TorT precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000318"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53006"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR014301"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G8"
FT                   /protein_id="ACY53006.1"
FT                   /translation="MVKNQHAFRTIFKHSAVTLALVASLPVVAAEKVCAIYPHLKDSYW
FT                   LSVNYGMVSEAKKEGVELRVLEAGGYPNKTRQEQQLALCSQWGADAIVLGTVDPQAYEH
FT                   SLKNWVGNIPVFATVNQLDLDEEQSELLKGTVGVDWHWMGYEAGKYLAARHPKGSGKTN
FT                   IALLLGPRTRGGTKPVTAGFYEAIQESDINIVDSFWADNDKELQRNLVQRVIDMGNIDY
FT                   IVGSAVAIEAAISELRSAGKAEEIGLVSVYLSHGVYRGLLRNKVLFAPTDKMVQQGRLS
FT                   VMQAAHYLRGKEYDKHASPTIKPLTPKTLHDDTIEESLSPSEYRPTFRVKAVD"
FT   gene            346963..347418
FT                   /locus_tag="VEA_000319"
FT   CDS             346963..347418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000319"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53007"
FT                   /db_xref="GOA:A7K4G7"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G7"
FT                   /protein_id="ACY53007.1"
FT                   /translation="MQKTIRTMPTHKHVALVAHDNCKPELLRWVKENKEKLQSHFLYAT
FT                   GTTGHMLSKETGLAIKSMISGPMGGDQQLGALISEGKIDVLVFFWDPLNAVPHDPDVKA
FT                   LLRIASVWNIPVATNRATAKFLFNSPLLEQEVDIEVPDYEAYLAERM"
FT   gene            complement(347496..349565)
FT                   /locus_tag="VEA_000320"
FT   CDS             complement(347496..349565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000320"
FT                   /product="DNA helicase IV"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000320"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53008"
FT                   /db_xref="GOA:A7K4G6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR022161"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G6"
FT                   /protein_id="ACY53008.1"
FT                   /translation="MQLTATSKAQFFIQNEYHHVEIKENSVLLSSIGSEEHIPFTIWNG
FT                   KVSVKRGLLWSSLQFFAHEHEGKQQSWLVQGLPWPQCRKFALEAVRQYQEWHNTQCRKL
FT                   AEYLPKWEEELYKLKHLPAYLSHSQVVSWVESLNQELSEMKTTLEEAKMRMPNRMAEIE
FT                   PWLIDTSATLGERNRDWLEEERPNWEVLFNRIESSPLNLSQQYAVLLNDDHNLVLAGAG
FT                   SGKTSVLTARVAYLLQSHQAQAEELLMLAFGRDAATEMKERLVDKVGMAADGVRVNTFH
FT                   QLGLYILNQVEQQPVEISPLALDDNQRTAWCVDWLKKHWMTPTNFKRWQKHLDKWPIAY
FT                   LKGDDELGSHSENPKLIAWLDSQLSHLAAVGLTKKQVQEKLVNHQDYTRLNSELALCWP
FT                   CFTAWQKMLKESNQVDFPTMISRATDYVNKGKFVSPWRFIMVDEYQDISPDRLALIEAL
FT                   CESTQKQAGATLFAVGDDWQAIYQFAGADVDLITGFKERFAHSTVHHLDTTYRFNNQIG
FT                   DVANTFVQQNPSQLPKTLNSHKQRKQKSVHTAPSNQVEKILDQLNQQAKQTKSVLLLGR
FT                   NHYHKPDLYDDWLRRFPNLDIRFMTCHASKGREADFVIILSVDEGQFPAKKKQIHIDGA
FT                   LTESKDKFPHAEERRLFYVAITRAKEKVWITHTGAGSAFVQELVNGDYPIITSR"
FT   gene            349889..352042
FT                   /locus_tag="VEA_000321"
FT   CDS             349889..352042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000321"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000321"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53009"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G4"
FT                   /protein_id="ACY53009.1"
FT                   /translation="MQATFKFRLYWANKTINYSVLILITLLGVVIPTWYFEQNTLITPL
FT                   ILGVIAAALAESDDSFTGRIKALILTFLCFALAAFSIEILFDTPWAFALGLFISTFGFI
FT                   ILGAIGPKYASIAFGSLLIAIYTMLGAHESTNIWFQPLLLLTGAAWYYFMSMIWQIFWP
FT                   LQPVQQSLANVFFQMANYLDAKAKLFHPVSNLTPQPLRIEAAKCNAATVMALNACKATL
FT                   LNRSKRGHIDGPSDRFLNIYFIAQDIHERVSSSHYRYQDLATEFERSDVLFRFKYLLES
FT                   QAQACRDIALAIQLGNEYSHTDQSILALAEVQNSLAYLEEQKQGHWKRLLMQLTYLFNN
FT                   LATVEKQLNNINNPDVEGLEEDTLADTNPHTLKAMWQRISANLHKDSMLFRHALRMSIA
FT                   LTIGYGIIQVFNIDRGYWILLTTLFVCQPNYSATRQKLTARVIGTLAGLLIGVPLLTFF
FT                   PSQESQLVFIVISGVMFFAFRMNNYGYATGFITLLVLFLFNQLGEGYAVVLPRLADTLI
FT                   GCVLAVGAVLVILPDWQSRRLHKVMSDAIDANKQYLDQIIGQYRIGKKDNLSYRIARRQ
FT                   AHNSDASLSSAISTMLAEPGKYRAAVDESFRFLTLNHAMLNYISALGAHRTRIEDESIH
FT                   KLVLDAHRCIHQHLDVLHKQLHQHCEECDLSNIDDAGLEQRLNEWRDEDDSSARMVLQQ
FT                   LHLIYRMLPELHSLASKFAVRVN"
FT   gene            352296..352457
FT                   /locus_tag="VEA_000322"
FT   CDS             352296..352457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000322"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53010"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G3"
FT                   /protein_id="ACY53010.1"
FT                   /translation="MNAQQFNELKQKLSDLTASQLKSLQGEISVKLNKTQNPVLSVEER
FT                   EMLSKLFA"
FT   gene            352538..352840
FT                   /locus_tag="VEA_000323"
FT   CDS             352538..352840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53011"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G2"
FT                   /protein_id="ACY53011.1"
FT                   /translation="MPVSGIQSGHQIVQMSQQMAEKAAHGINDNLGKVKEEIASHNIDL
FT                   AKVADVAITASTPSLPSQKVESLINLTQAAGYNRVGASVIEKNNEVIGSLLDIHV"
FT   gene            complement(353000..368371)
FT                   /locus_tag="VEA_000324"
FT   CDS             complement(353000..368371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000324"
FT                   /product="autotransporter adhesin"
FT                   /note="COG5295"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53012"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019959"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4G1"
FT                   /protein_id="ACY53012.1"
FT                   /translation="MSTQTVPQNAIVNAVKGEVLVLGLDGKARSIKAGDELISGEVIIT
FT                   ENNASLDVQIHNELYLVDANCVACLPEPSFEQPETLLQSPVNGQVTFDPTAIEGANFDA
FT                   NDVAAIQQAILDGADPTAILEATAAGAGAEGSANAGYVTVEYNNPEVLASTFFETSATR
FT                   SGVEERDEADDLDVTIFADGGQSLQSSVTEGSISLSSYPQTISSSVLIEAGDLALDTAS
FT                   FVPETSSLESLLTELNSDITSAGQPVAFVYDEAQNAIIGTQEGNEVLRIEIEATSLGRD
FT                   LELEVVTTISQGIDHVASVSDGQVSIVSDQINIAFDITGADIGGNSIQAPIDFTTTVID
FT                   GDDPAPQNVTFENVESSSTPITGTFVDIGSDQLATVTFNQEGLSQFDGLLSDNQATEAV
FT                   LSEDGSTITLSIAGSNETVLTISLNTDGTYQFEQFKPLEQTNGEDTIELSLPTTIVDFD
FT                   QDTASNTFTMTILDGDNPVIENVTGLSLDEAGVDQGSQEGAVVTSGTGSITTAVGSDII
FT                   DHYELEPTEFNVGGELQSQGQVVQLELASESNGVRTYEGFIELDGVRITVFDVAIDAPV
FT                   LGEYQFNLYEQLDHTGVNDDSITFSLPVYAVDADGDRSSITDGSNTPEAAQIVIQVQDD
FT                   VPSIDGVDALAVDEDDLSSIGSDQSDSVLAQGSFTTTQGSDRVVSYQLESGTDPLNGLE
FT                   SQGRSISLTETVNSDGSFTYSATAEGDDIFTLQVNPDGSYSFALEGPIDHAVGSDSLTL
FT                   DFTIVATDFDGDTSSLVLPVTITDDVPTINDVVALTVDEDDLSSVGSDQSQPTLVEGQF
FT                   TTTQGSDGVVQYQLDVKADPLNGLQSQGQTVSIAETQNADGSYTYSATANGSAVFTLIL
FT                   NTDGSYSFELQGPIDHAANSDSLTLDFSVIATDFDGDTSQIVLPVTIVDDKPTITDVDA
FT                   ITVDEDDLGTIGSDQTDPISIDGNFTTTQGSDRVVSYQLDASATPVNGLTSRGVAVTLT
FT                   ETANGDGSFTYKATAGTEAVFTLTVNTDGSYNFTLEGPIDHAVDSDELTLNFPIIATDF
FT                   DGDTTNATIPVTIVDDKPVITDVDAITVDEDDLASIGSDQSNPISIDGSFTTTQGSDRV
FT                   VSYQLDTSATPVDGLTSQGVAVTLTETANADGSFTYEATAGGNPVFTLTVDTDGSYNFT
FT                   LEGPIDHAVDSDELTLNFPITATDFDGDTVTETIPVTIVDDVPIITAVDALNVDEDDLN
FT                   VIGSDPGGDLFVKGAFTTTQGSDRVVSYQLDSTSDPVAGLMSQGEAITLVETANGDGSF
FT                   TYVATADGNPIFTLNVATDGTYDFTLQGPIDHAANSDSLTIDFPIIATDFDGDTATATI
FT                   PVTITDDAPVIDNVVPLAVDEDDLSGIGSDQSDAVYVEGAFTTTQGSDRVVSYQLDSAS
FT                   DPVSGLTSQGEPVTLVETANADGSFTYVATADGNPVFTMNVNADGTYNFRLEGPVDHAL
FT                   NSDELVLNFPIIATDFDGDTTTATIPVTINDDVPTIDNVVPLTVDEDDLASIGSDQNND
FT                   AFMSGSFTTTEGSDSVVKYQLDATADPVAGLTSHGEPVALAETANGDGSFTYTATADGN
FT                   AVFELVLKPDGSYTFTLLGPLDHAMNSDSLQIDFPIIATDFDGDTSTKILPVTIVDDQP
FT                   SIINVDAISVDEDDLATIGSDQNESVSIDGHFVTMGSDHVVRYQLDASSNPINGLTSHG
FT                   VVVTMTESANADGSFTYTATAGSEAVFTLTVNSDGSYNFTLEGPIDHATGSDELTLNFP
FT                   IIATDFDGDTTTETIPVTIVDDKPTITDVDAITVDEDDLATIGSDQNDPISIDGNFTTT
FT                   QGSDRVVSYQLDASATPVDGLTSQGVAVTLTETANGDGSFTYKATAGTEAVFTLTVNTD
FT                   GSYNFTLEGPIDHSVDSDELTLNFPIIATDFDGDTSVETIPVKIVDDKPTLGGIEATSV
FT                   QTVDEDDIPTVGSDGTQANSIAGNFIATDGSDGIVEYGVSDLTTPVQGLTSGGQSLVMV
FT                   EVSNAGGVSVYEARIDGTTTPVFRVTLDASDDSYTFDLLAPLDHPNADGQNELVINLPI
FT                   NATDFDGDESNDITLPIMVVDDVPTIDGLLAGSEQTVDEDDLPAGTDAASAEDTVISGT
FT                   FDITEGADQVASIQLSDLTTPVASLTSDGEAITLVLSSSANGVNVYQGVAGNPAEVVFE
FT                   LTLDATNNTYEFDLQKPLDHPDGNQQNEIVINLPVTATDNDGDTSPAFTLPITVVDDVP
FT                   VVTNIESLRVDEDDLPLGSDGTKEPLTVSGEFEVTSADGIDAFELDLSSNPIPNLKSGG
FT                   EDVTLSQDVSASTADALVYVGQTPSGVTVFTLTLHQDGKYDFELSGQLDHAVNSDEILL
FT                   NLPVKITDGDNDTITATLPVTIVDDKPTIDAISSGSTLSVDEDDIPSQGSDDTPESNII
FT                   GGNFDVTDGADSIVSFQLDSLTSPVSGLTSGGQPLELVEFSNSNGVIEYRAYVQGTTDT
FT                   VFKLTLNGSADSYEFELLGALDHPAGNDENSLVINFPVNATDFDGDVSNNITLPITVVD
FT                   DVPAIVKVTDSSQQTVDEDDLAGGSDTTSNDSTVLNGGFEVVAGADKIVSYQVSDLDAV
FT                   VSGLTSNGSSIELNLVGTNGGVTSYEAVITGTSTKIFTLSLDANNDSYQFELLGPVDHD
FT                   AVQGENNLVIDIPITVTDFDGDTSSSLNLPITIVDDIPEIKSADALAVDEDDLANGSQA
FT                   TNKDSLEATGNFDTVEGADTVVSYQLDLTSNPIPGVTSGGLAVTLVQTAVSNNNFTYQG
FT                   QTPDGNSVFTLVLSADGSYKFTLEGALDHSTQGEDTLILDLPVFATDVDGDTAGINLPV
FT                   TITDDVPTLYDASILRVEGQGSRTVHLFQDPVEADDDLGADGAQVTSFSADDSGIYFKQ
FT                   NGVDSDSVDLNGSDQVVFVHKVLDGVDTEIGRLVVRTDGSVSFRPNDDLDHTETDSIDF
FT                   TINVVATDGDGDIADADVDISIRDRNAQIDTSTVNAFEDQGRDGVVVGVDSANTQDNLS
FT                   TLDVTPAKVDLVINLHDIDRNESLGDITIRDASTHNGTFYYRDGSGNFIELTPVGDTVV
FT                   LDASNVEQSFSGELVSLDNLYFVPDRHTSTDASGIDPRIRVEILNNGTPDHTINGRLDI
FT                   EVAAVADIATWTTSSEFNYSVDEDGNNVALNITAETQDTSNPEDIVYELVFTQGEGNAE
FT                   LVYSDGSAIPQTGGVYLVDASRIGDVQIDPIDNFSGEIKIDVTAITTENNNPLSGKETA
FT                   RSETETIIIDVNPIADPGSFTVNRINVFEDNARTQDTVNPVTDHDPLQLSEVITMKPSA
FT                   DLDGSEALFVRISDFSIDGVTLVWLDSANPSQIVEVTDSSGNVLYYEVPESELANVEVL
FT                   PPLHSNDDFTFNVEGIVKDTASLSSGVAEDMLSLGSKTVIVGVKGVADIPFIELNDKSG
FT                   IWHEFNDGNVRGIETNIDENGQVELGFSVISGELPDNPNDHSESVTVLLSNIPAGVEVF
FT                   DSDGASVDLTFVGYDAQNQPIYEANITTANINSGIVIKPEASSTENIHITATTIVTEND
FT                   GHSRTSSGEIRIIVAPVIDAQDNYTVQSEGDEDTRFNIDWKPTLAQSPDTDEFFSDVTI
FT                   SGFPPGSTVYVDGVAQTLVSGTLTLSPLANESEQDFSARISQSGYVQVQLEQDSSTDFD
FT                   LNTTVTVKEIDHEYVDASNPGQGIAEKTINGMVHVQVNPIVEPENTTGSLDAQTRLLVT
FT                   ESTGVVTDIVKSDGQGNIDFTINTSTGGESGANIIKYQEFDASSDEVVTQLVVQFHNVD
FT                   PEILNQLVIVGALNEGGGRWTVIDEENFSIKAPSGLDLTPNDDSDDGDNGGLSQIGLTI
FT                   YAEVNDLGEDAVEKDATVVRETDVTLEFPTVLTPQTSVAAEIQVADDVQIEASEDNAID
FT                   LGTQLTSKVDAINADGVEDVLTVVIDPSAPGIPPGLVITGTDIDFVNGKYVFQADIDAS
FT                   GNITGLDGLTMHLAEDYAGDFELPVRFVTKDTESGDEKENNVRIPVQVLPIADVPSSAG
FT                   DQPLDGDVTPNVTVDITGTLGLDANKQPVDDLNNDVPTADGVGYEDGLIQLNLNVDFAD
FT                   RYNNIQGGQETLTNIKLALDDTTLGEFVDANGNSLGTSIEFNEAEILAGALDNVLFKPK
FT                   ENYPVGGGQNTVKINIEGEITDEAVFDQSILNNPGDNIDIRTFTDDVTFEVTPVVDDIT
FT                   ITGADPTKPITVVGDEDTLISLNQSGSGVSISLNDNDGSESFVSLKLTGIPDDFVVQSN
FT                   SSDYVVKNNGGGEWSIQLKDLTQTSVDLSDIQIKPPKNFSGEAEIGITVFIQEELLQVP
FT                   TERTNNFTLVVNPIGDDVDVNPDTSAAGNEGEDIVINVNALVVDNKESIGDGATYQEND
FT                   PETLRVEISNVPDGASVSLPDGTVFTDQGNGVFVLEIDAQDLDQVVFNSGDRNDNSWGG
FT                   SLHFKVQAVDTGLDGRQSLGSAEEFDVAVDVEAVNDRPEFANVIDVETPEDNAILLDTF
FT                   GISDVDAVLDDPTAEYVLNIAVDSGYLALEPSIIANYGLTVSGDGTGSIELKGTVSDLN
FT                   AAIADGLVEFNPALNFFGNVNVDISVDDQGNEGIVISGVDETLNSNSSQFVIEVTEVND
FT                   APTTSEVTLTSIDEDSGAVIVTAADLLVNAVDIESDNLTVSNVTLVDPAAGTLTQLSST
FT                   EWSFEPAPDFYGDVSFNYDITDDGMTNGVSDPKTVSGSAVMTVQAINDAPEIDGSMVTN
FT                   TIVESSDQKISGIEITDVDFAGIHENEIMTVSLSIDEGDISVVVPAGSGITQGVGLAGE
FT                   TVLMGTLSQLNSLFASTDPDVGVFIDASDVNSNSIALTVTADDNGIFYDNLTGSSLQTS
FT                   ETFDINVTPVADVPNLAIDQNFSYIQKISASQSASRQGIALVGIMAALTDVDEVLALEL
FT                   TGVPRGATITSEATTSNISFDGTTWTVPEDEIDTLHINNAIPGDYDITLTAVSTASNGD
FT                   QAYSTPLDINLNVTLNSQDIDQSAESEDSYLIGSDAGITLAAGTGDDYILGGDGDDVLI
FT                   GGLGSDILTGGAGSDIFKWTEDTVDNGAIDTITDFSVNEDTIDLKDVIADLNDPTAGID
FT                   DLLAHIQADYDASTENVSLNITTDANVQQTIVVENLGTSIDFNGLSSNEIVESLLNHGV
FT                   IDNG"
FT   gene            369233..369478
FT                   /locus_tag="VEA_000325"
FT   CDS             369233..369478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000325"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53013"
FT                   /db_xref="InterPro:IPR020137"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4F9"
FT                   /protein_id="ACY53013.1"
FT                   /translation="MDMNMVEILGYAASIMVAISLTMKDIVKLRILNFIGCALFTAYGL
FT                   MIDSWPVVLTNGFIACVNIYFLAKMQQEKKSLESRA"
FT   gene            complement(369902..371908)
FT                   /locus_tag="VEA_000326"
FT   CDS             complement(369902..371908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000326"
FT                   /product="enterobactin receptor VctA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000326"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53014"
FT                   /db_xref="GOA:A7K4F7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A7K4F7"
FT                   /protein_id="ACY53014.1"
FT                   /translation="MESPACSSIKLSSLCLAVGMALSTPVLAQDTESHFEEVVVWGTKV
FT                   SSNTESMFADDMSLKQADHMSDLLRDIPGVDVGGTHSVNQRITIRGLSETDLDIRLDGA
FT                   SQHASMFHHIGNLTLNPDILKSADIQVGNNSVTQNGLGGSVYFETKDARDLLRYDETFG
FT                   ARVYGGYASNDNQQGSLTLYGLLSENIDAMVYGHYVTRDDFEDGDGNKTYGAAGDVYNI
FT                   LAKLGYELNDIHRFELSYDMYRDSGDYSPRPDMSGSANNGLSSTLLIPTDYDRDTVTLS
FT                   YELRGEQHKGNVTLYNTETEIKRDESVMAPRWPSNRLSKNTAKNQNFGLNGKFQSDVML
FT                   GEFDNRITYGFDYMDKTSSSYYGSRKFMDESAISTALFVEDQFFFSDAFFVTAGMRFDD
FT                   YKREAETGTSNYDDVTWALAVEWAVTQDWTLFASARSLFKGPELMETFIAYQDVAFLED
FT                   GLKPETGLNTQGGVRFDKTFDKHFFGANITAFQTEIDDYIADQYQNATQTYLIYNLGDV
FT                   EIKGFEASASYGYDKFNSKLSYSKSDTKNKNTGGPVAGGNGRSIDMGDSIALTLDYQSD
FT                   ALETIFGWNSMFVLEEDNVFDGQPKKASYDVHNLYAQWVPSNIDGLSVTFGIDNVFDEL
FT                   YSSHASRSGTARGFTLDDYEPGRNFKLSAAYQF"
FT   gene            372025..372993
FT                   /locus_tag="VEA_000327"
FT   CDS             372025..372993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000327"
FT                   /product="transcriptional regulator AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000327"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53015"
FT                   /db_xref="GOA:D0M8U8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8U8"
FT                   /protein_id="ACY53015.1"
FT                   /translation="MQEVTPKRTRVAKIALTQKLEATEKQWIVTQGQPCQTQLAEGKFL
FT                   SYQYNDQIFVHGGRCLELVDSHIVSTAHASLLVTILLEGKLSFGYDDLQFDLDASDGPK
FT                   GVVVNLLKPANFRRSLLKDNLINKINILVKPQWLEARLDQTCRHRSFFNSHQAFHPLEL
FT                   NQALCELAETLTSRETPQEFQDKLEVESLIYQILHQATEQIPKHFSANKNNLERHTDGR
FT                   IEDIVSYIETHLEQELGLEKLASVFSMSVSNLQRRFKQSLNMTVNGYIRFRRLEIARQH
FT                   LERGLVTITEAAYEAGYHHPSNFTCAFKKVFGVPPHEVIKE"
FT   gene            373081..373467
FT                   /locus_tag="VEA_000328"
FT   CDS             373081..373467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000328"
FT                   /product="HTH-type transcriptional regulator CueR"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53016"
FT                   /db_xref="GOA:D0M8U9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8U9"
FT                   /protein_id="ACY53016.1"
FT                   /translation="MNIGAVAKLTGLSSKSIRLYEDKGIISPPARSDSGYREYSDNHIQ
FT                   ELNLVSRAKNAGFSLQECKEFVQLAHNPNRKSSEVKARTMDKLREVEEKIAHLMEIKTQ
FT                   LEGWVSSCPGDAESRCPIIDELTK"
FT   gene            complement(373522..374277)
FT                   /locus_tag="VEA_000329"
FT   CDS             complement(373522..374277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000329"
FT                   /product="ferric vibriobactin enterobactin transport system
FT                   ATP-binding protein"
FT                   /note="TC 3.A.1.14.6"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000329"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53017"
FT                   /db_xref="GOA:D0M8V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8V0"
FT                   /protein_id="ACY53017.1"
FT                   /translation="MIVIDKLTKAFGSNKVVDEANTQFEKGKVTSIIGPNGAGKSTLLS
FT                   MASRLTERDGGSVIIDCKEIAEWDTKELAKKLAVLRQANSITMRFTVKELVSFGRFPYS
FT                   KGNLTKEDHAVIEQAIDYLDLQGIQDKYLDELSGGQRQLAFIAMVIAQDTDYVFLDEPL
FT                   NNLDIKHSLQIMKVVQRLAHDMNKAMVVVIHDINFAACYSDVILALKQGKVVASGAVEE
FT                   VIQASTLEDIYETPFNIIELNGKRMCTYH"
FT   gene            complement(374280..375230)
FT                   /locus_tag="VEA_000330"
FT   CDS             complement(374280..375230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000330"
FT                   /product="iron(III) ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53018"
FT                   /db_xref="GOA:D0M8V1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8V1"
FT                   /protein_id="ACY53018.1"
FT                   /translation="MRDSTKILLLGGIAVLFACLFIGIGLTADNYQYFLSRRVPKVLAI
FT                   VLAGVAIAQSSLVFQTITHNRILTPSIMGFDALYVLTQILIVLIFGGLSTLVLNLYVNF
FT                   TIAVIVMVSFSLLLFGFYFSKGSKNLITLLLVGLIFGQLFSNAASFFSLLMDPNTFAIV
FT                   QSKLYASFNNVKVNLVYFSAPALMFACWLLFSMHRTLDVFWLDQDNAKSLGVDVPKVTR
FT                   NVFIISAVLIAISTALVGPIMFFGLLVTNLSREMFRSYQHKTLLVGCSFLSISSLLAGQ
FT                   WIIENVFSFETTLSVVINFIGGAYFLYLLLKNKVV"
FT   gene            complement(375223..376092)
FT                   /locus_tag="VEA_000331"
FT   CDS             complement(375223..376092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000331"
FT                   /product="iron(III) ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53019"
FT                   /db_xref="GOA:D0M8V2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8V2"
FT                   /protein_id="ACY53019.1"
FT                   /translation="MTPQQLFSGDEKALELFFTSRIPRLFAILLAGAGLSIAGLIMQQI
FT                   SQNRFAAPSTTGTIECAMLGYVLSVVFFGNDNHLWLVFGISVFGTLAFIFFIQRIQFKS
FT                   VVFVPLVGIIFGNVIQSMTTFIAYKYDALQSLNAWTVANFANILRGDFELLYIAVPMAI
FT                   LSYLFAARISAVGIGKDFAVNLGLNYQQVVTIGVLLVSIMSASVVMIVGQLPFLGLIVP
FT                   NLVSHFYGDNLKKNIPLTAMYGATLVLCCDLVSRLIIFPHEMPISIVISILGGVVFIAM
FT                   LLRGKQHA"
FT   gene            complement(376181..377089)
FT                   /locus_tag="VEA_000332"
FT   CDS             complement(376181..377089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000332"
FT                   /product="ferric vibriobactin enterobactin transport system
FT                   substrate-binding protein VctP"
FT                   /note="TC 3.A.1.14.6"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000332"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53020"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8V3"
FT                   /protein_id="ACY53020.1"
FT                   /translation="MKKFVGAAMLSLFTVSPSFAAKVVIDHYMGQTELEQSPERVVVIG
FT                   FGPLDALDNFGIDPVAVSNSSNLPSYLSKYSKDNYTSAGSLFEPDFETIYMQKPDLILV
FT                   GPRASAKYEELSEIAPTVVFAAKENQGYWEGTQAQWRNIGKIFDIEEKVEQKIEALDAQ
FT                   FKAIRNYNQSNNNDALTILSMGDNISAFGAQSRFGVIYNDFGFLETVEYVKTGTHGDII
FT                   SYEFIREANPKNILVVDRNSLKGTPDNDIRKSMDNDLVKATAAYKNHKITYLDVDAWYL
FT                   SMSGVTATEKMVSEIKQTVEL"
FT   gene            complement(377253..377933)
FT                   /locus_tag="VEA_000333"
FT   CDS             complement(377253..377933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000333"
FT                   /product="predicted N-ribosylNicotinamide CRP-like
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000333"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY61"
FT                   /protein_id="ACY53021.1"
FT                   /translation="MKISPYPTGRFKTYLEKKSVAFREMIYQCQISTRYFDAGEEILRQ
FT                   GEQLQYLYVVPVGRVSMSILAANGRRFQLGEANCDYHIYGEMEYFTQTPCQWNVIADEH
FT                   MQVDVICIQKLTEALQKHPEMMVFFASALAEDYQDSMDIYTNRLLHPITYNIAYDLFVR
FT                   NQTNTLLGGFDKVNQEAERFGTSGRVYRRAVKDLIEKGLIAKTENGLEIIDELALKAFI
FT                   EAHE"
FT   gene            complement(378066..378797)
FT                   /locus_tag="VEA_000334"
FT   CDS             complement(378066..378797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000334"
FT                   /product="N-Ribosylnicotinamide phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53022"
FT                   /db_xref="GOA:A7JY62"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY62"
FT                   /protein_id="ACY53022.1"
FT                   /translation="MAKQPHIGVDETQVAPLVIVCGEPDRANRIAALLDDAEMISENRE
FT                   YRVFTGKYKDQPVSVCSTGIGAPSMIIAVEELKQCGVTHVVRVGSAGAMQSGIQLGELI
FT                   IAEGAVRDEGGSKAYVDSAYPAYASFSLLKEVERYLSIQEARYHFGVVRSHDSFYTDDE
FT                   DAICQYWNKKGVLGADMETSALLAVGRLRGLHVASILNNVVLYQQDVKEGVGQYVDEAK
FT                   VMMQGEKLAAMTALEALIAQR"
FT   gene            complement(378808..379539)
FT                   /locus_tag="VEA_000335"
FT   CDS             complement(378808..379539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000335"
FT                   /product="ribosyl nicotinamide transporter PnuC-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53023"
FT                   /db_xref="GOA:A7JY63"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY63"
FT                   /protein_id="ACY53023.1"
FT                   /translation="MDLLALLDINNTLVNIPIGGGYAMSWIEAFGTVFGLLCIWFASQE
FT                   KTINYLFGLLNVTLFAVIFFQIQLYGLLLLQLFFFCANIYGWYAWTRPNAEGETLEVRW
FT                   LNKQKLIATASISVVSIALLTIYIDPFFFALANIAVDSLNLFGAGLADPVLEPDAFPFW
FT                   DATMTVLSVVAQILMTRKYVENWILWVVINIISVGIYATQGVYAMSVQYAILMFIAANG
FT                   TREWARSAKRNGDKTLAQAAA"
FT   gene            complement(379707..379925)
FT                   /locus_tag="VEA_000336"
FT   CDS             complement(379707..379925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000336"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53024"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY64"
FT                   /protein_id="ACY53024.1"
FT                   /translation="MLSKGYAKFSVKHPWFHRVNVIAVILIFFVSCYQLLVNEAFEYAI
FT                   GFVITLLASALFASASAFKKRYLGLDS"
FT   gene            complement(380040..381062)
FT                   /locus_tag="VEA_000337"
FT   CDS             complement(380040..381062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000337"
FT                   /product="ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53025"
FT                   /db_xref="GOA:A7JY65"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY65"
FT                   /protein_id="ACY53025.1"
FT                   /translation="MATMKDIAKLAGVSTSTVSHVINKTRFVSEEISERVNNAAKELNY
FT                   YAPSALARSLKVNRTKTIGMLVTTSTNPFFGEVVKGVERSCYQKGYSLILCNTEGDNER
FT                   MRQSINTLLQKRVDGLILMCSSLEGERIDVFERYPDIPVVVMDWGPMLFTSDKIQDNSL
FT                   RGGYLAAKYLIDCGHTEIGCITGPLIKHQAQMRYEGYKRAMNEAGLEFNANWIIESDFE
FT                   CEGGYQAFMKMAQRGTLPSSIFVSNDMMAMGVINAANELNIKVPEQISIIGYDDIHIAK
FT                   FMSPSLTTIHQPKYRLGQAAVETLVRKLDDKSTEAQVVQLEPTLVERKSVKILKSSSTR
FT                   "
FT   gene            complement(381096..382013)
FT                   /locus_tag="VEA_000338"
FT   CDS             complement(381096..382013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000338"
FT                   /product="ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53026"
FT                   /db_xref="GOA:A7JY66"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY66"
FT                   /protein_id="ACY53026.1"
FT                   /translation="MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQA
FT                   VAAARLKADIGFIACVGDDSFGINIRENFNMDGIDITGVKMQPNCPTGIAMIQVSDSGE
FT                   NSICISAEANAKLTAEAIEPDLDRIRQADYLLMQLETPMCGIEKAARVAKDAKTNVILN
FT                   PAPARELSDELLACIDVITPNETEAEVLTGVTVTDNDSAQEAANVLHSKGIEIVMITLG
FT                   AKGVWLSQNGRGELIPGFRVDATDTTAAGDTFNGAFVTGLLEDLPLESAIKFAHAAAAI
FT                   SVTRFGAQTSIPTREEVDAFLAAQ"
FT   gene            complement(382239..383117)
FT                   /locus_tag="VEA_000339"
FT   CDS             complement(382239..383117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000339"
FT                   /product="ribose ABC transport system ribose-binding
FT                   protein RbsB"
FT                   /note="TC 3.A.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000339"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53027"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY67"
FT                   /protein_id="ACY53027.1"
FT                   /translation="MKKLATLISAALLSSTVSVAAQAQDTMAIVVSTLNNPFFVTMKDG
FT                   AEAKAKELGYDLIVLDSQNDPSKELSNIEDLSIRGVKAILINPTDSDAVSNAIRMANRS
FT                   KIPVLTLDRGASRGEVVSHIASDNVIGGEMAGHYIMEKVGEKAKVIQLEGIAGTSAARE
FT                   RGEGFMNAVKGSDMDLLASQPADFDRTKGLNVMENLLAANPDVQAVFAQNDEMALGALR
FT                   AVQASGKDVVIVGFDGTEDGIAAVNRGKLAATIAQQPDLIGALGVETADKVLKGEKVEA
FT                   YIPVPLKVVTK"
FT   gene            complement(383195..384178)
FT                   /locus_tag="VEA_000340"
FT   CDS             complement(383195..384178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000340"
FT                   /product="ribose ABC transport system permease protein
FT                   RbsC"
FT                   /note="TC 3.A.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000340"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53028"
FT                   /db_xref="GOA:A7JY68"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY68"
FT                   /protein_id="ACY53028.1"
FT                   /translation="MSTNTMSKPTEASNKKLFTKEWLIEQKSLIALIFLIVVVSFLNPN
FT                   FFTVDNILNILRQTSVNAIIAVGMTLVILTAGIDLSVGSVLALCGAFAASMIALEVPVL
FT                   VAVPTALVAGAALGAISGIIIAKGKVQAFIATLVTMTLLRGVTMVYTEGRPISTGFTDT
FT                   ADAFAWFGTGYALGIPVPVWLMVVVFAAAWYLLNHTRFGRYVYALGGNESATRLSGINV
FT                   DRVKIGVYAICGMLAALAGIIVTSRLSSAQPTAGMGYELDAIAAVVLGGTSLMGGKGRI
FT                   MGTLIGALIIGFLNNALNLLDVSSYYQMIAKAVVILLAVLVDNKNK"
FT   gene            complement(384175..385680)
FT                   /locus_tag="VEA_000341"
FT   CDS             complement(384175..385680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000341"
FT                   /product="ribose ABC transport system ATP-binding protein
FT                   RbsA"
FT                   /note="TC 3.A.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53029"
FT                   /db_xref="GOA:A7JY69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY69"
FT                   /protein_id="ACY53029.1"
FT                   /translation="MTQAILQLSDIEKAFPGVKALDKASLNVYPGRVMALMGENGAGKS
FT                   TLMKVLTGIYHMDAGSIQYQGQPAAFKGPRDSQEAGISIIHQELNLIPELTIAENIYLG
FT                   REFTGTMGRIQWGKMYEEADKLLQRLNVKHSSKTLLGDLSLGEQQMVEIAKALSFESKV
FT                   IIMDEPTDALTDTETESLFKVINELRVQGCGIVYISHRLKEIFEICDDITVLRDGKFIG
FT                   ECKVADTDEDGLIEMMVGRKLEEQYPRIDVRHGETCLEVIGLTGSGVHDVSFTLKRGEI
FT                   LGISGLMGAGRTELMKVIYGALPSEHGVINLDNKTINPVSPQDGLANGIAYISEDRKGD
FT                   GLVLGLSVKENMSLCSLNQLTKGFQIQHSDEVIAVEDFIKLFNIKTPTRDQIIGNLSGG
FT                   NQQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINKFKAEGMSIILVSSEMPEV
FT                   LGMSDRILVMHEGRITGEFDAKDADQEKLLACAVGKKINEEAA"
FT   gene            complement(385704..386123)
FT                   /locus_tag="VEA_000342"
FT   CDS             complement(385704..386123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000342"
FT                   /product="ribose ABC transport system high affinity
FT                   permease RbsD"
FT                   /note="TC 3.A.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53030"
FT                   /db_xref="GOA:A7JY70"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY70"
FT                   /protein_id="ACY53030.1"
FT                   /translation="MKKSTLINSDISYLVATLGHTDEITICDAGLPIPEHVQRIDLALT
FT                   HGVPSFLDTVRVILSESQIEGVIIAEEFSDVSPVLHQALLNELSKESEETGKSIEISYV
FT                   SHEAFKARTAQSRAVVRTGECSPYANVIFQAGVVF"
FT   gene            386596..388962
FT                   /locus_tag="VEA_000343"
FT   CDS             386596..388962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000343"
FT                   /product="C-di-GMP phosphodiesterase A-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000343"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53031"
FT                   /db_xref="GOA:A7JY71"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY71"
FT                   /protein_id="ACY53031.1"
FT                   /translation="MKLSNRVILLVAPVILLSALVSSYIIYSIQKVTLIKREDSYIQLQ
FT                   MEKLAGQFRQANIFLNSYAYTLSKSDVLQDYLVNHSNPYRERVLFNRLDETADVLSHGY
FT                   TGDASMAILDGKQNLLYYTENKYYESSGVVDPKVLDYISRSFSTREAFNHTGFIYNSSG
FT                   QSILLQYELIDKRTGTQPLSFDPQNVFFVVVSVSLEAFNEIKHEIEFDTHSVITFADKP
FT                   IYLDIPLAQTIELLPHFYAVLSPAEYLMWNKVDKVWLELALSFGVAAFCTITLIVLVLY
FT                   RYVLHPVSRLDKQLQELETNQRGNIEKLETNDEIGRLSSRFFDMYEELNIIYKKTKRLA
FT                   ETDHLTQLANRHRFHELATRELVSPSQHLWVIYVDLDNFKYVNDKYGHELGDNLLKVFS
FT                   SHIKNVCQKFSHDYDSPCFAARLSGDEFAILLSSNQDAQRLPDLLASELLKPISNLSPS
FT                   WSNSFPVTASVGIAQYPQDGTDVAKLLSSADAAMYQAKRAGKNQYAYYSAALNVESQRR
FT                   SQLERALRKSNVEEEFHLVFQPYMNNRDNEIEGLEVLLRWEAEGIGPVPPKEFIPIAEQ
FT                   AGLFDKIDRWVFANATAEYHQLRNIFGKDIVLSINLSSAELNSIEMANYIHDQASKNGV
FT                   KPECIELEITETFAAEQQGTALLDELSKRGYRLAIDDFGSGYTSLTQLVQYPVQKIKFD
FT                   REFLVTLMKTNNGHVIKPIIDLCHAQNKTVTAEGIEHNVMHEWLSSYRCDYMQGYLFGK
FT                   PMSKEQLNLWWQSANDDSRFDGSIVGSITVQGTSY"
FT   gene            389924..390448
FT                   /locus_tag="VEA_000344"
FT   CDS             389924..390448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53032"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8W5"
FT                   /protein_id="ACY53032.1"
FT                   /translation="MFKQAKLDGVVDFKLFRDAYIAYQKTPDRKKSVLTIIDYSKPSTE
FT                   KRFYVVDLDKKKLIYNTYVSHGVNSGKKTATQFSNVVNSRKTSLGTFLTDTTYYGSNGY
FT                   SLRLDGLSSGLNDKARERYIVVHGADYANPSFIKKNGYLGRSWGCPALPKKLSREIIDT
FT                   IKGGSVIYASA"
FT   gene            390780..391238
FT                   /locus_tag="VEA_000345"
FT   CDS             390780..391238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000345"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53033"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY73"
FT                   /protein_id="ACY53033.1"
FT                   /translation="MLSLSLFSGFIVASYAHTYHHTKHYTSERLLKLAQQDDFELAHSE
FT                   FHTFASPSSWGSEGYYLHIKRELLALVSCRRTSATDGVLSSDFTPDYFLLVAFSSPPLL
FT                   ELAKQASRLPLDGYGGLMSKRSLYRLSGRKEANLMYVFTHGRNAFPVV"
FT   gene            391325..391648
FT                   /locus_tag="VEA_000346"
FT   CDS             391325..391648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53034"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY74"
FT                   /protein_id="ACY53034.1"
FT                   /translation="MTKFATTIALALLFATSSAFANTEAKPEEMSNETLLECANVSNAR
FT                   IAVPEHRAMFRHYLMSERNYSFSQLSSAELEFKAADKNESEVENIYKSQCKEVGEYLYS
FT                   IGY"
FT   gene            complement(391774..392454)
FT                   /locus_tag="VEA_000347"
FT   CDS             complement(391774..392454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000347"
FT                   /product="DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53035"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY75"
FT                   /protein_id="ACY53035.1"
FT                   /translation="MFDSIIQVLSAFWHQDFTALMAPGGAGLVYFVVAALIFLESGFIP
FT                   AAPFPCDSVVVLSGTLAAVGVLDPIMIMLVIAVSAGLGSWAAYLQGKWLNRLPKVRGWV
FT                   SAVPQKRLEQVDVLLSKHGLIALFCARFIPVVRSLLPLMMGLRVKRISKFHYFAWLSAI
FT                   LWTLILCGFGLLLPLLPENMSKAITMLLMAAPIITLVIGVLSFLFVKARRAFCKSKDVS
FT                   EFSQ"
FT   gene            complement(393030..393548)
FT                   /locus_tag="VEA_000348"
FT   CDS             complement(393030..393548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000348"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53036"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY77"
FT                   /protein_id="ACY53036.1"
FT                   /translation="MWKGLILGAVMMLVSACTTVTTDVDKQADFSAYRTFDFGAQAEAP
FT                   TSIDGRRIEQGLAEQLEDKGLIKVNSGGDLYVHHDIVEESELVSSGSSVSFGYGWNSFG
FT                   VITSSPERYKERKYGKLVVELVDAKANQVVWKGVSSRKLSESMSSEKRESLIEEEIAKM
FT                   FENYPYGEK"
FT   gene            393920..393994
FT                   /locus_tag="VEA_rna007"
FT   tRNA            393920..393994
FT                   /locus_tag="VEA_rna007"
FT                   /product="tRNA-Gly"
FT   gene            complement(394012..394869)
FT                   /locus_tag="VEA_000349"
FT   CDS             complement(394012..394869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000349"
FT                   /product="sterol desaturase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53037"
FT                   /db_xref="GOA:A7JY78"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY78"
FT                   /protein_id="ACY53037.1"
FT                   /translation="MDWTQLMERPELLLMILAPVFFLCMVAEYWFGQRRGRLPESATYY
FT                   IPEVVCNFVLAGLHQATDILTGLLIAQLYLWWFDWRLFDIEMSVSAFLLLVVLQDFFYY
FT                   WFHRASHRIRWMWAAHVVHHSSERMNFSTAFRQSLMYPLAGMWIFWLPLVIIGFDPKWV
FT                   VFVVLFNLGLQFFVHTQSIRSLGPLEWVFNTPSHHRVHHGINRQYIDKNYAGVLIIWDR
FT                   MFGTFEPEVETVRYGISKPVNSFNPIRVTFAEWKDMFYDVTRPNLTWKQRWRCLFAPPS
FT                   DSFE"
FT   gene            complement(394877..395887)
FT                   /locus_tag="VEA_000350"
FT   CDS             complement(394877..395887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53038"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY79"
FT                   /protein_id="ACY53038.1"
FT                   /translation="MHELKTLDSFIQQNGLPVFGHLDGIPTSLQLDKFTYLDEMDKPAS
FT                   KWRRYCDYKQFQFVNLVTPNYVIGVAIADIRYLASGFCYLFDIQNNELVEQQWLKPFNI
FT                   DYQTQPSSWSSHAHLADKSIQFSIQNGIWHVHFVTKSVNADLYLRPESMSLPLMLCTPT
FT                   GYAGWTYTQKHNALTVDGNLFILGKEQDLSEVAAGYDFSAGYMRRETSWRWASINCFES
FT                   GRRLGLNLAAGVNETGYCENVFWINGERHFLQPVQFQFSRNDEGQRWHIMSEDKRIDLV
FT                   FTPLNRRSEKKNFWFLKSNFRQYIGYFSGYIVDGNGIKHQLEEVIGLTEDHYAKW"
FT   gene            complement(396036..396152)
FT                   /locus_tag="VEA_000351"
FT   CDS             complement(396036..396152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53039"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY80"
FT                   /protein_id="ACY53039.1"
FT                   /translation="MNLFPLNSDFDQFSMAIMVFPADENAQFPTSGRIDEED"
FT   gene            396190..397542
FT                   /locus_tag="VEA_000352"
FT   CDS             396190..397542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000352"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53040"
FT                   /db_xref="GOA:A7JY81"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY81"
FT                   /protein_id="ACY53040.1"
FT                   /translation="MSHIHDTIVALQHSSPAQKEFYQAVEEVLTSLAPVIESNNKYKEQ
FT                   AIIQRIVEPERQIMFRVPWVDDAGNVQVNKGYRVEFNSALGPYKGGLRFHHSVNASIIK
FT                   FLGFEQIFKNALTGLPIGGGKGGSNFDPKGKSDGEIMRFCQSFMNELYRHIGPVTDVPA
FT                   GDIGVGAREIGYMFGQYKRLTGRYEGVLTGKSLLWGGSLVRKEATGYGTVYFAECMLND
FT                   RNDSLKGKTCLVSGAGNVAIYAIEKLYHMGATPVTCSDSRGTIYHEHGIDLQLLKQLKE
FT                   VKRASLEEYLDTYPEAEYTPLGDYPNEGHAVWRYQADAAFPCATQNELTSNDALALIDN
FT                   GCVLISEGANMPTTRDAANIIVDSEMAYGPAKAANAGGVATSQLEMAQNASMQNWTFEQ
FT                   VDSQLQTIMKNIFVNANETSREFGQPGNLVLGANIAGFRRVADAMIEQGIV"
FT   gene            complement(397618..398082)
FT                   /locus_tag="VEA_000353"
FT   CDS             complement(397618..398082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000353"
FT                   /product="predicted redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000353"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53041"
FT                   /db_xref="GOA:A7JY82"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY82"
FT                   /protein_id="ACY53041.1"
FT                   /translation="MSKHSALIEWHREADEVFSDNQYSRAHIWKFDGGLQVPASPSPHV
FT                   VPLPLSVEENVDPEEAFVAALSSCHMLVFLSIAAKRRYVVDRYLDEAVGELKKGENGKE
FT                   WVSKVTLNPKITFAGDNQPTRSQLEKMHHMAHENCFIANSVKTEVTTLTD"
FT   gene            complement(398181..400538)
FT                   /locus_tag="VEA_000354"
FT   CDS             complement(398181..400538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000354"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000354"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53042"
FT                   /db_xref="GOA:A7JY83"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY83"
FT                   /protein_id="ACY53042.1"
FT                   /translation="MSKFKLVNLCFFIAMLTCCVLAYMSHVNSKSAQEFHAELTDIGHK
FT                   LIEERDVIVNRYAVEDRKNYELTTSLVDIEVAAEKLLNSSRESVWFPVTPNHKKVEDTL
FT                   NLFKNRVLDTTLKLDMLIGVQVENQYALLMLFNLYQQDISTDTGKTLSGHHYFEFLNQL
FT                   LLTQNVVESESEANFLDRLQASDKRIELLTNELLDHGYFVFIEDAEHRLLNIAQSEARF
FT                   TWLFVFIAVMLLVSAFLYQSQYRMYNLKQLNLEIEEARNKAERAAKAKSSFLAAMSHEL
FT                   RTPMNGVLGLSQMIAEETNEPTTKEYVKVILDSGQHLMTILNDILDFSKVEENKLEFEQ
FT                   AKFNLDQVISPVCSAIKPLIDEKNIELIVENEVPEYVEFTGDCARLRQILFNLAGNAVK
FT                   FTSEGHVLIRTELDKVNHCLVMIVSDTGIGIALDKQEHVFNSFEQADSSTTRKFGGTGL
FT                   GLAIVKKLTGLMDGKITLKSVEGVGSQFIVELPIPWVECELPKAQEPPKTRKKTHNLQI
FT                   LLAEDNRVNAIVAKGFCEKLGHEVDVAENGLVAVKKARDNEYDLILMDNHMPEINGVEA
FT                   TRVIRQELGIKTLLFAYTADVFREAHDSFIQAGADHVLTKPLQQESFSDALKQFATRLE
FT                   PKENLPLTNDNNVLQLQRKPIEKLRLTEEELSSSEMLISLQEAPEAIDELLKSIIVDFE
FT                   SSVDELIDYFMAEDFASLEDTLHKTKGMALNLGLPILAGQTEALENTLKAKQTPEIERL
FT                   QMLINRLQVNIHQANRLLDDIQKKNVDPQQIL"
FT   gene            complement(400531..401508)
FT                   /locus_tag="VEA_000355"
FT   CDS             complement(400531..401508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000355"
FT                   /product="cytochrome c551 peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000355"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53043"
FT                   /db_xref="GOA:D0M8X6"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8X6"
FT                   /protein_id="ACY53043.1"
FT                   /translation="MQLMRQFSIITLVVVALILSQATIARNAKVLGDISLVQPIEGDPV
FT                   VDIKLARIGWHLFRDPQLSSNGSVSCATCHNLQTNGAENTPVSTGVKGDGTRNSITVFN
FT                   AALNYRFLWDGTENTLMAQIDGPIHNPIEMDSNWQTIEQYVKGSERYQALFSRDGELPI
FT                   NINNIKSAIVEFVEGLQTPGAPFDAYLLGYTHVLSEQQIRGWKTFQSSGCVQCHQGKNI
FT                   GGAMIQRFAYFKDKPVVEDSGRHLITTESEEQFYFRVASLRNVALTSPYFHNGRVDQLS
FT                   EAIQIMAKTQLGITMSDESVADIEAFLQSLTAPRPVILEVLENE"
FT   gene            402209..404857
FT                   /locus_tag="VEA_000356"
FT   CDS             402209..404857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53044"
FT                   /db_xref="GOA:A7JY85"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY85"
FT                   /protein_id="ACY53044.1"
FT                   /translation="MVISFLFISRYFFLYSLDELEDMEINHANQQALAVIDMMVSQQES
FT                   ASYDWAYWDETYDLFVDRDIAKYTERNLYTESIDALNLDMMAFITTNGQTLLSLTREDN
FT                   PDTSSELTAKMANQPTLQDYIKSMNHKLDIHRESISGLFKINDTIWGLSLSPVRNSEGD
FT                   RPSNGWMLWGRNLSLRFPGDFKSILTAENSLETQMVSESDSNQMRDIEKTSRSITKWAS
FT                   LSDLSGEPIAWLKTKTQREHYAKGNTLFMYLFATVGVVASIIAAGTYITFKNKVATRFN
FT                   HFAEGISEIASQYQLEGLHSVKVDELELATKLVQKLSENTSLTQLQLKDSMEKFGALYH
FT                   SSSLGMLIVIDRKIVDVNQRALDLLSYSKSQLIDRPLDALCPSEDDECRVDAMFRELKN
FT                   GKTQFEAQVLDSNAEEIDCLIEATLIQHHGQSALMMLLQDMRETKQQAEMIQKLTDFDP
FT                   VSGFCNRPVILNALHELVETRPNHFSFVYINSKTLKQIAGVYGHLIFDEVIQYIASAIR
FT                   EQLGAFQIGRISEHEFIVLIPDIEHHQKAIDATNRLLNHLSHKVQLSGIMMSLDSKAVM
FT                   MDLNITHQSVEHLLLAARFSSQSAKGRHSHEVLVIDEELSEQAETSMVINRDLENAIRQ
FT                   DAIKPFFQPIVDAKTTEVISFEALARWQHPTLGMISPEVFIPMAEQGKLIVELGESILK
FT                   QSCEFISRLNGVRHAQGLSMLSVHVNLSAQHFYHSGLMSYLKKVMAQYNLSAGQLVLEI
FT                   TESMLMGGEIESIQSIQDIKRLGVGLALDDFGTGYASFSSVCNFPLDIVKLDKSYIDEI
FT                   ETNDRAKTLVRNIANMSQELGLTIVAEGVETASQVRKLKVWNIDELQGFYFHKPMSAEQ
FT                   ALVQFSRHVNS"
FT   gene            405113..406489
FT                   /locus_tag="VEA_000357"
FT   CDS             405113..406489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000357"
FT                   /product="nfed family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000357"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53045"
FT                   /db_xref="GOA:A7JY86"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY86"
FT                   /protein_id="ACY53045.1"
FT                   /translation="MKRLWIWVLPLLLFASQALANTVWIVPVKGAIGPATSDYLSRELE
FT                   EAQLNGVSLVILEMDTPGGLDSAMRDIIHAITTSSTPVATWVGPSGSRAASAGTYILLA
FT                   SHVAAMAEATNLGAATPVALGGAPQPPSSDDGKDQNAEETSEGTNEGSEKVPAKTAMEK
FT                   KVINDARAYIKGLAKLHGRNAEWAEKAVSEAASLDATEALELNVIDYIANSPEDLVKAI
FT                   DGQTVKVNNRDVTLSLENPVWIERTPDWRAEMLAVITNPNVAYILMLIGIYGLLLEFYN
FT                   PGIGLPGVLGGICLLLAMYALQMMPVNYAGLGLLLLGIALMIAEAFSPSFGILGLGGVV
FT                   AFVLGSIFLMDSELPGFQIALPLIFGISIFSVALIVLTVGLLLKIRRRRVTTGLETYPG
FT                   KIAVVSDDFIDGEGRVQLDGALWRAKTKDHQQLKQGDHVTIVNVKGLTLTVMPDDRQNK
FT                   "
FT   gene            406500..407282
FT                   /locus_tag="VEA_000358"
FT   CDS             406500..407282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000358"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000358"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53046"
FT                   /db_xref="GOA:A7JY87"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY87"
FT                   /protein_id="ACY53046.1"
FT                   /translation="MMLYTVAVIVVLLFALATQMFKVLREYERGVVFFLGRFQEVKGPG
FT                   LIILIPFIQQMVRVDLRTVVLDVPTQDLITKDNVSVRVNAVVYFRVVDPQMAINNIESY
FT                   SDATSQLAQTTLRSVLGQHELDELLSERERLNKDLQSILDQQTDDWGIKIATVEVKHVD
FT                   LNDSMVRALARQAEAERNRRAKIIHATGELEASNKLKEAAQMLNEAPNALQLRYMQTLT
FT                   EITTDKTSTIIFPMPINLVEAVSDIAEAVKKNKETQDK"
FT   gene            complement(407367..407771)
FT                   /locus_tag="VEA_000359"
FT   CDS             complement(407367..407771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53047"
FT                   /db_xref="GOA:A7JY88"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY88"
FT                   /protein_id="ACY53047.1"
FT                   /translation="MNVIQVFNDSYERCIANQGFFDLFYKKLWSKSTSFRQKFDGVDMH
FT                   QQVRMLRGSIVFFMMADTSNEAHKMVEKYGKKHASSDIGIEPQDIDVWFESLIETVQEC
FT                   DFEYDDDVETAWRACFNTGLSVMKRECSKH"
FT   gene            407953..408666
FT                   /locus_tag="VEA_000360"
FT   CDS             407953..408666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000360"
FT                   /product="oxygen-insensitive NAD(P)H
FT                   nitroreductase/dihydropteridine reductase"
FT                   /EC_number="1.5.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000360"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53048"
FT                   /db_xref="GOA:A7JY89"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY89"
FT                   /protein_id="ACY53048.1"
FT                   /translation="MVVDAKRILICHKNKKDTNVSHQIITDLNSRYTAKKYDETKRVSQ
FT                   EDMAIIKEALRLSASSINSQPWKFIVIESDEAKQRFHNTFANMHQFNQPHAKAASHTIL
FT                   FAYDPNFTKEKFAKRVDAEVTSGHLPAEMYNNFMGAYAFADANTDENGFNGNWTKAQVY
FT                   LALGNLLHTLARLGIDSTPMEGVDPTLIGEVFKEELEGHVCEVALAIGYHKDGEDYNHG
FT                   LPKARLAMDDVITTL"
FT   gene            complement(408770..409948)
FT                   /locus_tag="VEA_000361"
FT   CDS             complement(408770..409948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000361"
FT                   /product="L-proline Glycine Betaine ABC transport
FT                   ATP-binding protein proV"
FT                   /note="TC 3.A.1.12.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000361"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53049"
FT                   /db_xref="GOA:A7JY90"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY90"
FT                   /protein_id="ACY53049.1"
FT                   /translation="MDAITIQNLDVVFGQQQSQALALLDQGKSRQEIIDETGQVVGVDN
FT                   VSLNVKQGEICVLMGLSGSGKSSLLRTVNGLNEISRGSLKIKDGDDMVELSNCDEQKLR
FT                   HLRTHRVSMVFQKFALMPWLTVLDNVAFGLEMQGIGKAERRKKAREQLEMVGLSEWETK
FT                   FPHELSGGMQQRVGLARAFAMDTDILLMDEPFSALDPLIRAQLQDELILLQEKLNKTIL
FT                   FVSHDLDEALKIGNNIAIMESGKLIQHGKPEQIILAPENDYVADFVAHTNPLNVLKGRS
FT                   LMRDDLVREDERVLICPDKDIWVTQESKGLSLADTDKSLVQWKSDSSNLDEVNENSLVQ
FT                   VSPEISMREAIELKQRSNQPLLMVEDNQLVGVLSDNELYDALLGNFKSEQVA"
FT   gene            complement(409951..410751)
FT                   /locus_tag="VEA_000362"
FT   CDS             complement(409951..410751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000362"
FT                   /product="L-proline Glycine Betaine ABC transport system
FT                   permease protein proW"
FT                   /note="TC 3.A.1.12.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000362"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53050"
FT                   /db_xref="GOA:A7JY91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY91"
FT                   /protein_id="ACY53050.1"
FT                   /translation="METGVDWLTINASGFFDAISITLETIILFVVDIFKWMPPAAPIIM
FT                   TAAIAWFLHRSIPLVVFIVLALLAILNLGYWQEMLETFVLVFAATTISVLIGVPLGIMA
FT                   AHRPWLYTLLRPILDLMQTVPTFVYLIPTLVLFGLGIVPGLISTIIFAIAAPIRLTYLG
FT                   IIKVPEELLEAGKAFGASRMKLLFKVELPAALPSIMAGVTQCIMLSLSMVVIAALVGAD
FT                   GLGKPVVRALNTVNISQGFEAGLAIVLVAIILDRLCKAPNQKEA"
FT   gene            complement(410872..411810)
FT                   /locus_tag="VEA_000363"
FT   CDS             complement(410872..411810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000363"
FT                   /product="L-proline glycine betaine binding ABC transporter
FT                   protein proX"
FT                   /note="TC 3.A.1.12.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53051"
FT                   /db_xref="GOA:A7JY92"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY92"
FT                   /protein_id="ACY53051.1"
FT                   /translation="MSKMTKIFSTIALSTLATGAYANQCETVRFADVGWTDITATTAVT
FT                   SELLKGLGYKTKTDLLSVPVTYSSMANGDIDIFLGNWMPTMEGDIAKYRDAGTVETVRA
FT                   NLVGAKYTLAVPKYVYDAGVTNFADLVKHADKFKDRIYGIEPGNDGNRLIQSMIDSNAF
FT                   GLKDFSLVESSEAGMVSQVSRAARRNQWIVYLGWAPHPMNSNVEMEYLAGGDDFFGPNY
FT                   GGANVYTNVRKNYLAECPNVGQLVKNLEFNLEMENELMEAILNQKQKPSKAAQAWLNAN
FT                   QEQIEAWLEGVKTVDGQDAVTAITNYLKTNA"
FT   gene            complement(411849..413564)
FT                   /locus_tag="VEA_000364"
FT   CDS             complement(411849..413564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000364"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53052"
FT                   /db_xref="GOA:A7JY93"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY93"
FT                   /protein_id="ACY53052.1"
FT                   /translation="MQQHYDYIIVGAGSAGCVLADRLSESGQYSVLLLEAGGSDKSIFI
FT                   QMPTALSYPMNTEKYAWQFETVEEQGLDGRQLHCPRGKVLGGSSSINGMVYVRGHACDF
FT                   DQWEEEGAKGWNYQSCLPYFRKAESWIGGADEYRGDNGPVGTCNGNDMKLNPLYQAFID
FT                   AGKEAGYPETKDYNGYQQEGFGPMHMTVDKGVRASTSNAYLSRAKKRKNFTLMKRVTVH
FT                   RVLLEETDAEGKKAVGVEFEKSGSIQQCFANNEVISSAGSVGSVQLMQLSGIGPKAVLE
FT                   KAGIEVKHPLEGVGKNLQDHLEVYFQYHCKQPITLNSKLGLVSKGLIGTEWILTRKGLG
FT                   ATNHFESCAFIRSREGLKWPNIQYHFLPAAMRYDGQAAFDGHGFQVHVGPNKPESRGSV
FT                   EVVSANPNDKPKIEFNYISTEQDKQDWRDCIRLTREILNQPAMDEFRGDEIQPGLNITT
FT                   DEQIDEWVKQNVESAYHPSCTCKMGADNDPLAVLNERCQVRGIQGLRVVDSSIFPTIPN
FT                   GNLNAPTIMVAERAADMILDNALETSNNAPVWIAPNWQEMQRMHPPKRDLDSIS"
FT   gene            complement(413746..415206)
FT                   /locus_tag="VEA_000365"
FT   CDS             complement(413746..415206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000365"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000365"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53053"
FT                   /db_xref="GOA:D0M8Y6"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8Y6"
FT                   /protein_id="ACY53053.1"
FT                   /translation="MEMKAHYINGAMYNGCSDEHFTTYNPANGEPLANIKQANQDDLEA
FT                   AIESAKKGFAAWSAMTAIERSRILHKAVAILRERNDELASLEVADTGKPIQEAIAVDIT
FT                   TGADVLEYYAGLAPSLQGEQQPLSEDQFFYTRREPLGICAGIGAWNYPIQIAMWKSAPA
FT                   LAAGNAMIFKPSEETPLTALKLAEIYSEAGMPDGVFNVVQGDYRVGQMLTAHPDIAKVS
FT                   FTGESGTGKVVMSDSAKTLKQVTMELGGKSPLIIFDDAKLNDAVSAAMVANFYTQGEVC
FT                   THGTRVFVHEGIYDDFIAQLKARTELLVVGDPLDENTQIGALISKDHESKVLGAIEAAK
FT                   ASGATLLTGGYKVTENGLANGNFVAPTVFVDCDDDMSHVQQEIFGPVMSVLKFRDESEV
FT                   IARANGTDYGLAAGVFTQNLSRAHRVIHQIQAGICWVNTWGDSPAEMPVGGYKQSGVGR
FT                   ENGVETLKHYTQTKSVLVQLSDFESPYK"
FT   gene            complement(415225..415809)
FT                   /locus_tag="VEA_000366"
FT   CDS             complement(415225..415809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000366"
FT                   /product="HTH-type transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53054"
FT                   /db_xref="GOA:D0M8Y7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8Y7"
FT                   /protein_id="ACY53054.1"
FT                   /translation="MPEIRKPQLVKATMSVIDRVGLHAASISLISKEAGVSTGIINHYF
FT                   GGKHGLLEETMREILRQLSSTITQKLRELPSDAHHQRINAIIDGNFVGYQAENQVAKTW
FT                   LAFWSYSMHDEQLKRLQRVNERRLLSHLRKELKALLNAEQAELVAHGIASLIDGIWLRG
FT                   TLNPQGIDAERARIIINDYLDKQLTFYSEKI"
FT   gene            415979..416122
FT                   /locus_tag="VEA_000367"
FT   CDS             415979..416122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53055"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY96"
FT                   /protein_id="ACY53055.1"
FT                   /translation="MPKLRLKNQIKTQTNQQLINDSIFNTPLIELFFVPQKFTLEKIYI
FT                   DH"
FT   gene            complement(416350..418371)
FT                   /locus_tag="VEA_000368"
FT   CDS             complement(416350..418371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53056"
FT                   /db_xref="GOA:D0M8Y9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8Y9"
FT                   /protein_id="ACY53056.1"
FT                   /translation="MPLLLGCLCLSIQASAEKVEQEGKFLQSLEGIENQIYALPQSSLA
FT                   LIEALEEDSLLQNQPTELLVRYWLAKSTVLELLGRAEESQNVAQKGLELVRPQSHEYLL
FT                   FKLIQMRTMVGKSDIDTALSSLDSLLETSRENGDKQLESEILLLKGRYYDEQGEFKKSY
FT                   AAIMSSMDAAESSGVQGLVERAALELGDVLVKIQGYDRSEALLEQAYRYFRDRRMSFNE
FT                   LLSVLTIAKLHKAQFQYEEAIVSYQRALKLAQIIGDGRFRFRVNLELAALYRETNQENK
FT                   MVRHLKLAENLQYRETSSAYLATFKLLQAEYMLEQKQFETLLAMIAPMLPEIIESRYVK
FT                   QQQMELLKVAAMAYAGSNDFKLAYKTYGNYHDKFIQFSNQREVENLERQQTLFELERLE
FT                   YENEDLNWNNVLQRMELENNRRTFYLLGEALLALIGVLFLMAVVFLVVNRSRLRMRRLA
FT                   KTDTLTGLFNRRFLEDWFTKPVETKRERKEKPTPQSKQEKVQHFVSEQVEQVKYGYLAL
FT                   NKWVDSKLDKQKMVPKKPQSGPVSLALIDVDYFKQVNDTYGHVFGDAVLTGVAKVLEET
FT                   VRENDIVARFGGEEFVVVMPNTDHEDSLITAERLRSALSLHGFVTEQNEEVRVTCSFGV
FT                   VTTEDSEMNFKSLCDQADKLLYQAKADGRNCVKGRKLT"
FT   gene            complement(418828..419586)
FT                   /locus_tag="VEA_000369"
FT   CDS             complement(418828..419586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000369"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase (isoleucine
FT                   degradation)"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000369"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53057"
FT                   /db_xref="GOA:A7JY98"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY98"
FT                   /protein_id="ACY53057.1"
FT                   /translation="MDLANKVIAITGAGQGLGKQMALSLAESGVHLALIDLNSDQLAET
FT                   KAECESFGVTTRFYVANVTEEQEVCAAFEQIEADFKQLNGVINNAGIMRDGMFIKVKDG
FT                   QVNAMSLEQFQSVMDVNVTGTFLCGREASKVMLNTDSKGVLINISSVARAGNIGQTNYS
FT                   ASKAAVATMATVWAKELGRFGIRSVAIAPGVIKTAMTDQIKPEAMERLVKMIPVGRLGL
FT                   ADEISSTIKYVLTNEFVTGRVFEVDGGMRM"
FT   gene            complement(419596..420492)
FT                   /locus_tag="VEA_000370"
FT   CDS             complement(419596..420492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000370"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000370"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53058"
FT                   /db_xref="GOA:A7JY99"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A7JY99"
FT                   /protein_id="ACY53058.1"
FT                   /translation="MDKIAFIGLGNMGAPMAKNLLTAGLNVEVFDLNPNAVAELTALGA
FT                   SSADSVKQAVQGASVVVTMLPASQHVQSVYLGQDGILDSVDSGTLLIDSSTIDPATARL
FT                   VGEKALQLGISFVDAPVSGGVAGAAGGTLTFIVGGSQENFVQAKVVLSHMGKNIFHAGD
FT                   AGAGQVAKICNNMMLGVLMSGTCEALNLGMENGLDPKVLSDIMLQSSGRNWALELYNPC
FT                   PGVMENTPASNGYQGGFMSQLMAKDLGLAMEAAVASQTSTPMGSLARNLFNFHNGQGNG
FT                   QKDFSSLFEFYQKQNQA"
FT   gene            complement(420511..421695)
FT                   /locus_tag="VEA_000371"
FT   CDS             complement(420511..421695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000371"
FT                   /product="enoyl-CoA hydratase [valine
FT                   degradation]/enoyl-CoA hydratase (isoleucine degradation)"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000371"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53059"
FT                   /db_xref="GOA:D0M8Z2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniProtKB/TrEMBL:D0M8Z2"
FT                   /protein_id="ACY53059.1"
FT                   /translation="MRFCKSASHNGQTASGGQMTGTVNVSKLECADGSVIGVLELDNPA
FT                   ALNALSYVMIEKLYKQLNEWQTDDSVIAVFLHAQGEKAFCAGGDIQAIYRALENKEQDF
FT                   DSAFSAMETFFDLEYRCDHLIHTYPKPIIAWGHGYLMGGGVGLFMGTSHRVAETTTRFA
FT                   MPEIKIGLYPDVGATYFLNQLPKHLALFLSLTACQINATDMKALGLSQWIAKPESKQAL
FT                   LDLLASVSWKGEAKINEKIATTLRSVQVDEPSEGMLMPYAGLIEQLCSGDLDSIVRAIS
FT                   SADVDDKWFINAQKALNYGSPLSLNITYQQLTQYQNLSLKACFDMEFNLTLRCGLEGDF
FT                   REGVRALIIDKTNQPTWQHRTVSDVTPQVLERFFAPIDSAEYPLTASSVATVAL"
FT   gene            complement(421652..422428)
FT                   /locus_tag="VEA_000372"
FT   CDS             complement(421652..422428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000372"
FT                   /product="3-hydroxyisobutyryl-CoA hydrolase"
FT                   /EC_number="3.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53060"
FT                   /db_xref="GOA:A7JYA1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA1"
FT                   /protein_id="ACY53060.1"
FT                   /translation="MTAQIKLEREAHIAKLTISNPPANTWTLESLNQLKELAIELSNDR
FT                   SIYALVLTGEGEKFFSAGADLNNFASGDKSQAADMAFAFGEAFEALSAFDGVSIAAING
FT                   YAMGGGLEVAMACDIRIAEEQVQMALPEASVGLLPCAGGTQNLTALVGEGWAKRMILCG
FT                   ERVTAERAEKIGLVEEVVAKGQALEAAMELAQRVAGQSPKSISACKALIQGRRSQTHAA
FT                   GLVLERELFLQLFNTQDQTEGVNAFLQKRKPQWTNS"
FT   gene            complement(422478..423632)
FT                   /locus_tag="VEA_000373"
FT   CDS             complement(422478..423632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000373"
FT                   /product="branched-chain acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53061"
FT                   /db_xref="GOA:A7JYA2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA2"
FT                   /protein_id="ACY53061.1"
FT                   /translation="MDFELNEDQLAFAEVAKQFADQMLAPHAAEWDENHHFPKDVLRQA
FT                   GELGFLSIYTPPEHGGLGLSRLDAAIIFEQLAMGCTATTAFMTIHNMATWMITSFAKAE
FT                   VAQQFSADLISGEKLASYCLTEPNAGSDAASLTTSAVRDGDEFVLNGAKVFISGAGDTD
FT                   VLVVMARSCGEGASGVSAFVVPADCEGISYGKKEAKMGWNCQPTRMITFENVRIPADYL
FT                   LGEEGEGFKFAMLGLDGGRINIATCSVGTAQQALNEAKQYMNERKQFGRSLAQFQALQF
FT                   KLADMATELVAARQMVRLAAAKLDAQHAEKSAYCAMAKRFATDVGFKVCDQALQIHGGY
FT                   GYIKEYPVERHFRDVRVHQILEGTNEIMRLIVARRLLTEGVELL"
FT   gene            complement(423728..425221)
FT                   /locus_tag="VEA_000374"
FT   CDS             complement(423728..425221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000374"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53062"
FT                   /db_xref="GOA:A7JYA3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA3"
FT                   /protein_id="ACY53062.1"
FT                   /translation="MTEQVKQYIGGEFAISDSKQWLDVTNPATNEVIAQVPCATESEMN
FT                   AAIASATETFKRWKEVAAPERARLMLRYQHLLKEQHDELAILLSSETGKTLADAKGDIW
FT                   RGIEVVEQAANICSSMMGETVENVATNIDGYSYIQPLGVCAGITPFNFPAMIPLWMFPM
FT                   AIACGNTFVLKPSEQVPLTAMKLAELFEQAGAPKGVLQVVHGTKEQVDRILTDPVVRAI
FT                   SFVGSVPVGEYIYKTGTDNLKRVQSFAGAKNHMVIMPDANKQQVINNLVGASVGAAGQR
FT                   CMAISVAVFVGESKEWIPELKEALAQVQPGAWDDETAGYGPLISPQAKQRVVNLINEGK
FT                   ASGANCVLDGTDCQVPGFPNGNWVGPTLFTNVTTDMSIYQEEIFGPVLLTMEVDDLDEA
FT                   IELINANRFGNGTSIFTANGAAARKYQHNIEVGNVGINVPIPVPLPFFSFTGWKGSFYG
FT                   DLHAYGKQAVRFYTETKTVTARWFEDDIPSGPNMTIQLS"
FT   gene            complement(425292..426470)
FT                   /locus_tag="VEA_000375"
FT   CDS             complement(425292..426470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000375"
FT                   /product="3-ketoacyl-CoA thiolase (isoleucine degradation)"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53063"
FT                   /db_xref="GOA:A7JYA4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA4"
FT                   /protein_id="ACY53063.1"
FT                   /translation="MKNETWIVAAKRTPIGSFQGALASTDVTELGAKAIQGALAESQLD
FT                   VQKIDEVLMGCVLPAGVGQAPARQASLKAEMPQSIGCTTLNKVCGSGMKTVMLAHDLIQ
FT                   SGNAHAVIAGGMENMSSSPYLLKKARDGFRLGHEQVLDHMFYDGLQDAYQGELMGVFAE
FT                   QTAQKYQFSRESMDIWAQQSLTRAQQAIEQGLFKEEIVPVNVKSRRDETLVVDDEQPSK
FT                   LDVTKIPTLRPAFAKDGGVTAANSSSISDGASAMILVDSEFGRQENLQPLAKIVAYSTH
FT                   ARQPDEFTIAPVFAIESLLEKTGWDKSDVDLWEINEAFAVVTQYAVKALELNESKVNPR
FT                   GGACALGHPIGASGNRILVTLIHALKQTGGKRGVASLCIGGGEATAIAIEIC"
FT   gene            426680..427066
FT                   /locus_tag="VEA_000376"
FT   CDS             426680..427066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000376"
FT                   /product="predicted transcriptional regulator LiuR of
FT                   leucine degradation pathway MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53064"
FT                   /db_xref="GOA:A7JYA5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA5"
FT                   /protein_id="ACY53064.1"
FT                   /translation="MNTFKISELAKEFDITTRSIRFYEDLGLLTPERKGNTRIYNGRDR
FT                   IRLKLILRGKRLGFSLADIKELFELYDTDQSTEQLNYMIRLIEEKKAALQQQANDIQAV
FT                   MMELNAAQLRCQNTLRSMKGEKVT"
FT   gene            427112..428281
FT                   /locus_tag="VEA_000377"
FT   CDS             427112..428281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000377"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000377"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53065"
FT                   /db_xref="GOA:A7JYA6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA6"
FT                   /protein_id="ACY53065.1"
FT                   /translation="MKSTYSSLNFVYDENTDLLREQINSFAAREIAPLAQSIDQSNDFP
FT                   NHLWSKLGDMGLLGVTTSEEFGGAGMGYLAHVIAMEEISRASASVALSYGAHSNLCVNQ
FT                   IHRNGTQAQKEKYLPKLISGEHIGALAMSEPGAGSDVVSMQLKAERKGDIFLLNGNKMW
FT                   ITNGPDAHTYVVYAKTDPSQHSKGITAFIVERGFPGFTQAQKLDKLGMRGSNTCELVFQ
FT                   NCEVPAENILGEENQGVKVLMSGLDYERVVLAGGPLGIMQACMDIVVPYIHDRKQFGKS
FT                   IGEFQLVQAKIADMYTQMNAAKAYVYAVAAACDRGETTRKDSAGAILYSAELATKMALD
FT                   AIQLLGGNGYINEFDTGRLLRDAKLYEIGAGTSEIRRMLIGRELFNESA"
FT   gene            428379..429986
FT                   /locus_tag="VEA_000378"
FT   CDS             428379..429986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000378"
FT                   /product="methylcrotonyl-CoA carboxylase carboxyl
FT                   transferase subunit"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000378"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53066"
FT                   /db_xref="GOA:A7JYA7"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA7"
FT                   /protein_id="ACY53066.1"
FT                   /translation="MACLTTNINTHSEQYQENYRSMASLVDQLYTVTAQIEDGGGEKAR
FT                   EHQHKKGKLPVRERILALLDSGSSFLEIGQFAGWDVYPDYVPCAGVVAGVGVIDGTECM
FT                   IVANDVTVKGGSYYPLTVKKHLRAQEIAEKCQLPCVYLVDSGGANLPRQDEVFPDKDHF
FT                   GRIFYNQARMSAKGIPQIAVVMGLCTAGGAYVPAMCDVSIIVKEQGTIFLAGPPLVKAA
FT                   TGEEVSAEDLGGADVHCRTSGVADYYAENDHHALELARQAVSQINHLKPVQLKQKAPQE
FT                   PRFSAQELYGIVGTDLKKPFDVKEVIARIVDDSQFDEFKALFGETLVCGFAHIHGMPIG
FT                   IVANNGILFSESAQKGAHFIELCAQRKIPLLFLQNITGFMVGQKYEAEGIAKHGAKMVT
FT                   AVACADVPKFTVVIGGSYGAGNYGMCGRAYDPTMMWMWPNARISVMGGEQAAGVMAHVT
FT                   RDIKTRKGESWSTEEEEAFKRPIAQQYQTQSHAYYASARLWDDGIIDPAKTRDVVGIAL
FT                   SAALNAPIPDSKFGIFRM"
FT   gene            430095..430877
FT                   /locus_tag="VEA_000379"
FT   CDS             430095..430877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000379"
FT                   /product="methylglutaconyl-CoA hydratase"
FT                   /EC_number="4.2.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000379"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53067"
FT                   /db_xref="GOA:A7JYA8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA8"
FT                   /protein_id="ACY53067.1"
FT                   /translation="MTGLLLEKDSNGVAWLSLNRPEKHNAFNDALIASLIETLEQLEKD
FT                   DSLRALVLSAQGKHFSAGADLGWMQSMATKTESENLQDAQQLAMLLHKLDTFSKPTIAM
FT                   VHGAAFGGALGLICCCDIAIGTPESRFCLSEVKLGLLPATIGPYVIRAIGQRQSRRYFL
FT                   TAELIDAETALSMNIVHQIDPQPKEAVNRMVEHLLNNGPQAMQAAKALCLRCDNQPIDH
FT                   SLIEYTSQAIATARVSSEGQEGLSAFFEKRAANWRNHV"
FT   gene            430870..432930
FT                   /locus_tag="VEA_000380"
FT   CDS             430870..432930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000380"
FT                   /product="methylcrotonyl-CoA carboxylase biotin-containing
FT                   subunit"
FT                   /EC_number="6.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000380"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53068"
FT                   /db_xref="GOA:A7JYA9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYA9"
FT                   /protein_id="ACY53068.1"
FT                   /translation="MFKRILIANRGEIACRIIKTAKHMAIETVAVYSEADRSSLHVKQA
FT                   DFAEFIGPAPASESYLDIDAIIGAAKKWQADAIHPGYGFLSENPKLAKACSENGIVFIG
FT                   PSTSAIEAMGSKSQAKAIMSEANVPLVPGYHGTDNSVEHLLAEAEKIGYPVMLKATQGG
FT                   GGKGMRVVNSAAEMPLAIDGAQREALSSFGDKQLLIEKCILQPRHVEVQVFADQHCNCV
FT                   YLSDRDCSIQRRHQKVVEEAPAPGLSDELRKQMGEAAVQAAQAIDYVGAGTVEFLLDSR
FT                   GQFYFMEMNTRLQVEHPVTESITGVDLVEWQLKVAAGEHLPISQSEITHNGHSIELRIY
FT                   AEDADNDFMPSTGRIDYLKEPVSDSNVRLACVRVDSGVTQGDTISEYYDPMISKLIVWG
FT                   QTRDIALKQLKEALTQYHVRGVTTNIGYLHSIISQPAFANIALDTDFLVKHQQGISAQQ
FT                   NVLDSIWLTLAAVARWNALTAKSDSSTLPAPTSQGFRLSVDNVYRFNFTDANANHQVRL
FT                   QQSSQDTGAQHLNHFTVRCGEELHQVILLESESQFIVDIDSVRYTFNALNDEQKTTLFY
FT                   LGQQRTFEHQPSFESTKGEDDELSPTAPLNGIISAVMVNKGDEVAAGDPLLVLEAMKME
FT                   YTITAPVAATVDEIFYQHGDQVQHGSILLHLASIPENVSVDKEREYATSEG"
FT   gene            432884..433813
FT                   /locus_tag="VEA_000381"
FT   CDS             432884..433813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000381"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000381"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53069"
FT                   /db_xref="GOA:D0M902"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:D0M902"
FT                   /protein_id="ACY53069.1"
FT                   /translation="MSLSIRSVSMLPAKVNIVEVGARDGLQNETAVTLVDKIRFINQLS
FT                   NSGLKHIEAGSFVSPKWVPQMADSAQVFAGITQQPDVVYSALTPNLAGLERALESGVKQ
FT                   IAVFGSASEAFSQKNINCSIAESLSRFEPVIELAKQHNIPVRGYLSCTMVCPYEGEIKP
FT                   EQTTAVANALFDMGCYEISLGDTVGKATPNRVIAMLDSLLTQLPKDALAVHFHDTYGQA
FT                   LANIYQALLMGINTIDSAVAGLGGCPYAKGASGNVATEDVLYLCEQLGIETGIDLKIIN
FT                   QAGWQICRALGKRPMSKVALALGDPNSL"
FT   gene            complement(433900..436521)
FT                   /locus_tag="VEA_000382"
FT   CDS             complement(433900..436521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000382"
FT                   /product="putative sensory box sensor histidine
FT                   kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53070"
FT                   /db_xref="GOA:A7JYB1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB1"
FT                   /protein_id="ACY53070.1"
FT                   /translation="MTLRSKTILGIALIEALALGVLIISGLNWLESSNETSLEVGSQHL
FT                   VSVFAQASRDAVIATDLAYLDSFARSVVSERELAYIRIVNQDGVELTLQGDYSGVDTGV
FT                   RPFDVTDGVYDVAQEITLGEQTFGKVEMGVNVEHVHQVLSFATHASLVIAFIEMSLVAM
FT                   FSYALGSYLMKRLDLLRTGVIKVSQQGPGSQISISGNDEVTRVGEAFNQMSRSLAQAQT
FT                   KLQQEHQTQQQLSAKISQLAEVAEHARDTIIITHPDGTIAWVNPAFEQLTEYTLEEVIG
FT                   KSPGELLQGPDTDPNTVALLSKSVRKHSPIRVEILNYTKSKHPYWVELELSPVFDEDGG
FT                   LLRFIAVERDITDRRRMERRLSSALDKSKKAMQAKSEFLANMSHEIRTPMNAIMGISEI
FT                   LLENENRREPRELLLLLHKSANNLVTIINDILDYSKVEAGKLTLVEEEFDFRSLVESCT
FT                   ALCAYQADKKNLKLLVDMPLAMNTVVVGDKGRINQILLNLIGNAVKFTDEGHVLLKVRE
FT                   SEHGFDFSVSDTGIGIPEDRLAHIMDKFEQVDTSATRRHEGTGLGLAISKRLISMYNGE
FT                   LCVHSDFGKGSCFSFSLQLPKQSQLLAEPIELSANRLLLIDDYQPRVQHLIHLAQEIGI
FT                   EVTHANDWSTAQSLGKKLDGFDRILASVNNVQDRDSLYELDATESAAKRVMFLAPCVME
FT                   EGQAWSCERDRLLPQPVTQHKLQALFSTKTQKRRELSSDENPDFSSLHLLVAEDSHINR
FT                   ILIEKMLQDTGVKLTLAEDGVEAVELYKQLSPDLVITDISMPNKDGFGVTKDIRELQES
FT                   GAFPWCPIVAFSAHAMQEQQQKSIALGMDDYLTKPVQKSDLLNMIAKWGCHTLTEEKHA
FT                   SV"
FT   gene            complement(436533..437219)
FT                   /locus_tag="VEA_000383"
FT   CDS             complement(436533..437219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000383"
FT                   /product="phosphonate ABC transporter phosphate-binding
FT                   periplasmic component"
FT                   /note="TC 3.A.1.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53071"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB2"
FT                   /protein_id="ACY53071.1"
FT                   /translation="MQQWQPLLQRWGDLAGVEIKFATARDIPTFEARLMAGAYDIAYMN
FT                   PYHFTLVNQNPGYTALARAKNKRITGIIVARRGKSFSLDELQEKTIAFPAPRAFAASII
FT                   TQSELAQKGIKFTPKYVGSHDSVYLGVLKGLYIAGGGVKRTFESLPSEIKDQLSIIYTT
FT                   AGYTPHAIAVSNNVDEEIPLALRKAISQLNDDPKAQESFTLLNIDGLQLAQDQDWQDVV
FT                   QLGISR"
FT   gene            437502..437822
FT                   /locus_tag="VEA_000384"
FT   CDS             437502..437822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000384"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53072"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB3"
FT                   /protein_id="ACY53072.1"
FT                   /translation="MLITFRCHSHSNVTMFGDIAIKMIKMMGHSGSVPGSISAQDIPDA
FT                   LSRLTSALAAQEAIEKNNSQAMEEDEEQEEQTVSLGRRAFPLIELLKSAIKEECEVMWD
FT                   SQ"
FT   gene            438132..438614
FT                   /locus_tag="VEA_000385"
FT   CDS             438132..438614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000385"
FT                   /product="acetyltransferase (isoleucine patch superfamily)"
FT                   /EC_number="2.3.1.79"
FT                   /note="COG0110"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000385"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53073"
FT                   /db_xref="GOA:D0M906"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D0M906"
FT                   /protein_id="ACY53073.1"
FT                   /translation="MRAKTAQLVFQFNHEPNPDIRRQLLAEMGVQLENSACIEPPLQLT
FT                   YGCHLSIGENTYINWDAIILDNGQVEIGANVMIGPRVQIYTAAHSLDTQRRLAGDEIAK
FT                   PVKISNNVWIGGGAIILPGVTIGDEAVVGAGSVVTKDVAPGDRVAGNPARSIKPKN"
FT   gene            complement(438624..440039)
FT                   /locus_tag="VEA_000386"
FT   CDS             complement(438624..440039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000386"
FT                   /product="transcriptional regulator GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53074"
FT                   /db_xref="GOA:A7JYB5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB5"
FT                   /protein_id="ACY53074.1"
FT                   /translation="MAKYQELVEQLKRQIKSGIWHPGDKLPSLRRQSEHSGLSLMTVLH
FT                   AYQILESQGWVTSQPRSGYRVAPYIKSSNEPQAPAAVSWTEQVDINEFIFDVLQASKNP
FT                   SMINFGFAYPDPSLYPRYHVNRAMGAAARNMPISTTFDNLPPGNEQLRTIIAKRYAAKG
FT                   IEISPDEIVITAGALEALTLSLQACTRPGDWVVVESPAFYGALQSLERLGLKALSVRTD
FT                   PVTGIDLDSLERALQTHDVKACWLMSNFQNPLGFTLSNEKKQKLIELTQRYNMPVIEDD
FT                   VYSELHAENDSVYPLRMFDDTGNTMLCSSFSKSLIAGLRIGWVAAGKRALEVQKLQLMS
FT                   TLATSAPVQMTLVHYLTSRNYESHLKQLRKKLFERKSKMTDLLNELLPEEVKVLSQSGG
FT                   YFIWLELPKHIDALQIYREALKDNISIAPGKMFSLTEQYDHCIRLNASFELNDKYVHAL
FT                   NLLANIIRDHLAK"
FT   gene            440194..441567
FT                   /locus_tag="VEA_000387"
FT   CDS             440194..441567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000387"
FT                   /product="putative Cytochrome bd2 subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53075"
FT                   /db_xref="GOA:A7JYB6"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB6"
FT                   /protein_id="ACY53075.1"
FT                   /translation="MFGLDAFMLARIQFAFTVSFHIIFPAITIGLATYLAVLEGLWLKT
FT                   RNPDYQKLYHFWSKIFAVNFGMGVVSGLVMAYQFGTNWSGFSDFAGSITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWRRVGEKLHFFATSMVALGTIISTFWILASNSWMQTPQGYEIVD
FT                   GRVVPTDWFAIVFNPSFPYRLAHMSVAAFVSSALFVGASAAWHLLRDNQSTAVKTMFSM
FT                   SLGILVFLAPLQAVIGDVHGLNTLKHQPAKIAAIEGHWDNSDGKPTPLILFGMPNMEQE
FT                   RTDYALEIPVLGSLILRHSLTEPIPALKDFPKEERPNSPIVFWSFRIMVGLGLLMIFQS
FT                   FYSMWLRKKNTLYTSRWFLKFSLFMGPSGLIAILAGWFTTEVGRQPWVVYGVQKTRDAV
FT                   SAHGDLQMSISLLCFLVVYSLVFGFGYYYMIHQIKKGPDAIEHDEHDEHDMTTVSGRI"
FT   gene            441596..442603
FT                   /locus_tag="VEA_000388"
FT   CDS             441596..442603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000388"
FT                   /product="putative Cytochrome bd2 subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000388"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53076"
FT                   /db_xref="GOA:A7JYB7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB7"
FT                   /protein_id="ACY53076.1"
FT                   /translation="MHFDLSVIWFAIIVFATLMYIIMDGFDLGIGILMPFIKDEKQKDV
FT                   MVNSVAPVWDGNETWIVLGGTSLFGAFPMAYAVIIEALTIPLTLMLIALIFRGVAFEFR
FT                   FKALENHLKFWDRSFMVGSILTTFFQGIVVGAVIQGFAVENRVFVGSQLDWLSPFPIFC
FT                   GLGLVATYALLGSTWLIMKTEGELQNTMYRFTNKTLLAMISALVFVSAWTPLAYPAIAE
FT                   RWFSLPNLFYLLPVPVITGLVCLKIADSVKKRKERSPFVMALVIVILGFAGLGISIWPN
FT                   IIPPSISIWEAAAPASSQRFMLVGAVIIIPIILAYTFWSYYVFSGKVKEGEAYH"
FT   gene            442624..442752
FT                   /locus_tag="VEA_000389"
FT   CDS             442624..442752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53077"
FT                   /db_xref="InterPro:IPR018895"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB8"
FT                   /protein_id="ACY53077.1"
FT                   /translation="MKVKNWCRQWAWMIGIWVVSVAALGLVSMLFRVMMTAAGLKS"
FT   gene            complement(442823..443578)
FT                   /locus_tag="VEA_000390"
FT   CDS             complement(442823..443578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000390"
FT                   /product="phenazine biosynthesis protein PhzF"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53078"
FT                   /db_xref="GOA:A7JYB9"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYB9"
FT                   /protein_id="ACY53078.1"
FT                   /translation="MIKAQVYDVFCDELAQGNPCGVIELNHWLSDSELLQITHQVAQPV
FT                   TSFVVQSSSDYHIRWFSLAGEINLCGHGSLGAGSAIISNYHKNEVILQSQYGHVTVTEL
FT                   DGMYRIVMPSWQAKPHVIPLDISGFSNRPVDAFTTRDLVVVLESEDDVVRYQPNFDELI
FT                   KIDEFHAVIVTAQSSDSGYVLRYFAPKIGISEDLATGSAQCSLAPYWFDKLGKEKLTAR
FT                   QLSRAGGYFEVARGSESTIVLSAHVKSRT"
FT   gene            complement(443979..444635)
FT                   /locus_tag="VEA_000391"
FT   CDS             complement(443979..444635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000391"
FT                   /product="2-deoxyglucose-6-phosphate hydrolase YniC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53079"
FT                   /db_xref="GOA:A7JYC0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC0"
FT                   /protein_id="ACY53079.1"
FT                   /translation="MIYAAVFDMDGLLIDSEPLWKEAEKQVFSSVGVQVTEVLSKQTAT
FT                   MTTGEVTRFWYERNPWQEKSLEEVENAVVDKVETLIIEKGCELEGVTETLKLLKEKGFK
FT                   IGLSTNSPYQLIPTILNKLGIASYFDAISSSDDVEQGKPEPDVYLSTINKLGVDSSNCI
FT                   AFEDSYSGMLAATRANIKTVVIPQPDKFYQEFNEASLKLRKLSEFNESHLVDLIG"
FT   gene            complement(444765..445646)
FT                   /locus_tag="VEA_000392"
FT   CDS             complement(444765..445646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000392"
FT                   /product="transcriptional regulator of alpha-acetolactate
FT                   operon AlsR"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000392"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53080"
FT                   /db_xref="GOA:A7JYC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC1"
FT                   /protein_id="ACY53080.1"
FT                   /translation="MEFRYLKYFVAVAETRHFTRAAEQLGIAQPPLSQQIKKLEHELGV
FT                   DLFKRLSRGVELTHAGQVFYTDAVNILADVERAKAKARQIARGENTQVKIGFATSTSTC
FT                   IKVLERVGRIQENGVHLQAAELSMPELAAQLKSKQLDLAIMRLPCYASEPFEHKVLFND
FT                   PFVAVIPAGHELAKYPCIQMKQLRDHKILLFPRETGPALFDGMSTLFADAGVRLESQFA
FT                   APQLRTTIAMAQAGLGIALVPRSLAEHLDDSATVAEIDDIPLTSRVVVAWEASNLNKQA
FT                   LKVAMNIGHVEV"
FT   gene            445744..446529
FT                   /locus_tag="VEA_000393"
FT   CDS             445744..446529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000393"
FT                   /product="alpha-acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53081"
FT                   /db_xref="GOA:A7JYC2"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC2"
FT                   /protein_id="ACY53081.1"
FT                   /translation="MRGFYNPLCACSLEVAKEFSEYHHVTGDGEIYQTSLMSALIAGVY
FT                   EGSTTIEELLKHGDFGLGTFNELDGELIAFDKEVFQLKSDGSANPADLAQKTPFAVMTF
FT                   FKPDIELPLTSRMSRHEVHSLIDDMVPSDNLFCAVRIDGVFDSVRTRTVPKQTRPYRPM
FT                   LEVVKEQPTFRFTHKQGVVAGFRSPKYTTGINVPGYHEHFITDDRQGGGHIQDYSISSG
FT                   FLQIGKVSRLVIDTPVSTDFLSANLAPEDINTAIEKAEK"
FT   gene            446559..448262
FT                   /locus_tag="VEA_000394"
FT   CDS             446559..448262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000394"
FT                   /product="acetolactate synthase catabolic"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000394"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53082"
FT                   /db_xref="GOA:A7JYC3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC3"
FT                   /protein_id="ACY53082.1"
FT                   /translation="MQSKPSNKNGAQLIAQQLESLGIKYIFGIPGAKIDRLFDAIEDTN
FT                   IQMIPVRHEANGAFMAGVMGRLTGKAGVTMVTSGPGCGNLVTGVATANSEGDPLIAIGG
FT                   AVKRTDQQKQTHQSMDTVSIFRSITKFSAEVQHVDAASEIMANAFRIAESGRPGACFLS
FT                   LPQDVLSEQTQTDIIVPSPYTQPGCADIAAIEEAVSRISKAKRCVVLLGLHASRSQNAA
FT                   AIARFLQNTQLPVVGTYQAAGTVDINYYHHFAGRVGLFNNQPGDVLLRDADLILTIGFS
FT                   PIEYDPELWNSHRNPVIHLDIEPAEYQLNYQPCVEIVGNIAQSLDKMGSYISEYARLSP
FT                   TALSVLEEVALQRQVIKTYPNVYNKQGFHPLALIKAMQSIITPDTTLCLDMGSFHIWIA
FT                   RYLSCFRARQMLVSNGQQTMGVALPWAIGASLLKPGSKVVSISGDGGFMQSSMELETAV
FT                   RLNCNIVHIVWVDNAYNMVEMQEFNKYQRCSGVKFGPIDFKAYAESFGAKGFAVTSQHE
FT                   LLPTLNKAMDVEGPAVVAIPVDYSDNDKLMLPRTEKNQDPVFVSFEGEIA"
FT   gene            448259..449017
FT                   /locus_tag="VEA_000395"
FT   CDS             448259..449017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000395"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000395"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53083"
FT                   /db_xref="GOA:A7JYC4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC4"
FT                   /protein_id="ACY53083.1"
FT                   /translation="MRGLKNKVALVTGSANGIGLAIAKRLYEEGANVALADWNEEQLAN
FT                   AVEGFDKQRVSAHSIDVSDPDKVAALISDVVTRFGKLDILVNNAGVHVPGSVIEGSVED
FT                   WKKISGVNIDGVVYCAKFALPELLKTKGCMVNTASVSGLGGDWGAAFYCASKGAVVNLT
FT                   RAMALDHGAEGVRINAVCPSLVKTNMTNGWPQEIRDKFNERIALGRAAEPEEIASVVTF
FT                   LASDDASFINGVNLPVDGGATASDGQPKIV"
FT   gene            complement(449109..450890)
FT                   /locus_tag="VEA_000396"
FT   CDS             complement(449109..450890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000396"
FT                   /product="choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53084"
FT                   /db_xref="GOA:D0M917"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:D0M917"
FT                   /protein_id="ACY53084.1"
FT                   /translation="MTDKLGVLYLALGIAAMCFMIYTVFSDLGQIKLGEADEQPEFGNA
FT                   SWAAMLFCGGIGASILYWGCIEWAYYYQSPPFQLEAGSEEAIRWAATYGLFHWGPIAWS
FT                   IYLIPALPIAYFFYVRKQPVLKISSALMPVLGEKRANGGIGKFIDVLFIFGMLGGAATT
FT                   LGLAAPLINGGLHHIFGLPNNTFSQVAVLLLCTAIFGYSAYAGLEKGIKFLSNINFWGA
FT                   MGLLLFVLAVGPTVFMLETGLDSIGRMLSNFFVMATWAEPFGGYGEFTDTHFPQDWTIF
FT                   YWAWWLVFAPCMGLFVARISRGRTIKQMVVGSIFYGSLGCFLFFIVLGNYGLSLQLTGE
FT                   LDVIAILNESGAPAAIFATLDTLPLGPIVIGVFTLLCIIFTATSFDSISYILASVVQND
FT                   VTEEPMRWNRLFWAFTLSFLPTVLMFMGGLSTLQTAAIVGGLPLLVISVMLMVSFVRAA
FT                   SLDIKHQAEYEEPTINIEELPEIDPWSTEGMALAKFERFKDLAQQAAEEEREAMAALMS
FT                   MRKIIRAFALEHSCESGFSDHHLPEEMQTELQQLTEALELAQQKKQELSEQAQESRMEF
FT                   NHVLLGGASAGLAASQA"
FT   gene            complement(451173..451778)
FT                   /locus_tag="VEA_000397"
FT   CDS             complement(451173..451778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000397"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53085"
FT                   /db_xref="GOA:A7JYC6"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC6"
FT                   /protein_id="ACY53085.1"
FT                   /translation="MKQAPTINQQFWDNLFTQGTMPWDAKTTPQELKAYLENALHSGQS
FT                   VFIPGCGAAYELSSFIQYGHDVIAMDYSEQAVKMAQSTLGKHKDKVVLGDVFNADSTHS
FT                   FDVIYERAFLAALPRDQWPEYFAMVDKLLPRGGLLIGYFVIDDDYHSRFPPFCLRSGEL
FT                   EGYLEPVFKLVESSVVANSVEVFKGRERWMVWQKSCRI"
FT   gene            complement(451903..453105)
FT                   /locus_tag="VEA_000398"
FT   CDS             complement(451903..453105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000398"
FT                   /product="coenzyme F390 synthetase"
FT                   /note="COG1541"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53086"
FT                   /db_xref="GOA:A7JYC7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC7"
FT                   /protein_id="ACY53086.1"
FT                   /translation="MNELFDAKESLSPQAREESLFQRLPTLIENAKANSEHYATHFAEL
FT                   DPTLANNREGLTQFPITRKFNMPNQQQLKPPFGGLNSVAIGQMARVFQSPGPLYEAQTD
FT                   EADFWRMGRAFHAAGFCAGDLVHNTLSYHFSPGGFIMDGGARACGCAVFPAGVGNTEAQ
FT                   VEAIKQLQPTGYTGTPSYLLTLLQKYQEQYDESPSFTKALVSGEAVTADMQQMFEDKGI
FT                   AVSQAYASAELGLIAYQVTGEQGLVITEDIIVEIVNPDGIPVQPGEVGEVVVTSLDEKF
FT                   PLIRYATGDLSAYLETGSDSPRTNARIKGWMGRVDSAVKVKGLFVYPHQIQEVCRRHDI
FT                   KGSLKIERDGFNDTITFCCHDVHVSAEDIQATLQSVTKLKGNVQFVPNQTEQPLINDLR
FT                   S"
FT   gene            complement(453115..453936)
FT                   /locus_tag="VEA_000399"
FT   CDS             complement(453115..453936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000399"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000399"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53087"
FT                   /db_xref="GOA:A7JYC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC8"
FT                   /protein_id="ACY53087.1"
FT                   /translation="MAELATNIEPAEILLSVNNIEVVYDEVILVLRGVSLEVPKGQIVT
FT                   LLGANGAGKSTTLKAISGLLKTEDGEVTRGEINFMGERIDNKSPEEIVRSGIFQVMEGR
FT                   RIVEDMTVIENLRLGAYTRTDNEVEQDIEMVFDYFPRLKERTGLAGYLSGGEQQMLAIG
FT                   RALMARPKMILLDEPSMGLSPLLVKEVFSIINKINKDQGITMLLVEQNANFALQAADYG
FT                   YIMESGKIVLDGSKHELLNNEDVKEFYLGGGDEDRKSFKNLKSYKRRKRWL"
FT   gene            complement(454017..455261)
FT                   /locus_tag="VEA_000400"
FT   CDS             complement(454017..455261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000400"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000400"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53088"
FT                   /db_xref="GOA:A7JYC9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYC9"
FT                   /protein_id="ACY53088.1"
FT                   /translation="MNKGHLATTLVLSSALFTTATWAKDSVFVGQLVDFSGPTAYVSKP
FT                   YGSGVRDALRWINQNGGINGTELEFETVDMAYKVPVAISNYKRWVARKDMVALQGWGTA
FT                   DTEALISFVTKDKVPVFSASYSGHLTDPTGKNPKTAKPAPYNFFYGASYSDACRALVKW
FT                   AKEDWESKGNQGAPKFTHIGDNHPFPNAPKEACAEYAEELGFEVQNPVVVSLKPGDFKA
FT                   QCLSLKESGTNYGYIANIGSSVISLVKSCNTVGTEFQYMANIWGGDKPVLEAAGDGLKD
FT                   YVFPGMTAFWGDDNEGMKLVREISKQSESEPGEFRTHHYIRGICSAFYMKEAMEWAKDN
FT                   GGITGENIKKGMYVHDNWVPQGLEGVCVPANWKPEDHRGTTTVNVFMGNNNGGAVDIKK
FT                   VSQVTLSRRDDWLGY"
FT   gene            complement(455307..456374)
FT                   /locus_tag="VEA_000401"
FT   CDS             complement(455307..456374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000401"
FT                   /product="branched-chain amino acid transport system
FT                   permease protein livM"
FT                   /note="TC 3.A.1.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000401"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53089"
FT                   /db_xref="GOA:A7JYD0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD0"
FT                   /protein_id="ACY53089.1"
FT                   /translation="MAQLSMRPCGDFRTTYKSDTPIFETKTIRSLAIAGVIAMLAAPLV
FT                   LDIYFLNLFIQIAYLGIAALGLNILVGFTGQISLGHGAFFGFGAFASAWLNNQFNIPVV
FT                   FAIPLAGYLTMIVGMLFGLPAARIKGLYLAIATLAAQFILEDFFARADWFSGGSYGAGA
FT                   NPINLFGFEFTTDESFFYIALFALIFMYMWASNLIRSRDGRAFVSVRDHYLSAEIMGIN
FT                   LTKYRLLSFGVCAFYAGIGGALYGHYLGFVSAEGFTIMMSIQFLAMIIIGGLGSVKGTL
FT                   MGTIFIVLLPEVLEFGVTGLAAFSNNTSFVDGLAYFKEMAIGLVIMLFLIFEPQGLSHR
FT                   WQQIRAYWKHYPFSY"
FT   gene            complement(456386..457279)
FT                   /locus_tag="VEA_000402"
FT   CDS             complement(456386..457279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000402"
FT                   /product="High-affinity branched-chain amino acid transport
FT                   system permease protein LivH"
FT                   /note="TC 3.A.1.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000402"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53090"
FT                   /db_xref="GOA:A7JYD1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD1"
FT                   /protein_id="ACY53090.1"
FT                   /translation="MNTDLLLQLVINGVIVGMLYGVVAMCFVLIYKSTQVVNFAQGEFL
FT                   LIGAWVCWAALVHLQLPFFIGFLLTLAFMMVFGIAVQTIVLRPLIGEPIISVIMVTIGL
FT                   SMFFQALMKWIFGVSAVSYPQVFETNVVNIGGLNVEFAYILSLIFSMFIMGAFYWFFKF
FT                   SKMGLAMRATAFNQQVAQSLGISIKKVFAISWAISAMVSATAGIVIGIVNGVSDALSII
FT                   GIKVFPAVILGGLDSVVGAIVGGITIGVLENLAEFFDSQYLQVGNLYNIAPFYVLLIIL
FT                   AFKPYGLFGTKDIERI"
FT   gene            complement(457279..459231)
FT                   /locus_tag="VEA_000403"
FT   CDS             complement(457279..459231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000403"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000403"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53091"
FT                   /db_xref="GOA:A7JYD2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD2"
FT                   /protein_id="ACY53091.1"
FT                   /translation="MAQQHNDWADITRLDTFPKVLQHNAKHWPEQVAMREKEFGIWREF
FT                   TWQDYENRVKWMALALQDLGVGEQDVVGLLGDNRPEWVWGELAAHAIKGFSLGIYQDSM
FT                   HEEVAYLINYAKAKVVVAEDEEQCDKLLELGDEIPSVEFIIYCDPRGMRKYDDPRLIDV
FT                   EQVYKKGQLIDKADPDKYLNMVEATKGSDLSILCTTSGTTSKPKLAQLHSGTFLDHCAA
FT                   YLRADPRSPGDNYVSVLPLPWIMEQVYVVGQALISRQIVNFVEEQETMMSDLREIGPNF
FT                   VLLAPRVWENIVADVSARMMDSTPFKQKMYKLGMSLANKALEQGKRSKLAEWILLRALR
FT                   DRLGFSNLTSAATGGAAMGPDTFRYLQAIGVPLKQLYGQTEMCGAYTVHQADDVDYDSV
FT                   GVAFDNAEVKVINPDSNGVGEIIAKSTGMFTGYLNNQEAYDEDVQDGWMHTGDAGYFKD
FT                   SGHLVVIDRLKDMSETSHGDRYSPQFIENKLKFSPFIAEAVVVGKGRPWLSAIICIRYA
FT                   IVAKWAEQRGLAFTNYTNLSAQPEVYQAIREEVLKVNESLPDAQKISKFILLYKELDAD
FT                   DGELTRTRKVRRGVVAEKYGDIIETIYSDDPKVDVDTVITYQDGTKTRIQTSLVIETLI
FT                   EHEPTLVDSEQRRIA"
FT   gene            complement(459231..460031)
FT                   /locus_tag="VEA_000404"
FT   CDS             complement(459231..460031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000404"
FT                   /product="putative high-affinity branched-chain amino acid
FT                   transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000404"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53092"
FT                   /db_xref="GOA:A7JYD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD3"
FT                   /protein_id="ACY53092.1"
FT                   /translation="MVSESPLLQVNDISLAFGGVKALTDVSFHVNEKEIFSIIGPNGAG
FT                   KTSMLNCISGRYTPNKGSVIFAGDDVTKRTPSQRAELGLGRTFQNLALFSHMSVLDNIM
FT                   VGRHHLLKNNFVTGPLYWFSNAQKEEMAHRKYVEDVIDFLEIQHIRKATAGTLSYGLRK
FT                   RVELARAIALKPKLLLLDEPMAGMNLEEKEDMARYIMDLNEELDITIIMIEHDMGVVMD
FT                   ISNRVLVLDFGKHIAMGEPEEVMANPHVKQAYLGEELPTLEESA"
FT   gene            460058..460174
FT                   /locus_tag="VEA_000405"
FT   CDS             460058..460174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53093"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD4"
FT                   /protein_id="ACY53093.1"
FT                   /translation="MRSIEHYLIKPNFDTGNRFYTYASTLYSVYVNVNLKSE"
FT   gene            complement(460274..461896)
FT                   /locus_tag="VEA_000406"
FT   CDS             complement(460274..461896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000406"
FT                   /product="electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase"
FT                   /EC_number="1.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000406"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53094"
FT                   /db_xref="GOA:D0M927"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D0M927"
FT                   /protein_id="ACY53094.1"
FT                   /translation="MEFDVLIVGAGPAGLSAACRIKQLAAEKEQDLSVCVVEKGSEVGA
FT                   HILSGAVFETRSLDELFPDWEEKGAPLNTKVNQDKTYYLGNEINGHELPSWAVPNTLHN
FT                   KGNYIISLGSLCRWMALQAENLGVEIYPGFTASQAIIDEDNRVCGVITGDMGLDKNGEQ
FT                   KGNFEPGIELRAKFTLFAEGARGHIGKQLINRFNLAEDKTPQHYAIGFKELWEIPLEQH
FT                   QQGLVVHGLGWPLANEATGGSYLYHLEGNQVAVGLIVDLNYKNPHLSPFDEFQRFKHHP
FT                   MIEQYLKNGKRISYGARAITKGGFHSLPTQQFAGGLLIGCDAGTLNGAKIKGTHTAMKS
FT                   GMLAAEAVCETLERQSVTADYQKHFKQSWLYEELYQARNFSSGIHRFGSWLGGGLALLE
FT                   HNVLKGKAKWHIRCDKPDHQSLLLAENSNKIVYPKPDGVLSFDRLSSVYLSNIFHEEDQ
FT                   PCHLRLANQRIPIEQNLELYAEPAQRYCPAGVYEIVQGEQQPELQINAANCIHCKTCDI
FT                   KDPSQNITWTPPEGGGGPNYPNM"
FT   gene            462068..462820
FT                   /locus_tag="VEA_000407"
FT   CDS             462068..462820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000407"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000407"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53095"
FT                   /db_xref="GOA:A7JYD6"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD6"
FT                   /protein_id="ACY53095.1"
FT                   /translation="MKILVPIKRVIDPYVKVRVKADHSDVETNNVKMTINPFCEIAVEE
FT                   AVRLKEQGIADEVIVVSAGGSQCQEQLRTALALGADRAIHVDTEDKIEPLVVAKLLKAL
FT                   VEQEQAQLVITGKQSIDTDNNQVAQMLAALLDWPQATFASDVKIEDQKVQVVREVDGGL
FT                   MTVAMNLPAVVSTDLRLNEPRFASLPNIMKAKRKPLDTITPDTLGVEVVFSQTIQEVTP
FT                   PAQRKGGIKVESVSELLDKLRNEAKVIS"
FT   gene            462817..463743
FT                   /locus_tag="VEA_000408"
FT   CDS             462817..463743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000408"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000408"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53096"
FT                   /db_xref="GOA:A7JYD7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD7"
FT                   /protein_id="ACY53096.1"
FT                   /translation="MKNLIIAEHDNNQLHADTLKVVNAAKQVSQDNVLIVVGHQCEEVA
FT                   QQACRVDGISNVICVDDEQLKHQFAESIAPIVVSVAEGFDAIWASSSSKGKDLAPRVAA
FT                   KFGVGQISDIVQVIDENTFIRPIYAGNAFAKVTTSDKVRVVTVRASAFEPVTCHNQADI
FT                   EHQQVTISEPMVELVSVDKTVSERPELSAAEVVVSGGRGVGSKENFALIEQVADKLGAA
FT                   IGASRAAVDAGFVANDLQVGQTGKIVAPKLYIAVGISGAIQHLAGMKESKVIVAINKDP
FT                   ESPIFEVADYGLVGDLFEVLPQLAEQL"
FT   gene            463771..465858
FT                   /locus_tag="VEA_000409"
FT   CDS             463771..465858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000409"
FT                   /product="acetoacetyl-CoA synthetase"
FT                   /EC_number="6.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000409"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53097"
FT                   /db_xref="GOA:A7JYD8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYD8"
FT                   /protein_id="ACY53097.1"
FT                   /translation="MFAPLFCFGHIQKELKLEGPMQNSAPIWSPSAERISNSNLLRFIE
FT                   TVNAHQTEDISINNYTSLHQWSIDHNDEFWRHTWHFCNVIGNIGSQVKSLGAPKWTQTD
FT                   STQSHVNRDTVWFADATLNYAENLLSQAEQTPEREFIVFTNESGEHKQLTGTQLLEQVS
FT                   VVQQWLLNCGVGKGDVVAGYLPYLPETVIAMLATTSLGAIWTSTSPDFGIDSVVERFGQ
FT                   VKPKVLFCCDGYQFGGKTFDMTDKNTTLSSKLSSVSEYATISVCQIEYIQNAKSASTSD
FT                   FVYWSDMAHHFSPQPIQYQPTLFNDPLFILYSSGTTGQPKCIVHSVGGTLLNHLKEHQL
FT                   HCDIKPQDKVFYYTTCGWMMWNWHVSALASGATLVIYDGSPVYPDHSVLWRLAEEHSVS
FT                   LFGTSAKYLEALEQANYSPKSEHDLKSLTTLCSTGSVLYPEQFNYVYQHIKQDLHLASI
FT                   AGGTDICGCFVLGNPISPVYKGECQGSGLGIDVRVLDDEGKTITQQRGELTCNNSLPNF
FT                   PIGFWHDNGERYHNAYWSKFTDIWHHGDDVMQTEHGGFIFYGRSDATLNPGGVRIGTAE
FT                   IYQQVNALPEVEDSIAVGKLNQQSEEIWLLVKLAHDVELTQQLTDSIRETLKTKCSPRH
FT                   VPRQIFAISDIPKTRSGKLVELAVKQLVNGQAIKNIGAIANPEVLEEIKTLFNIECATV
FT                   T"
FT   gene            complement(466037..467554)
FT                   /locus_tag="VEA_000410"
FT   CDS             complement(466037..467554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000410"
FT                   /product="phosphotransferase system
FT                   alpha-glucoside-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53098"
FT                   /db_xref="GOA:D0M931"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010975"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D0M931"
FT                   /protein_id="ACY53098.1"
FT                   /translation="MFVPVLLFPAAGMLLGFSVVLLNQEVFPWALEGSAWVKVSTIILQ
FT                   ASLAVFKNMALIFAVGLPIALAKKASGRAVLATLVSYITFNYVIGGILQFWGPELGVNY
FT                   TEGERGLTAVGGILTLDTNLLGAILIASLSVWVHNRFFDKKLPDWAAVFGGTPLVVIIS
FT                   FPIMVVMAILTCLTWPSIQHGINNLQSFLVSAGSLGVWLFTFLERIMIPTGLHHFVYGP
FT                   VFYGPVAVDGGTVAYWIQNIQTFAQSSESLTTQFPQGGLMLTGMGKVFGCTGIALALYS
FT                   VAKKENKKMVMGLVLGAAITAILTGITEPIEFTFLFIAPALFALHALLSATMATIAFMF
FT                   GVSGNFQTGLIDFIFQNWLPLAGNHAGTYVIQIIIGLMFTGVYFVTFRALILKYNILTP
FT                   GREGADSKLYSKTDYKEAKAVHNSSASPSQASAFIEGLGGKENIELLTNCATRLRVKVK
FT                   DVSLVKENAFFTQHGAVNIVRNQESLQIIVGLTVPQVREDMSQLIKA"
FT   gene            complement(467643..468971)
FT                   /locus_tag="VEA_000411"
FT   CDS             complement(467643..468971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000411"
FT                   /product="maltose-6'-phosphate glucosidase"
FT                   /EC_number="3.2.1.122"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53099"
FT                   /db_xref="GOA:A7JYE0"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE0"
FT                   /protein_id="ACY53099.1"
FT                   /translation="MKRQKLTIVGAGSTYTLGMMNSLIAEKDNFPLAKVVFYDIDEKRQ
FT                   ESNALATEILLREHYPEVEEFVYTTDKSVAFADSDFFFIQIRTGGLAMRERDEQIPLSN
FT                   SCVGQETCGAGGMAYGLRSIGDMIQLVNEIRQTCPDAWILNYTNPAAIVAEALNREFPH
FT                   DKRILNICDMPAAIMVSYAQLLGCEIWDFVPEYFGLNHYGWFTKIRNKQGYDLTDKIKN
FT                   IILKEGISAVDAEIADDPSWQATFKNMRTMLADNPEFLPNTYLQYYLYPEKMVAKEDIN
FT                   NTRARQVINGREKRVFELNARIIEAGTTKHETLHADIHGRYMVRVAASLAYNLSDVYLV
FT                   IVPNNGAITNLQNDAMVEVPAALTSDGPKAFTVGKIPTFQKAMIESQLGYEKLVVDAWY
FT                   EGSQQKLINALTLNRTVVNVPKAKEITKQLLEENKAYLPQFFQ"
FT   gene            469152..469859
FT                   /locus_tag="VEA_000412"
FT   CDS             469152..469859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000412"
FT                   /product="transcriptional regulator of succinyl CoA
FT                   synthetase operon"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000412"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53100"
FT                   /db_xref="GOA:A7JYE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE1"
FT                   /protein_id="ACY53100.1"
FT                   /translation="MKPKYIDIAERLEKKIKDGELQPKSMLPKESDLQEEFSVSRVTIR
FT                   KSLQILVDNNLISRTRGSGTYVNDLKAQHDALHLLGFIEEVSKQGKTPSSQVIKFELKK
FT                   PNEQVAKQLNLSPNDDTYEIHRLRCINDEPEIYEVTHMPAVLFPDLSIAIMNGSKYEYI
FT                   ENSKGLKIAKSSQSVKPYLLDAETASYLNESEASPILKVESTGYLEDGRAFEYTVNYFR
FT                   LHQYSFEFISTRT"
FT   gene            complement(469879..470172)
FT                   /locus_tag="VEA_000413"
FT   CDS             complement(469879..470172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000413"
FT                   /product="na+/H+ antiporter subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53101"
FT                   /db_xref="GOA:A7JYE2"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE2"
FT                   /protein_id="ACY53101.1"
FT                   /translation="MDVLIGLFLCLGTLLILSASLGVLRLPDLYTRMHAATKAGTVGVS
FT                   CLLLAVAFSLPEVTVISRVIGTMLFIVLTAPVASHLLGRAMREVGYKIWRND"
FT   gene            complement(470172..470450)
FT                   /locus_tag="VEA_000414"
FT   CDS             complement(470172..470450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000414"
FT                   /product="Na(+) H(+) antiporter subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000414"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53102"
FT                   /db_xref="GOA:A7JYE3"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE3"
FT                   /protein_id="ACY53102.1"
FT                   /translation="MDSWLQISVTFAYAGLLLSFVMAFFRLILGPTLADRVVALDLISF
FT                   ITIGFITVYTLDSGEDALLDIAITLGLVAFLGTIAFARLIVKRKEKE"
FT   gene            complement(470443..470919)
FT                   /locus_tag="VEA_000415"
FT   CDS             complement(470443..470919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000415"
FT                   /product="Na(+) H(+) antiporter subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000415"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53103"
FT                   /db_xref="GOA:A7JYE4"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE4"
FT                   /protein_id="ACY53103.1"
FT                   /translation="MIYLFLNLFLALAWMMLNGSYSSLNFIVGFTVGFFALRLSQPFGL
FT                   KTSYFRRFASALKLLVYFAYEMIISVARVVWDVVTPTHLSQPDIVYVPLDVDSDLEITL
FT                   LANMVSLTPGTLSLDVTPDKKHLIVHAMFAPEHEEVIRGIKNGLEHRILEVTRG"
FT   gene            complement(470916..472412)
FT                   /locus_tag="VEA_000416"
FT   CDS             complement(470916..472412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000416"
FT                   /product="Na(+) H(+) antiporter subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000416"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53104"
FT                   /db_xref="GOA:A7JYE5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE5"
FT                   /protein_id="ACY53104.1"
FT                   /translation="MSSILLTLPVVLSLSTALTIFFVRRSTKSVEWLSGASAILNLVVA
FT                   GLLTENIISNGIQAVAFGQWQAPFGIVFVADYFSVAMVMITAVIGAICVFYAMADLHRK
FT                   PSYSNYHALTHVLLAGVYGAFLTGDIFNLYVWFEVMLIASFGLMVLDATKTQIDGAVKY
FT                   VMLNLISTLVFLLAIGLLYGATGTLNLADLYTKAGESELSINMMLSALFLFAFSIKAAL
FT                   FPLFAWLPASYHTLPSGVVALFAALLTKVGVYALIRVFTLVFPLAESGWQPTLIWIAGL
FT                   TMLTGVLGAASQFDIKKILSFHIISQIGYMIMGLAIYTPLALAGAIFYIVHHIIVKANL
FT                   FLIGGFIERKYGSSQLEHLGGVYKAMPWLAFLFLVPAFSLAGFPPLSGFWGKFLVIKSS
FT                   LQAEYYWLAGTALLVGLLTVYSMTKIWSEAFWKKPVREKTEQTLQVKVHWLYCVPIAVL
FT                   TMFTLIIGLVAEPFYQFSVQAAEQLLNPNEYIRAVLGGNL"
FT   gene            complement(472409..472762)
FT                   /locus_tag="VEA_000417"
FT   CDS             complement(472409..472762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000417"
FT                   /product="Na(+) H(+) antiporter subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000417"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53105"
FT                   /db_xref="GOA:A7JYE6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE6"
FT                   /protein_id="ACY53105.1"
FT                   /translation="MEIVWSVVVGILVAAGVYLMLEKHILRLLFGIMLLSSAVNLAIFT
FT                   AGRLTPGEPPLIGDNALLPPDGAANPLPQALILTAIVIGFGLLIFALMLFYRAYKDSGT
FT                   ADVDEMQRSEEGQ"
FT   gene            complement(472762..475431)
FT                   /locus_tag="VEA_000418"
FT   CDS             complement(472762..475431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000418"
FT                   /product="Na(+) H(+) antiporter subunit A/Na(+) H(+)
FT                   antiporter subunit B"
FT                   /note="most likely function alternative not yet resolved"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000418"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53106"
FT                   /db_xref="GOA:A7JYE7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE7"
FT                   /protein_id="ACY53106.1"
FT                   /translation="MLNSITGKENLPKNPDNQLVLLIFPVLPILIFSFLFYIYTPAGVS
FT                   WNAEWIPGLDINFSFRLDGLSFLFAGLISGIGALIQIYALAYLRESDSRFSFHLYLTLF
FT                   MLAMLGIVMSDNILLLFVFWELTTITSYLLIGFNHENKTSRKNALQSLIVTGAGGLALL
FT                   AGLILLGAMAGSYELHTIIAQADTIAQHEWFMPSLVLILLGAFTKSAQFPFHFWLPNAM
FT                   AAPTPVSAYLHSATMVKAGIYLLARLSPVYAHSEVWFYALVITGSITAVWCTFVALKQT
FT                   DLKLMLAYSTNVALGKLTLLLGMGTDLAVSAVLMFILAHSFYKAALFMVVGNIDKATGT
FT                   RDIDQLYGLKSVLVISMVAGSLAALSKAGFPPLLGFLSKEYMYKSAVELNNWIAFVLLM
FT                   VNILMVALTIMLIARPFFARRDLVPIETKPVEAKKAMWVSPLLLALGSLIVPLVGLNWL
FT                   DHHIIFPGSADILPAADIKATSLWHGVNVPLVLSVITLVLGYVVYRVYPTVSAFFQRLH
FT                   LFVPKAENVFERLLDDMMTLAKWQTALLQQKKLSRYVLLFFAVLAVALLGQVAFIPLPL
FT                   FEQLSNVAFYEIGIALLLIGAAIVCTLSHSRLLAISALGMIGFMTTLVFMIYSAPDVAK
FT                   TLLLVETLMVVFLALLMRHMPRLTTVPKHSIKRKLANVCIAGVIGVSITFLLLGITSQP
FT                   MDSSVSEFFAANSVPGGHGRNIVNVILVDFRAFDTLGEVVVVVIAGIAAVSLLKTRAKK
FT                   QNRIQSLIFATTAHIVAALMLVFSVHLLLRGHNEPGGGFIGALIAVIGLSLLMFAESPK
FT                   YVRSRLYFKPFFIALFGVALSLISGALSFAFDKPFLTGLWWKDVIPLGTPLVFDVGVYL
FT                   AVIGGVMGMLLRINEELE"
FT   gene            complement(475900..476835)
FT                   /locus_tag="VEA_000419"
FT   CDS             complement(475900..476835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000419"
FT                   /product="universal stress protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53107"
FT                   /db_xref="GOA:A7JYE8"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE8"
FT                   /protein_id="ACY53107.1"
FT                   /translation="MKRFANILFATQGLPGHSEALEQAMRIASSNKVPVSGLIACPDFP
FT                   ADMLQYQQSYEQSLQDSLKQSIQEYRQKLDLSEDDLAFPLTVKSSEKPAVCIIQEALAD
FT                   NKDLIIKEAEPLGEGAEGFKAIDMTLLRKCPCPLWLHRPIDKPRDKRRVAVAIDPLTAS
FT                   DEQHSLAVRLLELSRSIADTCDSRLHVISCWEYYLENYLHDNAWIQVDDAELKHELDKA
FT                   KADHKQALQQLLEESGITGEIVIHHLHGKPDEKIPDYVESIEVDVLVMGTLARTGISGY
FT                   VIGNTAENILQSINCSLVALKPDGFVSPIQ"
FT   gene            complement(477232..477951)
FT                   /locus_tag="VEA_000420"
FT   CDS             complement(477232..477951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000420"
FT                   /product="oxidoreductase short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000420"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53108"
FT                   /db_xref="GOA:A7JYE9"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYE9"
FT                   /protein_id="ACY53108.1"
FT                   /translation="MKKLIVITGASSGIGEAIARHFSEQGHALLLLARRVERLEALNLP
FT                   NALCEKVDVIDKASFEAAIEKAEALYGPVDALVNNAGVMLLGQIDTQDASEWKRMFDVN
FT                   VLGLLNGMQSVLAPMKARNSGTIINISSIAGKKTFPDHAAYCGTKFAVHAISENVREEV
FT                   ASSNVRVTTIAPGAVETELLSHTTSQDIKDGYDAWKEDMGGVLAADDIARAVLFAYQQP
FT                   QGVCVREIALAPTKQQP"
FT   gene            478009..478995
FT                   /locus_tag="VEA_000421"
FT   CDS             478009..478995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000421"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000421"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53109"
FT                   /db_xref="GOA:D0M942"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M942"
FT                   /protein_id="ACY53109.1"
FT                   /translation="MLIYTDLVETLLLYCNNTFLNYAEVIMQTHINLADIRSFVLIAQL
FT                   GNFTKAAEQLGVSRSHVSRQITNLEQQIGATLLQRTTRTLKLTEAGKVLYKQCETALHN
FT                   IDQAVMAVVDDVEELRGEIRINCVGGYLGEDVVADIVAQFLIQHPQVNINLDFSSHRVD
FT                   LIADEFDIAFRMGKLDDSNFIARKLIDVEMGTYASPSYLETHGYPSHPKDLEKHICLTG
FT                   SVTRWAFENTNTKQSTEHQIRGQLRCKSGRVMIKAALAGNGIIRVPALYCQQELQTGKL
FT                   KEVFTDWSIPSVEFSLLYHHDRHQPKRIRAFIDFATQYFRQLPSKHK"
FT   gene            complement(479089..479862)
FT                   /locus_tag="VEA_000422"
FT   CDS             complement(479089..479862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000422"
FT                   /product="transcriptional regulator AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000422"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53110"
FT                   /db_xref="GOA:A7JYF1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYF1"
FT                   /protein_id="ACY53110.1"
FT                   /translation="MALIDEETQFDADKISNCVVGIAADIGKHDSGMHQHKKGQLLYAY
FT                   QGCMSFALKDSICILPPTKAVWIPPNTPHRALMTNVVAYRSLYFDCEEFACPSKITMIE
FT                   VNNLLQALIDKMSFWEWDKPSSEMVNTTALFWEEFYAAKRYSFQLPLPSHRRLTTFRRE
FT                   LVEPSFLAPSLTTLASKVGASTKTVTRLFKSETGMNYQDWRQQWRLLKAVELLSTGMQV
FT                   SAVADWLEFSSDSAFIAFFKKQTGQTPLMFMKTRP"
FT   gene            479962..481098
FT                   /locus_tag="VEA_000423"
FT   CDS             479962..481098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000423"
FT                   /product="multidrug resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000423"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53111"
FT                   /db_xref="GOA:A7JYF2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYF2"
FT                   /protein_id="ACY53111.1"
FT                   /translation="MNTKPSLWLMLVMLMFPQIVETIYSPALSSIALSFDVNHAQAAQT
FT                   LSIYFLAFAIGVVVWGVLADKLGRRPTMLIGLFIYSCASLLATQTESFAVVMAARALSA
FT                   FGIAVGSVVTQTMLRDAFDGQELSKVFSLMGMGISISPVVGMLLGGQLTGLGGYRYVFF
FT                   ALFLIALVLLAYNVIKLPETQKEQTPVRLRQLSWKMVRDARIWRSGLLVALYNIALFSY
FT                   YQLGAFTFSALGYSSEQFGYSGMVLGLGTLLGSYLNKSLVSKNVRKNQLLWLSAVLLSL
FT                   GSVGVLILSQSIWFVAPMMLVVMSYGIAIPNILSDALVDYKQQVGSAGALFGLMYYIMI
FT                   GTGLAMAGTVQNLGVVLLACSCLAILLAFSTKQVHTDL"
FT   gene            complement(481215..482318)
FT                   /locus_tag="VEA_000424"
FT   CDS             complement(481215..482318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000424"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000424"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53112"
FT                   /db_xref="GOA:A7JYF3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYF3"
FT                   /protein_id="ACY53112.1"
FT                   /translation="MKSQNDNQASYQDEPDEGRRNMMKMTGASVVAMGGGSLSTSSVQA
FT                   ETQINLGDTWDKTFTKSNQVQHRKVSFKNRYGIMLAADLYRPKNKSGKLAAIVISGPFG
FT                   AVKEQSSGLYAQTLADRGFITLAFDPSYTGESGGEPRNVASPDINTEDFSAAVDFIGLQ
FT                   KDVDRQKIGVIGICGWGGMALNAVAADKRVKAVATSTMYDMTRVMSKGYNDSTTFEQRT
FT                   QTLEQLSLQRWEDAENGTPTYGPVSLELVGGEPQFVIEYAAYYKSPERGFHPRAINSNA
FT                   AWTLTTPLSFMNMPILTYIEEISPRPVLFIHGEKAHSRYFSETAYEAAAEPKELMIIPN
FT                   ANHTDLYDQLDVIPFDKLESFFKVNLV"
FT   gene            complement(482542..482871)
FT                   /locus_tag="VEA_000425"
FT   CDS             complement(482542..482871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000425"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53113"
FT                   /db_xref="UniProtKB/TrEMBL:D0M946"
FT                   /protein_id="ACY53113.1"
FT                   /translation="MQSTATKEIIEKAKAEFDGQRFYKLNEYDEEINVSDDGVITFKSY
FT                   LPRSGGYEWVPIVIRDTSFRVSCDYFSEYVEAGMVVQVQFVGKRGRIENYDKQRCEEFG
FT                   EPTWQ"
FT   gene            complement(483156..483485)
FT                   /locus_tag="VEA_000426"
FT   CDS             complement(483156..483485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000426"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53114"
FT                   /db_xref="UniProtKB/TrEMBL:D0M947"
FT                   /protein_id="ACY53114.1"
FT                   /translation="MYFFVDENGLKTVYTPRQGKSLDNYKWIDISFEEPEFIPLKFEVN
FT                   ENKNAYFSLTRGGGRLSVVANSVDMIEDENAVEYYCELETETALDPNVRLKIKHVKPNE
FT                   FEAWD"
FT   gene            complement(484286..486517)
FT                   /locus_tag="VEA_000427"
FT   CDS             complement(484286..486517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000427"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53115"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYF8"
FT                   /protein_id="ACY53115.1"
FT                   /translation="MDAVFPIAQREGGAYYTLSDFTKLFDQAKSGRYLIGQGYGWHSGI
FT                   HLTSKMLPWGKGLRPIQAMLDGKIVAFRINPDYLTSTYQEQEFKYSNNFVLIEHEAVNP
FT                   EDNEDVFKFYTLYMHLAPPSDIGANSSITTRYRLQEARNVRTFKHSDVPTNSGEKKQSM
FT                   SKGTLLEYLYAEEKETHPYQIDKNTYKMIKCRVVENGKSASGSEKALLNKIVWFASGLN
FT                   SDFDILEDSSAVLSEPVSEPKWMSDKAAMIRDGSVVSLLPLLFREGIKVSAGEDIGYMG
FT                   LHEYSNDAIGTKKEDNRVHIEMFSFEEPPEFFKKQISPKNAEENPLVVLDGADSSGAVD
FT                   MSNSFIQQLLESVTEDQVTDFSSFTARDAKVYLDGKRKHFERFIVKHPTDWHTESSQSL
FT                   YESIHQTAKEALDIKCSAGFVTIEDYRNSPWRDQVMDSFDLFSQFELERADKFSWMQDL
FT                   QGDLQLSDDKSLWHYWPFIPQTQGAFKFTLEMLQEVYPEVKDSKRDVLQGIVNELNDHM
FT                   LFYKLDTPLRRTHFFAQLMQETGESLNMAEYTNYRISTLDTSEFNTARSRRYPLDHPKY
FT                   AGKRYIDVHGIADKKNGKFVKKDGTSPTLDDKRILFNVMYGGRSEMKNGDFLTTDDGWI
FT                   FRGRGLKQLTGRDNYERFNKWHLQNQSEWPLDVVDFLNTPELILEAKYATRSAAWFWLD
FT                   IKGPERADKGANDKVVNEITRKVNRYTSNKSYRKRRENFKLLWENKVFN"
FT   gene            complement(486530..487987)
FT                   /locus_tag="VEA_000428"
FT   CDS             complement(486530..487987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000428"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53116"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYF9"
FT                   /protein_id="ACY53116.1"
FT                   /translation="MGVTVGANGLSIVHKGSGGEANATLPDVCLTKVGKPVVPIPYGNN
FT                   AKSADLAGGTTTVSMDGGNSVAIKGSTFSKSTGDAGGDRKGVASGTIEAEAKFISASPT
FT                   VKFEGKGVCRLSDQMTMNKANTMCLGGAQNPSVSVTEEQEGTYTLDIECKYPNGLPYSN
FT                   AQFSLVEPSGAVIGSGVLDSSGKASVNGLALKECKLVLSETQDSYTPNQSLAENIVTET
FT                   YPDPNDFCTFVAGRRSPFWEDRVGVANDWGILMSPSFSDDDFKDIVLEQSRISSPYAIS
FT                   QNHSKDFSDAYVSALYHIQTDTTALEKYEPLVELLLEQVHENGDILRVLYQADVFEPPY
FT                   ELLAKLRFLGTGNTVKYLQFVLWTLINNQICSYIDELNSEIIGRLDFIQSQASARSLSS
FT                   VEEGINGYKKALNHFKQALPDVISQIFETKNDTLISISAMALGSTVNIASQSSFATNLG
FT                   RVNAVVYTKSNNLNRPSFVTFDDNFSD"
FT   gene            complement(488136..488927)
FT                   /locus_tag="VEA_000429"
FT   CDS             complement(488136..488927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000429"
FT                   /product="ImpK/VasF outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53117"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG0"
FT                   /protein_id="ACY53117.1"
FT                   /translation="MSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLSIDNMGI
FT                   NPLVDQFSWLIASLSCMSSIPWLDDPMPFREQVAREIRKGERKLNEMELDRASVLVIRY
FT                   CLCAAIDESVCRQEWGANSHWSQNSLLSEFHNETSGGDKFFVILDRLKADPRKYRHVIE
FT                   FLYLLLQLGFQGKYGREERGNEKLAEIGSTIYRLVRDDRLAEQEKVSLINLKAKYLKKP
FT                   LKRVISPKLILSLSAITFALMYAATYIVIDLKFQQLLEVYR"
FT   gene            complement(488924..490249)
FT                   /locus_tag="VEA_000430"
FT   CDS             complement(488924..490249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000430"
FT                   /product="uncharacterized protein ImpJ/VasE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000430"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53118"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG1"
FT                   /protein_id="ACY53118.1"
FT                   /translation="MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSNNASPLHWGI
FT                   KRLEINSQLLALGKIGITRAEGILQDRTPFELPLLAELPEVKDVDPSIADKVVYLCCPL
FT                   PSERSELFGTKKDGARYTMESQEAVDACYDSEDMANIVVGKLNFCLMYDHEDKSAYTSI
FT                   PILKISEVKPDGSVILDDSFIPTCIDIHASTVLNKFATEFASMLKHRAESIVQRLGVVD
FT                   QQGVSSVSDFMLLQALNRYEPLFWHFANTEAVHPESLYRILLQAEGELSTLCSTTRRPI
FT                   EFTKYNHGDLTSCLSRVLDSAKMTLSVMSEQRAIPLTLKDQNYGIRTAAIPDNKIIDTT
FT                   TFILAVKADVTLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAG
FT                   YTYFELDKTGEEWMALKNTAAIAIHVAGDFANLSLQLWAVRL"
FT   gene            complement(490261..490761)
FT                   /locus_tag="VEA_000431"
FT   CDS             complement(490261..490761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000431"
FT                   /product="type VI secretion lipoprotein/VasD"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000431"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53119"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG2"
FT                   /protein_id="ACY53119.1"
FT                   /translation="MRSIAVLLGFAMLSGCSMWDQFKESTGITPETSSIELVIEASPVL
FT                   NVRDGGQSSPVILRLHELNSPVLFRSLDFFALFENDKASLGDEYIKRYEYQIQPGGKVH
FT                   EMLTLDPDTRAVGFSVAFRDIDGSSWRKVEVIEEKSEYYIKLKLEGSELISDNTRGIEQ
FT                   VYF"
FT   gene            complement(490754..492247)
FT                   /locus_tag="VEA_000432"
FT   CDS             complement(490754..492247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000432"
FT                   /product="uncharacterized protein ImpI/VasC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000432"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53120"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG3"
FT                   /protein_id="ACY53120.1"
FT                   /translation="MHSNQLVLFISKCPEEYTGAKHIEMPESGGSMGRSPSCSVSLTDH
FT                   NRFISGTHCLISVYGDTYYISDVSTNGTMVNGNKILKNQPVAIVDGDIISLGQYEIGVS
FT                   LEHVTSTQDIAADIAPERVSNDPLVSLGDAVVEEEEKVGALEDLFMETKQDDIDCHDPV
FT                   AHLNFSMQRDDDYLIRDDEHPEPEQPKTVESTRQVVDDSFSIYSEFDQPSLIPEDWMAT
FT                   ETKSNASIKGSLGGENDTPYREDIVSEETVQPQTTILDRAVQRQHRAPNSTETIVEHTA
FT                   KGSKWEEMTQSFTPSSQTNQPLQMPAVEPTINSTTKEQAGIEATACSQDIAQAFFDGLG
FT                   IRNPELMTNEAQLFKQMGTCLRLCIDNLQKELHEVESLKEEQSTSESNSNIAELMLTLN
FT                   SQHLLAPNELVEQMLDELNDHQVTFNKALNELILEQSETNDPVAFANKVASQSLFSTKS
FT                   KLWGEYLDFYSNNRRLLNETSLKGLIKKNYNKVIKGNHA"
FT   gene            complement(492257..492856)
FT                   /locus_tag="VEA_000433"
FT   CDS             complement(492257..492856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000433"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53121"
FT                   /db_xref="GOA:A7JYG4"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG4"
FT                   /protein_id="ACY53121.1"
FT                   /translation="MLKPSQIGLISAMCLFSSFAVAKGERYGLSASMLTIDSINYEEGN
FT                   SGEQDTLRFGLVHSRPIDENNNRWRWWLGLNYLAEDIEAPASGLYQEVTNYELRVVPQY
FT                   ALASWSVFTPYVGAGLSAGYSQYSNRWEVDPEGYRYKSVEDIDQFELGAVIAVGTVIKL
FT                   GSNPDAHIQIIPQASYILPVINDGIGGLELSVSMLF"
FT   gene            493395..494708
FT                   /locus_tag="VEA_000434"
FT   CDS             493395..494708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53122"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG5"
FT                   /protein_id="ACY53122.1"
FT                   /translation="MFFSDFARRPIDENNPSGSNPNGSEDFDEIKRQINNLNKVTGRVS
FT                   WKTVQTLSKKILSTHSKDLRCCCYFTVASTYNDGLRGLVEGLNSLLDVCVVYWNTAYPE
FT                   HSKSKARMSAIEWMVEHTEKRINKHRALPEELPLIEAAHQLCLRIEEELRLHYGIQAPS
FT                   FGRIRRILNQWAEQIKEQQHAIELREKKQANTNASASAQATPEIKVNVSPSPAPDSPSP
FT                   LNNNEKTTPTKSGRFMIYFIIGLIVTAICSHFVYEQQRYRTLEQKISQASLNELVKLVA
FT                   SLDYENKKYAQSLKTPTINRVDIMMNNWFLDSAKVSNVSELDSLTNELIAIYPDSSSAQ
FT                   QLRQNFLTQSAHLEDQFMDVYKRFSDARTVFANVARQNVDKNSKTAYEYSNSLFPLLGR
FT                   IEYAEKYSQQKEIDRATLLLNIYLYKLSQLQAEKTDNK"
FT   gene            494736..498128
FT                   /locus_tag="VEA_000435"
FT   CDS             494736..498128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000435"
FT                   /product="IcmF-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000435"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53123"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG6"
FT                   /protein_id="ACY53123.1"
FT                   /translation="MFKQKLFRNPVVISTILTLLVAITITAIYLLFLKDADRLYLWLSL
FT                   SVIAIFYVTFQFTLWLKKKNSAKAQNLETEEEALSMVIQPLLANSGKKPIYLMLGNKGS
FT                   GRRQFLFNSSAIKPMDRTRTAKNDFFEWYESDSAVYIKPDQRLVFQEISSSDASLWNTF
FT                   IEEVIRHRPRKPFSGCLFFIDFEFMIVSEPEQKEYTISSLLERLSTINSKTSSALPIYL
FT                   IMSKLDKLDGFKEYMHFSSLKTRVEFLSIPLKEAKGVFSEYYRDSYRNLVKVLESNALD
FT                   ASANSTDIDEKQAILAFPKQFELCQSEVSYVLERLCDVNNGVYSLDIREIFFSSSLQGG
FT                   RKYNLLAKSCSNYFNLPIIASEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQ
FT                   RQSRLAILGSIILLAGGGYFFATTLDSNLHVMNQLLSIDDKSQAEHDARFSELLENATK
FT                   AIEPSYGAWLKGSKALDEEILPLNISRLDQSTRIAYEALLKEVAQQLIPLIEKGYRLQL
FT                   AQNQNAFTRALPLLKGYLMLNDPSKRDIRFLRHQTLQMMSDLSNRSDVVDQAMRYLDAY
FT                   FRTQFAPIDINMDLVRATRRSLLANSNVDLVYAGILNEASSIDLGTLDLQRAVGFEFSN
FT                   VFNTPIDSERLIVDKIYTSTGFSTFYRPRVDLMSQRVISDNWVLGLSQHVIPTNEEQEA
FT                   FKEEVRKKYTDDYINNWRNALSELKVQNYDNVGDLTNAIDLISGPSSPMTTVLKQVYAN
FT                   TQFSPVGEKSALISKLDPKLAAAADSASDAVEEVVKPDYLLMQRVEQAFHLLNQLQVSE
FT                   TPNSPTPWDETVAALSRVRTYMKDIADAPDPQMAALAAAQHRMNSTEADPLIKLKQIAQ
FT                   KSPEPVRSWLLDVVQQSWSVMITESAKGIQTQWYSEIYTKFKEIGLGKYPFDLTATEEI
FT                   SIEDFELLFASGGLLDTFIQKNFAPFYDTNLWTPKQVDGETMPISPALLVQLRNYNVIR
FT                   DTLINKSTNRVHIPFSARVLDLDSSAIRASLKIADTNMSYYHGPSRIREMAWPPQNGDF
FT                   NISITLQDVTDEGRQHVLNKSGQWAIYRLLGDSTLTNTHNGSFVSDIKVSGRDLSLRIT
FT                   PLTQKNPFTLAELYNFTLPESIK"
FT   gene            498157..498609
FT                   /locus_tag="VEA_000436"
FT   CDS             498157..498609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000436"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000436"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53124"
FT                   /db_xref="GOA:A7JYG7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG7"
FT                   /protein_id="ACY53124.1"
FT                   /translation="MISNMTLQGLDKLDRKILSSLLSNGRESIANLSRNIGLSRTAVAE
FT                   RINRLEKTGIIKGYTAQIRVENEGRKAASYLLISCEKGKKNDVTNALKEIPEVRLTSVV
FT                   GGNFDIIALIEAPDLQSIHHLCNEIESFNGIQRLDTTVVLHQPISR"
FT   gene            complement(498664..499662)
FT                   /locus_tag="VEA_000437"
FT   CDS             complement(498664..499662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000437"
FT                   /product="uncharacterized protein ImpH/VasB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53125"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG8"
FT                   /protein_id="ACY53125.1"
FT                   /translation="MINTLSDKSNEFSFYQAVLLLEKHYQLEPNSNFVAVGENKYFHQE
FT                   RIEFSVSPNLSFPKSDMDFIAHMERNGQQYSRVETNFLGLHGSSSPLPASYTEKLAGRD
FT                   PEDNPVKDFFDFFHNRYTSLLYRVWKKYRYHVQYQSGASDAFSGRILHLAGLSSVMQDS
FT                   KVAELDRAKILSYVNQLSTRTRSPKLISGIVSHYFSLPSVRIEEWVYRRVEIAESQRNK
FT                   LNRANCILGQNLHLGQSIADLNGKFNLCIDSIDFETFKQFSYDGELHKTLVGLMRFILR
FT                   DPMSWDLKLTVNLDSIPENKLGNGEGNHLGQTFWLGNPSDKDAKIRVIGSI"
FT   gene            complement(499659..501407)
FT                   /locus_tag="VEA_000438"
FT   CDS             complement(499659..501407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000438"
FT                   /product="protein ImpG/VasA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000438"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53126"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYG9"
FT                   /protein_id="ACY53126.1"
FT                   /translation="MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLL
FT                   EGFAFLTGRIREKIDDELPELTQSLMTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVK
FT                   RGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQTNSRTSSMIDVTLSTEHGLELSRI
FT                   GLDTLRLHLHGEIHITRTVFLWLFRYLDYVELDVGGGYKHRLGPEYVKPVGHEEDEALL
FT                   PYSKNSFAGYRLLQEFFSLPDKFMFFDIKGLEWLKGIPQRSTVKIKFHFKRALPSEVVL
FT                   KDKHLKLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQEHYEVYSIEQVESWSKDE
FT                   RRRKSLIEFESFEHQINQRDKREFYKSKVAERVSGRGLERYISFHTHNGDIAELGTETV
FT                   LMKLQCSNADLAERLSVGDITYATHKSPTYATFRNITKPTQSVSPQVNGELQWQLIANM
FT                   SLNYLSLANIDVLKVLLSTYDFHSRVDRQAHRASIHRLDGVISSEMKPIDRVFRGVSVR
FT                   GNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELEVFDEATGEVYNWASLI
FT                   GQQTIL"
FT   gene            complement(501418..501828)
FT                   /locus_tag="VEA_000439"
FT   CDS             complement(501418..501828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000439"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53127"
FT                   /db_xref="GOA:A7JYH0"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH0"
FT                   /protein_id="ACY53127.1"
FT                   /translation="MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHSHLADLLNTHS
FT                   GNAMIDNEYGLPDFNDVLSNNTNLVRHIQKNITSTIERFEPRLLNVEVNYREDHHNPLQ
FT                   LGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV"
FT   gene            complement(501890..503365)
FT                   /locus_tag="VEA_000440"
FT   CDS             complement(501890..503365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000440"
FT                   /product="uncharacterized protein ImpC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000440"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53128"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH1"
FT                   /protein_id="ACY53128.1"
FT                   /translation="MSAEAQAPEQEAALVESGSLLDSILNETRLKPSDEGFDVAKRGVE
FT                   AFISELLSSSNTEKVDQSLVDLMISEIDQKLSKQVDAILHNEEVQAIESTWRGLKYLVD
FT                   HTDFRENIQIELISAKKDEVLDDFEDAPEVVKSGLYKQIYTREYGQFGGKPVGAVICDY
FT                   DMSASSPDIKLMEYMANVGAMSHAPFITSASAKFFGLDSYEELPNLKDLKSVFEGPQYT
FT                   KWRSLREHEDARYLGLCTSRFMLRTPYSVEDNPIKAFDYDEQVTDSHDNYLWGNSAYAM
FT                   ASKISESFAKYRWCPNIIGPQSGGTVHDLPVYNFEAMGQIETKIPTEILVSDRREYELA
FT                   EEGFIALTMRKGSDNAAFFSANSVQKPKVFANTPEGKQAEMNYKLGTQLPYMFIINRLA
FT                   HYIKVLQREQIGSWKERSDLEIELNKWIRQYVSDQENPPAEVRGRRPLRAAKVEVSDVE
FT                   GDPGWYKVSMSVRPHFKYMGASFDLSLVGKLDQ"
FT   gene            complement(503374..503880)
FT                   /locus_tag="VEA_000441"
FT   CDS             complement(503374..503880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000441"
FT                   /product="uncharacterized protein ImpB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000441"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53129"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH2"
FT                   /protein_id="ACY53129.1"
FT                   /translation="MSRDGSVAPKERINIRYVPATGDTQEDVELPLSMMVVGDFTARAD
FT                   ETPIEERTPINIDKDNFNEVLEGMSPNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPE
FT                   AIAKSVPELNSLLELREALVALKGPLGNVPAFRKKIASVLQDEDARKKLLDELSIGNDQ
FT                   EAKEE"
FT   gene            complement(503907..505475)
FT                   /locus_tag="VEA_000442"
FT   CDS             complement(503907..505475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000442"
FT                   /product="uncharacterized protein ImpA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000442"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53130"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH3"
FT                   /protein_id="ACY53130.1"
FT                   /translation="MSNIDTDHLLKPISDESPAGNDARYEFCYEMMEAEVKKFGSLFGE
FT                   TVDWNVVKTNAMEVLEHHSKDLKALCYLVRALAEESGLKGFEQGLKLLNEALACFGSDL
FT                   YPSRKRGRDGAVEWLNHQFKLMSTKLADSAQSWELVSGCISTIEEVQRQYDDVYQDSEA
FT                   DFFEIRTQLNVLSQQAAADDQSDDAIATIEQAAPATQPAAVETPAQNDVQTASAKTVPP
FT                   TPKPAPVKKAVAKEVDVDTDFSSPTASKRTLKKVAEVMLHANPSDPLAYRIYRHLTWDD
FT                   IDGLPDHQNDQTPLSLAVSSDQQAEYRDKANQESDIDTIKRLERTLTDAPFWLTGHHFV
FT                   YLMLTNLGFDDAALAVKQEVKRFVESLEGIERLSFKNSIPFADEATLSWLSTQDATSSA
FT                   AQTVVQTVVIAEEDSLLVEDITLENLGEYAAELARKLELDGSGRGQFMLYLQLIAAYQS
FT                   VGLYPLCLPYLEKGWEVQNAFNLASWEPHLSSQLEDLIRKTLHQLFRSKDLLPEKYEEW
FT                   KAIYD"
FT   gene            complement(505462..507462)
FT                   /locus_tag="VEA_000443"
FT   CDS             complement(505462..507462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000443"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000443"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53131"
FT                   /db_xref="GOA:A7JYH4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH4"
FT                   /protein_id="ACY53131.1"
FT                   /translation="MSNNQSTAKGYIDQLVVKAIEKKKLNEQRLAEKNKPKLEYVLFSQ
FT                   FDVLDKLPSKNGKTTVYHLAKKGQPEKQICCKVINDDSPEFASKMLVNEASRLELSQHP
FT                   SVANFIKIGNEFERPYLMYEWIQGESLAEKMERHSFKGFRHDHIAWLVYQLAGALEFMH
FT                   TRGICHLDIKPSNVLVSEGDYVKLIDFGAARYIGETEPYAEASLNYASPLYIETGIAEP
FT                   QDDVYSLALLAGHLFLGSIFGDTWNKQLKDRKRPALIPAHIWKLLKQVINKPRGHGYTA
FT                   ISFAQQLARIDTQSINSNSNAPIFSSLRNADLLLTHCKSNDKTAYGRFKLLEASLVLSV
FT                   VAMTGSYLYQQNSDALDAIFAKETTPLSHTITPTDTASFLAEPPWKIKEVLAKTEQSVD
FT                   TTKAYREAYRVQQLSLSGLYNEKQTQLKSYQSLADGLPQTLVDLRKELVTLREELVRDG
FT                   ALFPYADETLTKVMSGLNVASVDSMKVSAIAGSRDKQIAHLILDGEAKLAEEEMKEAWL
FT                   LNQSQAYFYSQILPKRVMENINDSIDKHAEAHFYTKAIEEAELAKDYFGNTPELEKKIT
FT                   DLIIARSEFILFSTVMEQSIFDKQKLHESLADLERNAPRKFTEITKILDSMASDAINQS
FT                   HQFSKPANGAIAVARALRDYLTEGDANFVQH"
FT   gene            complement(507700..508644)
FT                   /locus_tag="VEA_000444"
FT   CDS             complement(507700..508644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000444"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53132"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH5"
FT                   /protein_id="ACY53132.1"
FT                   /translation="MHNSTGRYVLGMEVMTPTGMNLDIASAVSYADLGRFDQCVGDDGI
FT                   ERFTYAKIEYTKEIEQFEKTCELITHLLDSLLAQLPRSLRPIPLLIAVPASVSLVKVQE
FT                   WLGESHYADFLSVVNAVHASGPSFVLLAMKSLDKYDAMMCISVDSLVNSMQTLIDDAMV
FT                   MSTNNPWGVIPSEGGAGLILCRRNTIETLKLKPQAQLGYIDTELNTSDRRGMFRLVQRA
FT                   SKKIDSFGEVYSDMTNLRMHSEDYGFALGAKAERFTNPEQPQLINELWGTMGSCSSLAL
FT                   IAFAVRDHHFRQPTTLLMFDFHGDKGILQLLQC"
FT   gene            complement(508637..509629)
FT                   /locus_tag="VEA_000445"
FT   CDS             complement(508637..509629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000445"
FT                   /product="pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000445"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53133"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH6"
FT                   /protein_id="ACY53133.1"
FT                   /translation="MQLWDIEAHPELSLKGRFQRDENGDEVWVVVAKRTWQFDGVVWHE
FT                   LGESEIFDDPQYLGEEGFSAMKVDHEFAYTKDNTDVLVYGKARSYAKKPVTYQECRVLI
FT                   DGHIDKSLAIHGERVWVEHAGSITLSNPVPFIEKDIDYTCAIGGDLRNRIGGGIADSNK
FT                   ELLEQKVPSVFYPREDWSATAKKLRVAGFGPVPPFFESRQKLAGTFDYDWIENRKPMLP
FT                   LDFDKRFFQSAPIDQQCKGFLRGGERLMMSGFCHDDTLSFRIPKEKYRATAVFNNDSYQ
FT                   VDMAMYTLFVDAEKKTISISYTAAFPCQGKEHLLVSTSIAKLEEVSEHA"
FT   gene            complement(509610..510929)
FT                   /locus_tag="VEA_000446"
FT   CDS             complement(509610..510929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000446"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53134"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH7"
FT                   /protein_id="ACY53134.1"
FT                   /translation="MRQRIGAEHLKAPITNQEVEGALAKAERAVNDLSQLPVTWLDFCN
FT                   EKLSIASESIGFLIRQRVQIHKRGYPSRELEYLKLIERQIEELKQVYLSFYRLAPGLIH
FT                   QLRGQEPEIYGWLMLQGELGSELDNLLCGLSLLEELDAKTAMVIAVQSPVESMDSTLSE
FT                   LIEGNATSSAFYFECLRVRQTLSVSLIKRWNKASIISSHVALPLLALQDVKEGIDWLND
FT                   NEGSEQYLFERLITKRDRGTWFRQSFGIEPSGLPSAQALTYAKLLELKEFEAFDISSPL
FT                   APVDFALSGDWKLMPPIIEHLESLEEAEGEIWLQALYVVYGKLLPLTPQDVGVEYEWED
FT                   IVDLLNEWVEDEKYIQNLPSRLGYALSFESTLAAMQDANVDVLFRDWLWRQLCIQSRAY
FT                   VPWDMAMPIHQQDWNFNNLKAAPSASERFNLRNSNAVMGY"
FT   gene            complement(511041..511439)
FT                   /locus_tag="VEA_000447"
FT   CDS             complement(511041..511439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000447"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53135"
FT                   /db_xref="UniProtKB/TrEMBL:D0M968"
FT                   /protein_id="ACY53135.1"
FT                   /translation="MAINESTGSVRVDFDGNPFKQPLTARLGRGFRRSELQMAIDNRLS
FT                   CRIEFLNDDLSLPLVTDIFFSILDDSDEFVLRAKKMVIETEQELIVKSGETETRYSGRD
FT                   GRITTKAKYVTSQAEKAQKIQGGTIAIN"
FT   gene            complement(511526..513604)
FT                   /locus_tag="VEA_000448"
FT   CDS             complement(511526..513604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000448"
FT                   /product="VgrG protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000448"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53136"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYH9"
FT                   /protein_id="ACY53136.1"
FT                   /translation="MVNDVEFKFEVPGCGHEFRVESFHVHEELSKPFHINLSLLSLDPD
FT                   ISFDELIRKAGTLTLYGQGVGAARVFNGVVNEVRYLGTGRRFSRYQLVLVPQAWFLSQR
FT                   QDCRIFQQKSAQDIITEVLDDGAVTDYRFEVSGTYPPKEYVLQYRESDLHFVQRMMAEH
FT                   GMWYYFDHSDSNHTMVIVDSNDAIAPLISSPLNASYIGPIVYHADGGGVADREHISDLG
FT                   LVNRVRTGQVTYTDYNYEHPKIPQEMTQAGDLDQDLKQFDYPGRYVDPLMGQVRTTEWM
FT                   SEHIVDNQQVEATSDVMRLASGYSFNVSDHPRSEINRDYLMLSVMHTGQDPQVHEDEAS
FT                   GMPTTYYNQFSCIPRDVVFKAPKLAAPVVDGPQTAVVVGPEGEEIYTDKLGRVKVQFHW
FT                   DRYGDNNEHSSCWIRVSQSMAAPTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGL
FT                   HFPPYSLPENKTRTTFRTQTHKGTGYNELSFEDEANQEEVYIHAQKDMSTKVLNNRYRD
FT                   IGQDEFLKVARHQTNEVHGDHKETIHGHKTTQVNSTFTETVEQDVTVTYNANEAQYVKN
FT                   NSDLEIGDNRTTKIGKNDDLDIGENSNLTIGASKSSDIGADDNQTVGGNLTVSVKGNTA
FT                   YKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSAITIEGSDKVVVKGGNVVVN"
FT   gene            complement(513677..514195)
FT                   /locus_tag="VEA_000449"
FT   CDS             complement(513677..514195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000449"
FT                   /product="Hcp protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000449"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53137"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYI0"
FT                   /protein_id="ACY53137.1"
FT                   /translation="MPTPAYMSIQGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELD
FT                   HVLTVPRDPQSGQPTGQRVHRPLVVTKVQDRSSPLLFNALVSGEKLPECVIRFYRTSVQ
FT                   GKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKFTYRAIEVTHENCGTAGN
FT                   DDWRAPREA"
FT   gene            515267..517330
FT                   /locus_tag="VEA_000450"
FT   CDS             515267..517330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000450"
FT                   /product="ClpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000450"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53138"
FT                   /db_xref="GOA:D0M971"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D0M971"
FT                   /protein_id="ACY53138.1"
FT                   /translation="MDILARRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGV
FT                   ELYGLDMGLLQAGASVKGEFEKRLNAVLDEVKNSPTPIILFIDEAHTLVGGGNQAGGSD
FT                   AANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRFQLVKLDEPSPEQAALIIRGL
FT                   RPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACARVNISLNAIPASV
FT                   ETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLELAMETTKEELAEQEAQWHKEK
FT                   EQIQEMIALRSRLHELVFGETNEEELVAEEDSEQEQDVSPYAEMDEEAVRIAISACQEQ
FT                   LDAIRNGNPLVHFEVGPDEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEY
FT                   AIDALSEGIQTAKAGLGNPDAPTGVFLLVGPSGVGKTETARSIADQMFGGERFMTTINM
FT                   SEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEKADPEVLNLFYQV
FT                   FDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKDIDANIIAEAIRPTLNQHF
FT                   KPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLQSHHKLSLSYEESLVEFVLGNCR
FT                   LAETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQIEVSVDEQGTLTYAFS"
FT   gene            517317..518948
FT                   /locus_tag="VEA_000451"
FT   CDS             517317..518948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000451"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53139"
FT                   /db_xref="GOA:A7JYI2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYI2"
FT                   /protein_id="ACY53139.1"
FT                   /translation="MRSANHSELSNALLAISQSLADRSQLTQTLDAVLTAARQMTLAKH
FT                   GIIYVLDQTGQALIPSTAHHNDKTIVSHPWEALQLDSASENDPFNFAIRNGEVVLINEL
FT                   YKYNGYDCESIYQTEQTLGLKSENLLAWPLIDSESKTIGLLVLLDLNVIDNEAALTEFC
FT                   RMAASNIRQAVWLEQYGQVIKNLNADNQALVRENTQLKKRTQKAYQGPIAESEEMLNVL
FT                   NRLDKVLSLPVDVLLRGETGAGKEVIAKYIHENSNRSEQPLIVQNCAAIPEQLLESELF
FT                   GHKKGSFTGADKDKVGLFEAANGGTLFLDEIGDMPMLLQAKLLRVLQERKVRPIGTSKE
FT                   IEVDVRVIAATHCNLMQQIRDGGFRADLFYRLNVFPITLPPLRARKSDIIPLAEHFVQH
FT                   TTNTLGLPQAPGLSANVRKQLLAYQYPGNVRELKNIIERSVLLSDFETITHIEFGEQIP
FT                   ESVPSIDMKAASPTPEQPAYEQQAQADLEDVSKSLKDVVSQYERTVIIDCLNACNWHTK
FT                   KAAEQLALPMSTLNHKMKKYDISAAG"
FT   gene            complement(519033..523808)
FT                   /locus_tag="VEA_000452"
FT   CDS             complement(519033..523808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000452"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53140"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYI3"
FT                   /protein_id="ACY53140.1"
FT                   /translation="MVDLCTYDKPMYLLGVYFQGEETEAGREFSNWNTVSDLTSVNHVK
FT                   NVRPIPFTPILIDALSQDSVTLPRFWGSDQYGRLCKVSYLSEAEESKPQVLLRHNSPIT
FT                   TIDDAHDYEMLFPPTNLIGQLAKSSSSITEIKETIKSLYTKMSPQLNQPRLFKPSKVSV
FT                   KQLAKPYTQEFGALLSQEEENYNQWYADIQSSGVEFIEGFVVPSVNTISIVFSSDIYIG
FT                   AEVSLIKYRSHLENQQQTSEQVLARGIVVRPFYDDEDQESQEFNDTLPSVSFNLPSVIE
FT                   PSSSESTSEGNHIVLGDGFYGLRVQFFVQDYLKENKRLQNKFPEVIKSGRLRFERNKSS
FT                   AVTGLEEQDCYTYELNEKVTFKSISGYGKLAIVCGDMISLEECLFYQYPQALPSNYSEL
FT                   MTKTGKSVPLSGTGVNTLGLASAIKKNAESLAEGFLMGGNPFSDNLKATMFSVSKGIWS
FT                   DIEKQKLPDLMTSSVALAFGFSAFKESRKELTKAIRFANKGLDFNQAAALAFRKSGMNI
FT                   SFIKRELDVIKANLITGTFSENSTRLARSWFNGSVMEKMNRAFPILESGSSLVDLYDLV
FT                   QKENELEKKSLEAKEDFDAVSQSYLQSISVIKAYQEWAQALDDAKNVINGSDGEEIAHI
FT                   VEDSQGLAIHINFKFNEWQHGNEHGKLRTDIKQVCKYLSQLMLDNPSYKVSIEGHAGRI
FT                   GSSDANALVAAKRAKTVTNAIISIDPSLEERVYTASYGNTQPLTADSTKSDMSQTGDSA
FT                   PAALDRRVEVRLIIPNYQVVLPPSRSGMVELEKARQLKQALDVGLDDTQKAQVAAVLTT
FT                   LSGFAMFTPLAPLAAGILYLRSGAELADCALSVLDELITEKAYSDFKGRYQNIDQLNQL
FT                   GKIHIRVLQQYRDLEVTIERSEIKTRDEVESHLKNKETVQELQKRFLLRALALNGLVEL
FT                   LARISLWNPNVSKLQGLLEEYRVKDYIDVYVINDNWEAPLSSYNTMAQNWIQRVRDDKS
FT                   GVSAARAFAQSWKNEHSPQLSPLLKRARIQGEFNKGFPVQARLYQGDADNGFSDFAKMF
FT                   DNNVESIKSDDIGFSRLLVDSKGDGVSWKPLEEWISPNKTNRITPFTRVKVQIVLSSNA
FT                   SKSKKKIFKTTLQYCCERSLWDFKGPSFEVLMAPRKADDLTLCGSNDKLKSYFDQHAVE
FT                   EHLTCVEFEPTYWFGEYEIPGLKPLYSNYEMQSFDKWKQSGEARSMQYYFTADGNTLSL
FT                   AGTEQQLSKFNYGVDDNNTYGKQCYLNDDGEVEVDGLPLVLYDGLANRQVVINEYDLLI
FT                   EEFVKSASAKKTEGIAPYLKGDVSSFSAVSKGSGFEWFDDKAPKSSVLDWSNDKPVTIY
FT                   VALLSEGGEKETYKRMMGEGYRVPMRLSLSIEEQESMFSKDTTEGPSFFGSLLEVGEYT
FT                   YKKEVPSPYAKVEIKEVSFTEADTEITSDLASFVQEFQAKVKDAPNRYLDPFNDRRTLH
FT                   IVKFELRYTSPTGRRVPTLRPFGPIVDKKKAEFLPVHISVSSLSQTGLAPGVGEYPIKQ
FT                   SQKLSLPGGQKYSVEGVPWMEIEGDASRMNDSAFLYWQKELANNPVKRKAWIEDWIMKE
FT                   PMNVSAPQQESI"
FT   gene            complement(523808..524911)
FT                   /locus_tag="VEA_000453"
FT   CDS             complement(523808..524911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000453"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53141"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D0M974"
FT                   /protein_id="ACY53141.1"
FT                   /translation="MKKTLLITLLGLAIIGCNDQSQQSASPVSSSAQTEQEKHPDRVYV
FT                   GEHNYYVMESAVTNENWVSDDKIKPMPGMFPKYYVFNSDEWPKEDINDASSYDLPRFQF
FT                   AWDNDDDDRVKLKIWSMKTDGTDLRLVVPDTKVDGIVLIRRSPNLRYVAWIDRGTGKYV
FT                   YDLKTGVKTRVMGLGSPGMVWSEDSRYLYFHTMGDFDNARWDSETGEIEAIDFGVGPYA
FT                   VLNNKTITNLSYTGVFKRNLTNNALKHISIKPKGKVQQREWLKFRGMSPMGRYAWGQNA
FT                   QNRFFFDIENETVKKYDKTEYVGSGILGKDARFSAHDRVSRMTVVDRETQIRWQWYALG
FT                   TGEIGVNSNMSLYNGLANDGLWFKESE"
FT   gene            complement(524915..526609)
FT                   /locus_tag="VEA_000454"
FT   CDS             complement(524915..526609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000454"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53142"
FT                   /db_xref="UniProtKB/TrEMBL:D0M975"
FT                   /protein_id="ACY53142.1"
FT                   /translation="MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRLRNSDDILRNLP
FT                   KELAQKISISAKITTSALLAAIRIELGKGNWVSLSTVARRSPLTDSQLQSFPRLKTLVD
FT                   SVSASNESKVFKAGYKQVTDDVALVRSYTHVPSEPSPDQKIVVEFAGQWSSNAACLMLG
FT                   KTETQKEKVTVGKADTENKHRSLATFKDLEAEGKTLYIKIPCSDQPQPILLKLAEDLQP
FT                   VDKETQMDEWDNVLVPVVPLYKSGSSWDGYTSGRVYIIWKGEVWRELQVTSNGYFADVD
FT                   MSSSRKKTMKTRHVNIDGSSLFPGENVAFEPFSILQDGVEVFSGELDINEQARVFSLLA
FT                   EEVEVKFAGFAHEQMMVSTHPSPMKASSAPSDEVLGYPLPHIWLPYKIKGECQDVYLYY
FT                   SPQALSDGAVSELESNYQSMAISLSEMSDYSSSKDFTLQTVFKLPKLSENQKVKAVVNE
FT                   QSNCNVAAVNIPPPGSEIILRYRVLGSTDQPDDYFMLQNEEHGWSQKAYFRCATPDVDG
FT                   YLNLRFSGWPEKVKEVDILRGAHASRGNETPETFKLREKVKVTDLLG"
FT   gene            complement(526705..526818)
FT                   /locus_tag="VEA_000455"
FT   CDS             complement(526705..526818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000455"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53143"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYI6"
FT                   /protein_id="ACY53143.1"
FT                   /translation="MLLAFVVVKSHVLIVKITICLVFLNSGDFSISLKING"
FT   gene            complement(527378..537790)
FT                   /locus_tag="VEA_000456"
FT   CDS             complement(527378..537790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53144"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYI7"
FT                   /protein_id="ACY53144.1"
FT                   /translation="MVFDAPVNGAKIEVFEFKNGNLGRKLANTTSDAFGNYLLEFESSS
FT                   MPLFVVAKEGSYTDPFTNETVSVSNAKTLKFEGVVNFKEGSEQKLMLTPLSNLAAGLAK
FT                   YKISQGTTDESAFSTALDSINSMYGFDVNETKPIDITKGGQSSFASAGHQYGALLTAYS
FT                   SYSYDLIKKYGNSDNVYTSMHFADIQYRDVIADGVLDGLEVSQTSGAVTPLSFGQKKIN
FT                   SDIYTRDLSQHVLIVVNDPSVNISGTDAADYVDFSKKLNDLGTYGSTDGVIPPRDGTDI
FT                   DTDAPIVTRTDSDVLAGTDKVDLKIVDDIGVEDVSAFIQYQVNGSWSGEFQCNDIQDFG
FT                   STFCSVEFDDFEVGLRETNVKVNINTKEIDSADMNPATGLSNVAAARLVLYTADVLGNE
FT                   LIPGSHSGLHINFEWDNDAPVIDITSASAINNQLKEYVLKGVVKESSQEISSVSISFKD
FT                   GLHEDVTCSPVTVESGNACEFSKAYPIDEFLSTTVFEVRAKDSKGNTGTAQHAVSRDDQ
FT                   APAQTITYPEGASMTYVNVGLDGERTTYDGIYSQDTYTPDNVQASRDYLKIDYAYASIG
FT                   IQNSLKGVDFSNFNANLLKENKIPYVRVKVSDVNTDTVLGSNANKLKLVVKYYVSQNND
FT                   NNYSLQQVIDTTASDDDYIAKIPHETLLDSNGRVEDVIYYIPFVRDILGDSFKSVSENS
FT                   SQKLVIQTVDESDNESTPREVYFRSSFDLPTIKVVTPFIGARAQLEGLSPNGEFTSLAS
FT                   CTTIQQLESDQSMALDVASCETTTDVVNYDFMRVRLIGIEGSEPYYYQWKRDPGTKKVT
FT                   VDLNKANIGVYFKLNGSQTYYITELSTYQTSLFDFQWDQVTAGEKTSERAIQILDEVRY
FT                   ALSGTNNSSFFGFDPTVVPYATNEMLATKAIPEKPSNDYLHRFLVEAIDSIAQGMPRNN
FT                   SLDFASAIYDDLSFDGKANGIGVGGRQVMLDSYQFGSDTYRKDLAQSYYEIMASKYGIE
FT                   TNIAQLYADDISMANPNLNGKNIFDTEGSSIDILPPQPKLTIESGRETMVGNRLYIAGE
FT                   VVSKIILDDPSGIVETDAYGPKFSTMWYQASGPNIEIPLDINIVENPGNSNAYRKEYLF
FT                   TLNSQSSELKDIVEFAVETSAMDPHGNAYGYDGKDPFIETVFIDNDFPKTSYLPPNDVD
FT                   GKPVEDGIYLNAKNTHELTFKVEDVVGDKLSSRGLVFYQQTGEKVTYTPEDFANNSKDA
FT                   FKVKLCTGELCSNQGATIYPGDGDWLVVAAAEDNLGNSVSELTSTAPRFNIRIDSEAPI
FT                   VKSEQVQSRLGGNNQWTPVIDWGTLSSGNNVKIDLRRGSGQALTLESCDPLTEACDVPY
FT                   LVGEQPDVKVQLVSKAFDYDEWNEFYVTATDNAYPANVSTTGKFTFQVDNKGPEIILNT
FT                   PWVEDTLSKENYVIGREFNVRFKSVIDDSDLEQVSLYQSGKDSPIKTIVPTDSSKEFVM
FT                   SLIKSDTDKIDISEDEKTTSLYVKATDIYGFESSSNTHKVILDRDGPTLGLSGFNANDY
FT                   YLGNYVFDLTALDLNANGDVSINGVNRESLEYWTFSDLEPLPGSPGTKINEDLKVSLGD
FT                   LGTGTHKVRLKGSDVRGNTTLTSDEQDFTVKVYNSIPQVTLAMSYTDGTPITNNTIYQD
FT                   GNIVLTLDIVDDSGVDRIDSTYRFSGEQNGTNFTFSETADGTWTATLLSTQIAKDGNYE
FT                   LDIKVYNKVRYLDEKDRKVGKVNQTFSVQREGVVLTVESPLDFQNYLSDGVLDVTFTTL
FT                   SAVKAKTLECWVREEYSSLDAPPTNEQPTSGVINVSQEPYSCSVNVGQNMTKAPVTLIT
FT                   KTLGTNGRETINKFNFSMVDIDAPTVVDGNSYSFKGSDVWFDEALKKKMLTFELSFNDA
FT                   LSGVNTESSDEYPKLVRNLGNKAYTPTTCAKGVGNIKCTYSESYADIIDGLSTTQEYKI
FT                   KNLSDLAGNLTAEHDLLLELPKGSVVVEITDPIGNTTINGQQLVAKFRIKLYENSRLDN
FT                   VMARFGTESYNYKDNPEKFAQLEVCADDPTYKCSTFTSELPSDADGKTIRTIITATDVW
FT                   SRVGEATVDIKVDNTPPSVGDEIIVTESPTNPDNVRFRFDITDTGSSLAKVNYSVLNPS
FT                   YQEERVEDGNGSSTYFELPKSQLEGRGSITVDIKATDSVGLYSDIRKVIDISVPKVTVD
FT                   FDGITSLQGGKLFLTKASQPFTLSTVEGERVKASQYSVELIPSLGDSLRYSGDVISSSG
FT                   NGMMNFAVDNQGSYTLKVTVTDSVGRENTSFELLGKSYDGQVIESIVDYDVPSISGLSA
FT                   NQISKIPTNDKYQLEISAYITDKNLNLVTSKAVSGGSTVAPQAITEPTTEAGPYVISYL
FT                   LPKGDHTITVAATDKVDNKSESSIDAHVEAATVPGLRISTASSAPLFGGEEITLAFNFT
FT                   EEVTNFDISDVHLVASDSGATGTLKQDTWSTSDNITWMVNYVSPEKQDKNITIQVEDNS
FT                   YQSTNTIPGKGSSLSIAVEGTLPKLTNVTFNPEHQSVGQSVSVSLEFDKELQEATAKLG
FT                   GNRISSLSATADKKVWVGNVQVPSTALLSVDLVVSQFKDLTGNIGEDNTAHELPITPTL
FT                   AITPVGSVDETHAATLQFEGTSTRFGGQSLRLEVKAQGSATVLKRGSATVQAGGTWTSD
FT                   AIDMSHQTNGTYTVMVTGTNSAGIEVSESQSFTLAQSLPTLTNVTFTPEHQAIGQSVTV
FT                   TLEFDKDLQSAAAELGGTTITSLMATADPSVWTGDVVVPDSSELNVALLVRDYQDLSGN
FT                   TGSQNTAYSMPITPTLAITPVGSVDETHAATLQFEGTSTRFDGQSLRLDVKVQGGATVL
FT                   KSSSATVQAGGTWTSDAIDMSHQTNGTYTVMVTGTNSAGIEVSESQSFTLAQSLPTLTN
FT                   VTFMPEHQAIGQRVTVTLEFDKDLQSAAAELGGTMITSLVATADPSVWTGDVVVPSTSE
FT                   LNVALLVRDYQDLSGNTGSQNTAYSMPITPTLAITPVGNVDETHAATLQFEGTSTRFDG
FT                   QSLRLEVKAQGSATVLKSSSATVQAGGIWTSDAIDMSHQTNGTYTVIVTGTNSAGIEVS
FT                   ESQSFTLAQSLPTLTNVTFTPEHQAIGQSVTVTLEFDKDLQSAAAELGGTTITSLVATA
FT                   DPSVWTGDVVVPSTSELNVALLVRDYQDLSGNTGSQNTAYSMPITPTLAITPVGSVNEM
FT                   QAATLQFEGTSTRFDGQSLRLEVKAQGSTTVLKSSSATVQAGGTWTSDAMDMSHQTNGT
FT                   YTVMVTGTNSAGIEVSESQSFTLAQSLPTLTNVTFTPEHQAIGQSVTVTLEFDKDLQSA
FT                   AAELGGTTITSLVATADPSVWTGDVVVPSTSELNVALLVRDYQDLSGNTGSQNTAYSMP
FT                   ITPTIHLDAINDVAGVESVTVSGSSERFEDGEYIDIKAVDVDGTEATGMATVFSDSWTT
FT                   DLDLSGLKDGAVTIYVNGTNKLSASAEEVQATLNYDRFASTASLGAVYNRYFSENKTLK
FT                   NAA"
FT   gene            538172..539149
FT                   /locus_tag="VEA_000457"
FT   CDS             538172..539149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000457"
FT                   /product="peptidase M23"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53145"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYI8"
FT                   /protein_id="ACY53145.1"
FT                   /translation="MTILIIKRSVRTPTATLLTIALLIFISVSLSHHILTPMDRLPTVK
FT                   PLEFKNEGVQAPFEGGTLRQKITIGVVEYSFVASLLKSGISQKEINLLLALIKSNFNII
FT                   DSVKRDDHFILRTKLNSRNETYISSFYYLGSKTDLFIINDGQGNIFDEHGVSIKNKLRF
FT                   SDPFDKSYRVSSGYDLKRTHPVTNITTPHLGTDYATPVGTTIRSIADGIVLKSRYNRFA
FT                   GNYINIRHTNGSVSRYLHLSQRHVHVGEKISRGQVIGKTGNTGRTTGPHLHLELHINGI
FT                   PVDYERYIQKHPNTDVNIEMLIAARKEKAELTAEWQRYRQSNRQ"
FT   gene            complement(539407..540399)
FT                   /locus_tag="VEA_000458"
FT   CDS             complement(539407..540399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000458"
FT                   /product="transcriptional regulator"
FT                   /note="COG0583"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000458"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53146"
FT                   /db_xref="GOA:D0M979"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D0M979"
FT                   /protein_id="ACY53146.1"
FT                   /translation="MTQKYFFCHIRCDYFSLIVSVMDKLSLIKLFVSVVDLGNFTAVAN
FT                   QLGQSPSTVSKAIARLEQDLGVRLVHRTTRQLQLTEAGFNYLETAREVINLLKSSEEQL
FT                   HQSIASPFGTLRVSLPLSFGQNYITPLIPEFCERYPEVKLDLSFSDEYTSILESGMDVA
FT                   IRSGRLNDSNLIARRLCPIDMGMFASPEYIKKFGRPQSVEALNQHKWIMYRYKQSGRLL
FT                   TLTMPLDGQLVEFSPTHQVTVDNGYAMASLASLGAGIALMPQYLARDLVQQGKLMLVSE
FT                   PQRTDGQGVYIYYPSRKFVPAKVKVFIDYIIHKLDEQGEAINSSWMLNH"
FT   gene            540603..542444
FT                   /locus_tag="VEA_000459"
FT   CDS             540603..542444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000459"
FT                   /product="2-oxoglutarate oxidoreductase alpha subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000459"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53147"
FT                   /db_xref="GOA:A7JYJ0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ0"
FT                   /protein_id="ACY53147.1"
FT                   /translation="MTIIQLKREVICFAGDSGDGIQLLGERFSDNSSKQGNDVMTLPDY
FT                   PAEIRAPAGTTSGVSAFQMQFASTEIYTPGDDFSVLIALNAAALKTKISQLVEGGLVLI
FT                   DLDGFNKKNLELAGYESNPLSDGSLANYRVISDSFTRLTVQSLSELNIAPKVVKRSKNF
FT                   FMLGIVLWIYSRPLEPTIEWLNNKFADNPQAREANTLAIKSGFNYAETTEVFSDCFQVA
FT                   PVADKAGLYRTVSGNEALSLGLICAAEKLQRQLFLGSYPITPASDILHTLSTYQHFGVT
FT                   TFQAEDEIAAACSALGASYAGGLGVTSTSGPGLCLKAETINLAVMAELPMVVINVQRGG
FT                   PSTGLPTKTEQSDLLLSLYGRNGDSPLSVLAPASPADCFDMAIEACRIATTFMTPVILL
FT                   SDGYLANGSESWLVPNPDEIKLTAEATKANISPFYPYARDDVYYSREWVTPGTKEKMHR
FT                   IGGLEKQAITGNPSHDPENHQRMTDERAKKINNICHFIPKQTLTGSTQDSLLVLSWGGT
FT                   QGSVSTAIEHLRKQGASVAHAHIKYLNPFPINLEEIISQFKHVLVFELNNQQLVKVIRS
FT                   QYAISARSVTQVKGLPFKVHEVIESINHHLKEIKNDD"
FT   gene            542434..543432
FT                   /locus_tag="VEA_000460"
FT   CDS             542434..543432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000460"
FT                   /product="2-oxoglutarate oxidoreductase beta subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000460"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53148"
FT                   /db_xref="GOA:A7JYJ1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ1"
FT                   /protein_id="ACY53148.1"
FT                   /translation="MTTKVLNRKDFASDVEVKWCRGCGDFNVLKTMQSVLARLGRTKEN
FT                   TVFISGIGCSSRFPYYLDTYGFHTIHGRAPAIATGVKASNPELDVWVVTGDGDALSIGG
FT                   NHFIHAIRRNQDIKILLFNNAVYGLTKGQFSPTSEQGFISKSSPEGSPDQALKPLALAA
FT                   SAGATFIARTSDNDPTHMTMVLEAAAAHSGTAVVEILQNCVIFNDKVHEPYNGPANRSE
FT                   HLLYLSDNEPLLFGKTHSKALINKGFGFEIVESEAPNLLLHSSQCEESYYAYALANLSY
FT                   PDFPVPVGVFRSVTRPTFDQVIQHQKHQATLKYGQGDLTELLKQNSYERLC"
FT   gene            complement(543616..544260)
FT                   /locus_tag="VEA_000461"
FT   CDS             complement(543616..544260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000461"
FT                   /product="antibiotic acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000461"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53149"
FT                   /db_xref="GOA:A7JYJ2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ2"
FT                   /protein_id="ACY53149.1"
FT                   /translation="MKTKHWSKVTLLHEVVTNPNITIKGKHSYYSDCWDAGFEESVVRY
FT                   LQGDEFSRDWEPKWKIDKLHIGDFVCIAAEVVIVMGGNSTHRADWFSLYPFMDFIEEAY
FT                   VGKGDTHIGDGAWLGMRSMIMPGVTIGEGAIVAANSVVTKDVEPYSMVAGSPAKHVKYR
FT                   FSRETIDELLALRIYDWPDKKIDSLKRLLCSDDLEGLKKASAEYDRNHSVE"
FT   gene            complement(544355..545506)
FT                   /locus_tag="VEA_000462"
FT   CDS             complement(544355..545506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000462"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53150"
FT                   /db_xref="GOA:A7JYJ3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ3"
FT                   /protein_id="ACY53150.1"
FT                   /translation="MKLNNALVAILSLTSFVTFAKTELTVSSQLKSVVDECAKGLMNEY
FT                   DIPGLAVAVTIDGKRYFYNYGLADESKGSLVTNDTIFELGSISKTFAATLTGYAQEKGK
FT                   LDMGDKVKDYIPELENSALGNTKLVHVATYTAGGLPLQFPSEVTNDAEMMQYYKTWQPE
FT                   YEAGTKRKYSNPSIGLFGYIGALSMKSDYTEMMETVILPELGMTNTFVDVPKDKLNNYA
FT                   FGYSSEGKPVRVNPGILDAQAYGIKSTSLDMLQYIEANMGQAQLNTDIENALERTHTKY
FT                   FDTDTFTQAVGWEGYDYPVSLSQLLKGNSSDVILNAKPVQASVSGTLGRDVWYNKTGST
FT                   GGFGAYIAYVPSEKIGIVILANKNYPNAERVEAAYNIISSVVK"
FT   gene            545866..547269
FT                   /locus_tag="VEA_000463"
FT   CDS             545866..547269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000463"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000463"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53151"
FT                   /db_xref="GOA:A7JYJ4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ4"
FT                   /protein_id="ACY53151.1"
FT                   /translation="MPFSLHFETGKVTSQQLYSEIYQGILEGRLRSNERLPSTRMLSKK
FT                   LGIARNTVISVYERLQFEGWIVKKAGSGTYVSNALEQTVNQDKRPIKHYQLGVFGTNAA
FT                   KKPEIIAPKNLDYDFTLGVPDHQRIAKHIWRHSRLSRLNALTPEFAHGGDLQGLACLRE
FT                   SICEYVRHSRGVICDPEDIIITQGGQQAIMTTLLTLLSPGDLVSTEDPGYPVFRNQARL
FT                   LGAQIGTVPMDDQGVVVESIPSNTKIIYTTPSHQFPLGFSYSVERKLELLRWAEVNNAI
FT                   IIEDDYDAEYHYLNTSKQALKSQDKNDCVIMVGSFSKILFPGIRIGYMIPPKSLIEPIS
FT                   NMLWHLGRSTSVVSQILLDEFMRDGHLSHHLLNMNKIYSERYHKLTQLIDNIDCLQRIP
FT                   SQGGLHIAAEVSGCATQMMNKLASSNVAVYPSSHFSINNHSNALLFGFGIIPTQKIEKA
FT                   FNTIQSVLD"
FT   gene            complement(547490..547633)
FT                   /locus_tag="VEA_000464"
FT   CDS             complement(547490..547633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000464"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53152"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ5"
FT                   /protein_id="ACY53152.1"
FT                   /translation="MNLKEDDLRNRVAGGAENVSVIRRFTLNLVRLQSKKYSLGAEAKQ
FT                   AG"
FT   gene            complement(547879..556398)
FT                   /locus_tag="VEA_000465"
FT   CDS             complement(547879..556398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000465"
FT                   /product="fibronectin type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000465"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53153"
FT                   /db_xref="GOA:A7JYJ6"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR028059"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ6"
FT                   /protein_id="ACY53153.1"
FT                   /translation="MVLDAGNSTDSTPFTGLNDLGFVAGVFFSNTMINEFNNRGFRFFE
FT                   RSSTNFSFDEITFMQGSARDSDKTYQLVLTGFSNDTQTVTETVTLPKGGEANSGLQDLF
FT                   TLTRGTDFTDSAWQDVDTVTMAFTRSPGADSRYLIKSIKIDDAAVSDSTAPTFVSASST
FT                   PTDDATNVSVSNNIEIAFDENIELKSGNITIRNVTDSRDFEVFNVATESDGTTTSPGAG
FT                   RISVTNDKVYLNPTSDLIGNRTYAIHIESSAVADTANNSFAGISDDATFNFTTVDTTPN
FT                   APSTPDLDASSDTGSLNTDNITSDTTPTFSGISESGSIVTLYSDQVGGGATVIGTGTAT
FT                   GGNWQITTNELASGITHAISAKASDSDDNVSSASNALSVTIDTVAPSVVSITTPIEADS
FT                   IVNAAEDNDVLIAGSGAEAGNSVTVTITDNNSSVSRTVTADNSGNWTLSGSELDISGLN
FT                   NGTLTVSATQADIAGNISTAATQSITLDNAGPSAVTITTPIETDGIVNAAEDNDVLIAG
FT                   SGAEAGNSVTVTITDNNSFVSRTVTADNSGNWTLSGSELDVSAFNNGTLTVSATQADIA
FT                   GNTSTAATQSITLDNAAPSAVTITTPIETDGIVNAAEDNDVLIAGSGAEAGNSVTVTIT
FT                   DYSNYASRTVTADNSGNWTLSGSELDVSAFNNGTLTVAASQSDAAGNTSSAASKTFTLD
FT                   NVQPTVSLSSSDLDLISGETASITFTLSESSSDFAESDVTVTGGSLSNFAGSGSSYTAT
FT                   FTPTEESVASGTIDVATDTFTDASGNSNSAATPLSISVDTVLPTVSITSSSAALKAGET
FT                   ATLMFTLSEAATDFAEADVTVAGGTLSNFAGSGASYTATFTPAEESTEDATIDVAAEQF
FT                   SDAAGNLNTAATQLLISVDTGIPTGHSISIDQESINKTNEQAMSFTFAAAEVNAMFTYR
FT                   VTDGTTTIDGASQTISSETMQVTGIDVTGLQEGTLTVSVVVTDAAGNASDAVTDTVTKR
FT                   YDVAPTAVDDSFSTEEDTAKQFDLLANDSDINDDMVASSATVKTQPIKGQVSISNGVVT
FT                   YTPNSNETGTDSFTYTVKDALLQESQDATVTVTIMAINDAPVAKALTINTDEDTASAAV
FT                   TARSQAKDVEDGIPTGDLALVSLPQKGQVAIDQTVGTFVYTPNANENGSDSFTYTIADS
FT                   EGGVSLAATVSVNIGSVNDSPVAEADSFTFDEDVTSTLDVLSNDSDIEDGSFTASSITL
FT                   QDLGQGEGGYSFAKVSVNADGTLKIVPTANVNGQHSFTYTLTDSGQAVSVPATVTLNIM
FT                   PVNDAPVAVDNSAQLLEGGSFEVNVLGNDSDADAGDRFELTSVTVVDTPAYGSVNVTAS
FT                   GAIVYNPNENYFGEDSFTYTVADLAGAVSNVATVTMTVTPVNDAPMAQAQSQTLDEDNS
FT                   LVITLVGSDIDNDDDTLQYLITEQVNHGVLEQLTNNGWRYTPEANFNGSDFFLFKVNDG
FT                   DLDSTEVRVDLTVNPVNDTPTATDISATGEEEIPLTITLNGNDAEGSSLSYQIVKSPVN
FT                   GNVTVTGNHAVYTGNSNFFGQDSFTYSVSDGELTSGVALVTITVNNVNDSPVITGTPST
FT                   QVDEDSVYQFVPAALDNDPADTLTYLIANKPPWATFDKTTGALSGTPSNSDVGTYPDIV
FT                   ISVSDGTISSSLSAFSITVNNVNDAPVISGSPATQVNEDSTYLFMPKVSDVDSQAFTFS
FT                   IVNKPSWASFDASTGTLSGTPDNGDVGKYQGIVISVSDGLTTTMLNRFSIVVNNVNDAP
FT                   VISGTPALTVNEGSTYRFALQASDVDSSSLSFSIRNKPSWATFDRATGLLSGTPENEHV
FT                   GSTNNIVISVSDGELSASLAAFSITVINVNDEPMAVNDTYAFTESNDGSYLLDVLSNDS
FT                   DIDLDTLQLEWVKPTSGTATIVGSQIQLVTTSIGTVTVQYSVKDGNGGKATAKAIVTIK
FT                   SAKLDAPTITAPSDIEVKATSLFTKVALGSAVARDSTGKLLPVSLVDSTTFFRPGTNTV
FT                   YWRTQDSDGNVAEASQTVTVYPLISISKDAQTTEGTNHSVTIHLNGLSPSYPVVVPYTV
FT                   SGSTDSDDHTLTSGEVVITSGTEGKLSFELLNDGQSEGVETLVIDLDSTLNLGSKRRYT
FT                   LTIFEENVAPKVSVSVSQAGEQRSQIENGVEPVTITSSVNDANMSDIHSFRWSSDSDVL
FT                   NQAIAGQMYSETLTFSPQLLSSAIYNLQLTVTDNGTPPLSVTRNVYLEVVQTLAELGSE
FT                   DSDGDLIPDDQEGHNDSDGDGIPDYLDAISDCNVIQQVVSEKDRFLIEGQPGVCLRKGI
FT                   TILTNTTGGALLLDEELPKDINMKSIGGIFDFVVTNLPLPGQSYQLVLPQRLPVPANAV
FT                   YRKYNAEQGWIDFIEDAQNTVSSSAGEAGYCPPPGHSSWSQGLTEGDWCVQLTIEDGGP
FT                   NDDDGLANGSVVDPGVVAARVNNNALPQAIDDNAFVSLNGTVTLDVLSNDTDADGDGLK
FT                   VSRASVDIGSVSVVDNKLSYVTQPQYYGEALITYSVTDGNGGTGSAKVTVNVVNSQNPN
FT                   AVDDNITTDDRTPVTVYVLANDTDPDNDTLKLVSVQAQYGQVVMNADQSVTYTPTSGFE
FT                   GNDVLTYIIQDSQGLQDTGKVIVTVKLVRDVKVENTSAGSLGSIVLMLLILLGAMQRYG
FT                   RNSALALIAVFSFSSQAGWYVDVQMGSSHADERDAVKGDNVISTDNTGLYRSIGFGYTF
FT                   SEQWSGTIRYIDMGEGSATLRSATTSPEDYHTSVAFIAPLLVKGIGFDIGYKFWQYNSW
FT                   SAKLSLGGLFWDTDIESTYQGSKITTEVDGFDGYIGAEVGYNLSDNWEIGVQGARYFLH
FT                   ENDVDIIALQLRYFFEPLAAY"
FT   gene            complement(557473..557892)
FT                   /locus_tag="VEA_000466"
FT   CDS             complement(557473..557892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000466"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53154"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ7"
FT                   /protein_id="ACY53154.1"
FT                   /translation="MQKGSPIEFYQQRPQSRETVGVEEVQQQTQQFGFAEPEMDELLKY
FT                   SLRTQLEAMLQNQLSTAERQRQLKESFAAAVELVLKETKVEHLTLVQAFQSMYGNACQS
FT                   LSLAKLTQEELTRQYISTSGLDAGMSLLQHASACE"
FT   gene            558762..561935
FT                   /locus_tag="VEA_000467"
FT   CDS             558762..561935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000467"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000467"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53155"
FT                   /db_xref="GOA:A7JYJ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ8"
FT                   /protein_id="ACY53155.1"
FT                   /translation="MANRDGRIPLNVLRLKELRKKLGLSQERLAEECFQQGFVVSIASI
FT                   KRAESGANVLYRTASNLAEYFSVPVEDLLIDRASEPLLTNVSSSPPYFFIFAIEAKCDL
FT                   TVKTLQTLLFSQNTTPIIQNRTFVLTWSIQESDEYVFERIRQLALQLQVALSASIRSFI
FT                   NVKYKHRVTELSEHPNAITPINEILVKIPWGEIAACPCFISSNCARPIKPFLTGEPDFN
FT                   NWHLVSLHQSHTDCFVGRKLELETLNSGIKRWQKQEAGQTYCITGTAGIGKTSLLNQVI
FT                   ASLNRSSCLTTEIQILNHGSADLLSPQNIFTRAICSFTREDTDDSIRQQTVESSIPSSF
FT                   HLCLYWLMGVALNESEKQLLNLMEFQTLKQTIEQSIPFLIQQRQTSKPHLIIVEDVHWA
FT                   DEVMLAFLETLLPHITNTNILLFLTFRQQKRLSSKQSWFTNVNLIELRELSSEESYELA
FT                   CSITCQQNEHINDCIKLAKGHPLYLRQTLLCSQFDKDVPESLEHLVSIQLAQLPAQDRQ
FT                   ALCTASVLGQCFQLEQLREITRIPGYVPDKLVDAGLVKLNGDQYLFHHDLICNAVFRQI
FT                   DKSQCSKIHMACAKWYENRDRFLYAVHINHAKVEGVFTVLEQTAKHYLSNYQFEKALTL
FT                   IEYAIKESPKEQMAYALNMKGNCLYSMGRIKESIEVLEQAIHHTENDPERVQYYLDLIN
FT                   PYRLTDNFVQAMSILDQAQVLCERLTLNKSLCEIHSMRGNMLFPTGQLDECEKEHLLAL
FT                   DYSQRANCFRAKAKSLGGLGDCAYAQGKMARSYEHLTECLQLCEEHQLLSIETANRYML
FT                   ATVMIYQLQSDEALKQAQHASNLAYLTANRRAEIVSRLTAAWIFLDRNVLVQAENEIST
FT                   ALQLSKQLNAHRFVAFLLESSARLHWYQGKEEKALSDIDTALDLVHINKLHNFIGPWLV
FT                   STKALVCGDESTALSALRTGEAWLESTCVGHNYLRFYQQGIQVAWQYKQPTLLRKYRDK
FT                   LANFTREDPHPWGDFYIEQANLMLALLDQSSSVSELLNFNQAARKHQLNQAQISVDELD
FT                   HWLFTSTQP"
FT   gene            complement(562070..562543)
FT                   /locus_tag="VEA_000468"
FT   CDS             complement(562070..562543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000468"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53156"
FT                   /db_xref="InterPro:IPR014992"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYJ9"
FT                   /protein_id="ACY53156.1"
FT                   /translation="MKMESKESQAIFTAHYQIGNGLPGGVNFDVNLLVASEDKSIVGKG
FT                   HIFQAINPPLNVVSDLNGSFNYQCTMRDCHIMVTLQGYQPYLGIAPLGADLHNVTLNIL
FT                   LNDDWKSGVAFYRYKNSSGKWVEVANQRVTLLLPEHVPSIENFKVEQSEHAPA"
FT   gene            562827..564518
FT                   /locus_tag="VEA_000469"
FT   CDS             562827..564518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000469"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000469"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53157"
FT                   /db_xref="GOA:A7JYK0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK0"
FT                   /protein_id="ACY53157.1"
FT                   /translation="MEQEWMQGTKENQVVEQHPNPQIQRLAVLNAYSISINNAKLFIQK
FT                   MDKCGFPKERLLTPLENTVSPVPGLNQYQVESLIFNTRYQHQPFVIVMCESTQEVQQAY
FT                   LTATRFSLPIRVRSGGHDHAGECSGDNVILIDVSRIKTFQLCENIATIGAGYRFYQLTP
FT                   KLAEHDRMIAHGTCATVGLTGYIQGGGWGPWTRKYGMCCEHLVSATVVLGDGTITEVSA
FT                   ESNPHLFWALRGGGGMSYGIVTELRVKTFPLPKEIHRFELQWNLYPKINGMLQPIPTHP
FT                   TIDVLKNWEQAIKSLDTPKLLGTNLQIDALPESSNHCDLETISHHCTMYGYWEGTVQDL
FT                   DQFIAVQFSACSPDLVQVYEAHGTDFDGKKYDHSLMSTWGRDSLCQSGSPFPPDYDAPA
FT                   PHKITSRLVSERGLKAEGYTALLQSLTSPLIKPENRDQGLFSYVTLGAITGGFYHHSDD
FT                   LEDISFPYRQCQYTVQYQTWWNEEIKQKLELQNNPVLVDVNRAMDWIDKAREADIPGTY
FT                   GAFISFKDPAIPTSVYFDRSYRDLIGIKEKYAKDKFNHLRTNKTII"
FT   gene            565404..566693
FT                   /locus_tag="VEA_000470"
FT   CDS             565404..566693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000470"
FT                   /product="choloylglycine hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000470"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53158"
FT                   /db_xref="GOA:A7JYK1"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK1"
FT                   /protein_id="ACY53158.1"
FT                   /translation="MCTDVNINYGCNNQTLSARTMEFAVNLQTEIWFRAQQTYQITTFT
FT                   SDEKADRVFNGQPPQRHSKECEFKASWKGKLSFIHCNGITRYNNPLLTADGINESGLSV
FT                   GSLYLPILNQNVSTSHIPDDAFALGSGLFGTFILSTFNTVDEMVKYFTTHPVYVFNSTI
FT                   STGEKESENMTLDQHFVIHDANNDSAVIEFLNGNMHIYRAFKESDMFSKEENQQARYQC
FT                   TEYDFDDYKVVVDHSYVGVMTNCPNYHWHVNHLSYFSNLRNYNPEPNNEVAMQRHVQVP
FT                   GPLQSINGAGLMGLPADPTPPSRFVQTYAIKQLSEQPTNFDEAFSLGQKLLNRVDIPLG
FT                   IMANEFETSDNPEVFFSDITQWSVIRHNSHQSPAFYLRTYGDMTWRVANVKDYIGLNRD
FT                   CQISSVLQLMPVTTSLPFEQVESRPTIKIA"
FT   gene            complement(566943..567986)
FT                   /locus_tag="VEA_000471"
FT   CDS             complement(566943..567986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000471"
FT                   /product="GMP reductase"
FT                   /EC_number="1.7.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000471"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53159"
FT                   /db_xref="GOA:A7JYK2"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK2"
FT                   /protein_id="ACY53159.1"
FT                   /translation="MRIEQELKLGFKDVLFRPKRSTLKSRSQVNLTRDFTFKHSGRQWS
FT                   GVPVIAANMDSVGSFAMAKALAEHGVMTAVHKHYTVEDWAEFAKSADKATLNNVMVSTG
FT                   TSDADFQKTKDIMALSDEFIFICIDIANGYSEHLVEYVERVRAEFPDKVISAGNVVTGD
FT                   MCEELILAGADIVKVGIGPGSVCTTRVKTGVGYPQLSAIIECGDAAHGLGGMIIGDGGC
FT                   SCAGDVSKAFGGGADFVMLGGMLAGHEESGGEVIEKDGEKFMKFYGMSSKSAMEKHSGG
FT                   VAGYRAAEGKTVLLPYRGSVHGTIQDILGGVRSTCTYVGAAKLKELTKRTTFIRVQEQE
FT                   NNVFGKE"
FT   gene            complement(568424..569965)
FT                   /locus_tag="VEA_000472"
FT   CDS             complement(568424..569965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000472"
FT                   /product="YjeF protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53160"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR026599"
FT                   /db_xref="InterPro:IPR026600"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK3"
FT                   /protein_id="ACY53160.1"
FT                   /translation="MDFNLALKLYTAEQVKNGETLAAQMAGVSMYSLMQRAGMAVYERF
FT                   LHLYPKSKNILVICGKGNNGGDGYVFASLAKQAQLNVQVFQLGDVTALKGDALRAYQDW
FT                   QSIDGVNNDWDEWNTALLEADVIIDAMLGTGLSGEVRSEYRRYIEQINQIHTPVIAVDI
FT                   PSGLCANTGAILGDAIHAEHTVTFIGVKQGLCTGQARDRVGELHFCGLGVNVEFASIEV
FT                   ESALGIDHQVVSRLMPKPNPTAHKGDNGKLLCVGGNQGMSGAIRLCSSAAVRSGAGLTA
FT                   AITHPSSLVPLQIGCPEVMSQSITADLLRDTENDLTKRIRWAEVLVFGPGFGDDEWAYQ
FT                   AYQYLAQEQKPKVVDADGLNILAMLSQRCDGTLVCDNQRVITPHPGEAARLLNVTTQQI
FT                   ENDRYSAARQLQERYGGVVVLKGAGTLIYDGTRMYVCLAGNAGMATGGMGDVLSGVIGA
FT                   LLAKGLPISVAARLGVVLHSHAADINVSQHGQVGLLASDVIGTLRTAITQQIDRT"
FT   gene            complement(570052..570489)
FT                   /locus_tag="VEA_000473"
FT   CDS             complement(570052..570489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53161"
FT                   /db_xref="GOA:A7JYK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK4"
FT                   /protein_id="ACY53161.1"
FT                   /translation="MLNMPAEFEQFHWMVDMVQNVDMGLVVIDRDYNVQVWNGFMTHHS
FT                   GLQSHDAIGRSIFDIFPEIPQEWFKLKTKPVYDLGCRSFITWRQRPYLFRCRNVRPVTQ
FT                   QAEFMYQNVTLNPMRTPTGKINSLFLSIQDATAEALMSQSQ"
FT   gene            complement(570489..571493)
FT                   /locus_tag="VEA_000474"
FT   CDS             complement(570489..571493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000474"
FT                   /product="chemotaxis protein CheC--inhibitor of MCP
FT                   methylation"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53162"
FT                   /db_xref="GOA:A7JYK5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK5"
FT                   /protein_id="ACY53162.1"
FT                   /translation="MSFPVLICDDSALARKQMARSLPATLNADITFAIHGKNALEELEK
FT                   NEFKLMFLDLTMPEMDGFETLENMQRLGNTTPVVVVSGDIQPKAKERVFALGAKAFIQK
FT                   PIAKDELKNALKELVEPEPRPQIITPVSIELPILRRRDIYMEVANVSIGRAADALARHF
FT                   DVFVQLPLPNVNIFEVSELHMALRDLASHDNVSGVCQGFCGEGIAGEALVILSDSSVSD
FT                   LKKLMKVPADSDELEELELLMDISNILVGSFLNGLGEQSEVRFFQSPPVLLGQHISIDS
FT                   IIESTTGAFSRTMTFEVSYNIEGTSIRCDLLFMFVDESLPLLDNKLSYLMEEF"
FT   gene            complement(571860..572768)
FT                   /locus_tag="VEA_000475"
FT   CDS             complement(571860..572768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000475"
FT                   /product="oxidoreductase aldo/keto reductase 2 family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000475"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53163"
FT                   /db_xref="GOA:A7JYK6"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK6"
FT                   /protein_id="ACY53163.1"
FT                   /translation="MVAKVVTAPKGPEFSELVQGYWRAVDWGMTAQERLSFLKQHIELG
FT                   ITTVDHADIYGNYECEKLFGEALALDKSVREQVQIVTKCDINLCGDKTPERKINHYDTS
FT                   SAHIYQSVNNSLERLNVDEIDVLLIHRPDVLMDADEVAEAFSELHKVGKVKHFGVSNFT
FT                   PRQFELLQSRLGKPLVTNQVEINPLNFEVAHDGTLDQMQMLRTRPMAWSCFGGGSIFSG
FT                   DSEQAVRVRNELEAIREEVGATSIDQVIYAWVRRLPSNPIPIIGSGKIERVQTAVNALS
FT                   IELTREQWYRVWVASKGHGVP"
FT   gene            572864..573277
FT                   /locus_tag="VEA_000476"
FT   CDS             572864..573277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000476"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53164"
FT                   /db_xref="GOA:A7JYK7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK7"
FT                   /protein_id="ACY53164.1"
FT                   /translation="MSFAQRLATLIGEESISGFARRVDVSEALIRKYLKGSEPSLTKAN
FT                   QIAMRANCSLEWLATGCGYLYRRAEVVDMDAYKLAFQHVMNQPLPDEAEELHRNLIAGY
FT                   QYLRAHKKSDGFLDESAMATFLSLHKESKNESL"
FT   gene            complement(573258..573737)
FT                   /locus_tag="VEA_000477"
FT   CDS             complement(573258..573737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000477"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53165"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK8"
FT                   /protein_id="ACY53165.1"
FT                   /translation="MPYSNLKERIETKGSWYRCDVQQQDASTYFSTFCLDDFSYYQQHL
FT                   YGEVVLGKDSALFSFLTEYQWQSLNDLILNLRKDGLVLRSITIGQEHYDVVEALEKKSS
FT                   ELVDKEVILLINRYPQETIRSLLWVKPDEFATPSPSLNVELHSDGEIIDVKVTRF"
FT   gene            574328..575731
FT                   /locus_tag="VEA_000478"
FT   CDS             574328..575731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000478"
FT                   /product="H(+)/Cl(-) exchange transporter ClcA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000478"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53166"
FT                   /db_xref="GOA:A7JYK9"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYK9"
FT                   /protein_id="ACY53166.1"
FT                   /translation="MTKRERIVKSVLAHVPKDAINQFVSRGSTPFSVLIMAAIVGTLAG
FT                   FVGTYFELAVHFVSETRTEWLRSEIGSVLPLWLAAVLISALLAFVGYFLVHRFAPEAAG
FT                   SGIPEIEGAMDNIRPVRWWRVLPVKFFGGMGALGSGMVLGREGPTVQMGGAVGRMVTDI
FT                   FRVKDDDTRHSLLASGAAGGLAAAFNAPLAGIMFVVEEMRPQFRYSLISIRAVIISAIM
FT                   ANIVFRAINGQDAVITMPQYHSPELQSLWLFLLLGALFGVFGVIFNKLITVAQDSFVAI
FT                   HKNDRKRYLIVGSLLGGIFGLLLLYVPQLTGGGIGLIPDITNGNYSVSVLVLLFFGRVI
FT                   TTLLCFGSGAPGGIFAPMLALGTLFGYAFGASADVLLPTLDIEPGVFAIAGMGALFAAT
FT                   VRAPITGILLVIEMTNNYYLILPLIITCLGAVIIAQLFGGQPIYSQLLHRTIKNDKLRQ
FT                   QDLPENQST"
FT   gene            575993..576940
FT                   /locus_tag="VEA_000479"
FT   CDS             575993..576940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000479"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000479"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53167"
FT                   /db_xref="GOA:A7JYL0"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL0"
FT                   /protein_id="ACY53167.1"
FT                   /translation="MQFYSVPPSQAALALGMIGLGQAWALYVPEIGEPIRPFLASLGAL
FT                   LLAPVLIKYATNPRLFMVDIRHPLSGSLMAPMSMALLILADYLASVAPIIAYPLWFMAL
FT                   LLHFTMMVLFFSFQLMNFKMSNIVPSWFLYPVGLISSSLAGSQLGHNLFSETLAMMCIG
FT                   IYFFMLPLVLYRLVFFGSLPRRARPTLAIMAAPVNLSLAAYLVNFPLPDPILTGALAGI
FT                   AITMTLLIYLCYFRLLRLKFQPSIAAVTFPSVISAIAMHRLTSFFAEAHPRWHWLHDFG
FT                   FLELSIATVLVVWVSAGYIKMYWPEIVKSPSKQA"
FT   gene            complement(576987..578225)
FT                   /locus_tag="VEA_000480"
FT   CDS             complement(576987..578225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53168"
FT                   /db_xref="GOA:A7JYL1"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL1"
FT                   /protein_id="ACY53168.1"
FT                   /translation="MTTQSTISTSSISAPVTESSWQKKAMLSVAFLMATTSVGPGFLTQ
FT                   TAVFTNIYKVDMAFPVLASIFITFGIVMNLWRIVGVSGMRIQDIANKVAPGMGYGVGIL
FT                   LALGAVAFNFGNVSGAALGINVLTGVDTTWGALFTGVVGCLLFVVHNASKRMDQMARYL
FT                   GLFMIVLIAYVAMTSLPPMGETLSAAVMPMDVGSLLLPTLTIVGGAVGGYYTGAQRLVD
FT                   IGLKGKENVPSITSTAWAGISIAVVIRILLFLAVFGVIATGATLDTANPAADAFRQGAG
FT                   QLGYFIFGLVLFVASITSVVGNSYMAISLIKTLFPVVARNEKAWCVGFIILTSLGTVTM
FT                   DMPILLLMLAGLVNSIILPIVLGTVLVATKRKDIVGDYQHPMYLTLTGAAIVIVMAASS
FT                   LTNIGNFMAKFAG"
FT   gene            complement(578501..579154)
FT                   /locus_tag="VEA_000481"
FT   CDS             complement(578501..579154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000481"
FT                   /product="GTP cyclohydrolase I type 1"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000481"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53169"
FT                   /db_xref="GOA:A7JYL2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL2"
FT                   /protein_id="ACY53169.1"
FT                   /translation="MSGLSESAKLVKEALEQRGLETPMRPNAVSREEKKEKIEYHMREI
FT                   LGLLQLDLTDDSLEETPHRIAKMYVDEIFSGLDYSNFPKITVIENKMNVSEMVRVKDIT
FT                   VTSTCEHHLVTIDGKAAVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQT
FT                   LLESDDVAVTIDATHYCVKSRGVMDATSETTTTALGGIFKSNPATRAEFLHGLR"
FT   gene            579442..580677
FT                   /locus_tag="VEA_000482"
FT   CDS             579442..580677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000482"
FT                   /product="molybdopterin biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000482"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53170"
FT                   /db_xref="GOA:A7JYL3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL3"
FT                   /protein_id="ACY53170.1"
FT                   /translation="MGCCDAPGLMPIEEAMDKMLSRIKPIQTTLSLPLADALGFVLAED
FT                   ILSPIHVPPFDNSAMDGYAIRIQDLEVSTVLPLAGKSFAGQPFEGEWPAGTCVRIMTGA
FT                   KIPEGCDAVIMQENTEVTDAGIQFNQTDVKPQNNIRPTGDDIKQGDIVLAKGARLTPRD
FT                   IPMIASLGVSHVTVVRKPKVAFFSTGDELKPLGEPLKAGQIYDSNRYGIKPLIENFGCE
FT                   AIDLGIIPDCPETLKATFEKAQTLADVVVTSGGVSVGEADYTKDILEELGEIGFWKLAI
FT                   KPGKPFAFGKLSTAWFCGLPGNPVSAVLTMYVLVQPMLAKLAGHTEWKAPESIPATTKT
FT                   AFKKAPGRTDYQRGIYTLENGKFVVETTGNQSSGAFRSMSLANCFVVLERERGRVEVGE
FT                   TVQIQLFNSTLY"
FT   gene            580687..581436
FT                   /locus_tag="VEA_000483"
FT   CDS             580687..581436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000483"
FT                   /product="molybdopterin biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000483"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53171"
FT                   /db_xref="GOA:A7JYL4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL4"
FT                   /protein_id="ACY53171.1"
FT                   /translation="MDILSDQEMLRYNRQIILRQFDFEGQEALKQSSVLILGAGGLGCA
FT                   SSQYLATAGVGNITFIDDDIVELSNLQRQVLHHDADIGRKKVDSAADALRELNPHIEVN
FT                   TVAKRLDDIQLQALIEQHTVVVDASDNVDTRNQLNRLCFATKTPLISGAAIRMEGQVSV
FT                   FTYDDPTQPCYQCLSALFGSSALSCVEAGVMAPVVGIVGAVQAMETIKVIANYGQPKKG
FT                   KILILDAFSMSWREMNLMKMPTCPVCG"
FT   gene            complement(581585..581704)
FT                   /locus_tag="VEA_000484"
FT   CDS             complement(581585..581704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53172"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9A5"
FT                   /protein_id="ACY53172.1"
FT                   /translation="MLGQVSNGAALTYALANRDPSNSDVLFMIRPLIGLYDMQ"
FT   gene            581730..583733
FT                   /locus_tag="VEA_000485"
FT   CDS             581730..583733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53173"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9A6"
FT                   /protein_id="ACY53173.1"
FT                   /translation="MQVYGVNLVTGSTKLLTDDVGLASGINGVGFNFTDRYIYGYDTTN
FT                   LKIVRLGQDFQAETLNVQGLPSHTFFVGDVYNHVYYLYRKGKGLFSIDLSPLDTDPNAT
FT                   LTLNKITSNASVSLTDFAFHPGDGALYGIDNGSGVLYKFDTKTGQATAIGNTGETGTFG
FT                   AGYFDVNGNYYVSRNQDGKIYRVDLSENNAANIAAGIVPAVEFVSNGPSSSQNDGARCA
FT                   NAPVIDEDEPIDFGDAPDTYATLLSSNGPRHAVDGVTWLGTIAPDGDADGQVAPSGDNK
FT                   VGTADEDGVGFVAALDPGLSSLVSVTASTSGYLSAWFDWNRDGDFADEGEQVFTDELLS
FT                   AGSNTLPFVVSELATAGPSWSRFRFSQQTGLNFDGGSTSGEVEDYPITITENGVSVQHF
FT                   PSADSYATVAYEDNWPYTADYDMNDVVIKFRMTETRMDGTVENIQISGDLAAYGAGYKN
FT                   GFAIRLPGVSKASIENGLTKLTFNGKEQPTNGLEAISEEAIFIISDDLSQYAQSQCAYF
FT                   RTQTGCNDNVALSFTLTIYFKEGADRSALQAMPYDPFIFATPNTYHGDGITFQPGRKWE
FT                   VHLPDQAPTEQFDDANLYGVGVDASDPARGVYFKTANNLPWALLIVEEWNWPLEKVDLV
FT                   DAYPEFATYAESGGREGANWHTQPKANKRYIP"
FT   gene            583744..584199
FT                   /locus_tag="VEA_000486"
FT   CDS             583744..584199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000486"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53174"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL6"
FT                   /protein_id="ACY53174.1"
FT                   /translation="MKNLITIIMGLALTACGGGGGGGGDKSNDSATPPPAQTTVIVEEP
FT                   SMQNLDVPDGFDYDPRLESSLAVDISGYSLQRAHLSIYKEYREDASGTYQAKYSSNVAS
FT                   AALTSGKANLDFSTSDSQGNLLIEIWFYDGSEPLQKVVSTGNTTWRM"
FT   gene            584340..584636
FT                   /locus_tag="VEA_000487"
FT   CDS             584340..584636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000487"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53175"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL7"
FT                   /protein_id="ACY53175.1"
FT                   /translation="MDNPKTYMLVFSGFIALLVLLLLIKQTDENTVSATVISNTLTQSL
FT                   DGQRRYLTINSPEIEQQRVTVPVSASCPVGSIALFHQASRSSLDSSLSFIRCE"
FT   gene            584676..585506
FT                   /locus_tag="VEA_000488"
FT   CDS             584676..585506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000488"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000488"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53176"
FT                   /db_xref="GOA:A7JYL8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYL8"
FT                   /protein_id="ACY53176.1"
FT                   /translation="MQALIDAKELHALLDQPNVKLLDASIRFQIPSEGKKITNKWIPGS
FT                   LRFDYDNDFCLPGTNLPHMMPTEEGFNHSAQKLGLNNEDLIVVYDNSGTLASPRAWWMF
FT                   KAIGHDNVKVLNGGLPAWIEAGLPVTDVLSEAKQLGNFTGKLNKHAFLDANAILEYSNN
FT                   CSANIVDARSRARFLGEVPEPREGLRSGHIPNSVCLPFQTLLSNGFIKADSELKQAFSA
FT                   LTLYNDKSIIFSCGSGVTACILLLAAYQLGWRDLSVYDGSWTEWGADHSLPITR"
FT   gene            585528..587819
FT                   /locus_tag="VEA_000489"
FT   CDS             585528..587819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000489"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000489"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53177"
FT                   /db_xref="GOA:D0M9B0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9B0"
FT                   /protein_id="ACY53177.1"
FT                   /translation="MVRLKKNIWTLYMALLTISAVLFVLFGRYHYESTLNKYKDKQLLQ
FT                   LELFASSVESLLKGQESLLEVIGHQLVERNDFTRTAAVQTRPMLDKLLSIHPAIIGFGL
FT                   TNPDGDYIAVSSNLILAKLHNLKQDPLTRDTFLAALNSDRMIIGRTYFMPAQDSLVIPI
FT                   RKAIPNKDGVVQAVMTAGFNMNSSSVFRNDIHANEHNRVTLIRSDGYLTFSSSEDTTLE
FT                   DYLKPANDLDIKAVMAQITKDSGWDMAQLKELTRALNIVVDNSRLSELITLRYLPDYHL
FT                   WASSSTDLNFIKRGFYEQFALYSIVFLIVQGAFYALFRSIANNEHKTKLRLLYQANHDH
FT                   LTGLPNREYLRANIRHWLSGKGNPFSLMFIDIDNFKSVNDTHGHDFGDEVLKQISIRLN
FT                   TFVNDGRLIIREASDEFIFLTNRIDEVSVKRLASDLIKALSEPYEVNDSQFLLSCSIGI
FT                   ACYPHHGETLDELLLSADIAMYQAKKQRNVYSLFNQQMQATHLRKMKIEQRLRLAIDKQ
FT                   ALHMVYQPQLNLEGDIYGVEALIRWSDDELGLVPPSEFIPVAESTGLMVRIGEQIIENS
FT                   LTDMAKLTGNIDTSIQISINISVKQFVHAKFITNLMNAIEKRGIECSKITLEITENLFI
FT                   EDLEKFAPICERLHALGFKISLDDFGTGYSSLSMLRTLPIDEVKIDKSFVDHIEHDKKA
FT                   LNMVKNIISIGKNFEMKVLAEGVETLQQLNELKACGCDLIQGYFYSKPLSLEDLIAFTK
FT                   QNQSKETVVE"
FT   gene            complement(587845..589136)
FT                   /pseudo
FT                   /locus_tag="VEA_000490"
FT                   /note="chitinase; frameshift"
FT   gene            complement(589268..590269)
FT                   /locus_tag="VEA_000492"
FT   CDS             complement(589268..590269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000492"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53178"
FT                   /db_xref="GOA:A7JYM2"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYM2"
FT                   /protein_id="ACY53178.1"
FT                   /translation="MSSSNQDISIENTDLLTEISVAYYQDGATQEEISRKFAISRAKVG
FT                   RMLKQARDEGIVEITVKYHPVFSAKIEQRLIERFGVKRALVALDQPNEEAQRLQVSGLV
FT                   SNYLTSTLKNGMVVTVGQGRNVSSVAHHIGVITPRDCKFVCGIGGIHPRGGMYNADHIC
FT                   RQLAKKYGGTSETLYAPAYAENREQKLAFMQNATVKQTLDLARKADVALVGIGDMSENS
FT                   YMVDLGWFTPDEVVQSRLQQGVVGDFAGYDFFDIHGNVANTVMSDRVIGLGIEEFRPIS
FT                   EVIAIAAENSKPLALLGALRTGAIDVIATSVSNALTVLNLDEQMHGNAASES"
FT   gene            complement(590585..590716)
FT                   /locus_tag="VEA_000493"
FT   CDS             complement(590585..590716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000493"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000493"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53179"
FT                   /db_xref="GOA:A7JYM4"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYM4"
FT                   /protein_id="ACY53179.1"
FT                   /translation="MGLSVIFVITACAFASELANRLIAFNETSAQPTTENFVTEQMQ"
FT   gene            590736..591686
FT                   /locus_tag="VEA_000494"
FT   CDS             590736..591686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000494"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000494"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53180"
FT                   /db_xref="GOA:A7JYM5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYM5"
FT                   /protein_id="ACY53180.1"
FT                   /translation="MSNKLEQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQI
FT                   AEYAPLIDASIEYAKAQSNDKAQQVQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYD
FT                   MEGSVAKARQLVKMYNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRIMDWYKAKEGRDFEASEDPGVLSVTKIYNYYKEYGYKTVVM
FT                   GASFRNIGEILELAGCDRLTIAPALLAELEAAEGEVVEKLVDSKGAAERPAPMTHSEFL
FT                   WEHNQDPMAVEKLAEGIRNFAVDQGKLEAMIEAKL"
FT   gene            591810..593801
FT                   /locus_tag="VEA_000495"
FT   CDS             591810..593801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000495"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000495"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53181"
FT                   /db_xref="GOA:A7JYM6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYM6"
FT                   /protein_id="ACY53181.1"
FT                   /translation="MDRKYLANAIRALSMDGVQQANSGHPGAPMGMADIAEVLWRSHLN
FT                   HNPSNPEWADRDRFVLSNGHGSMLIYSLLHLSGYELSIDDLKNFRQLHSKTPGHPEYGY
FT                   APGIETTTGPLGQGITNAVGMALAEKALAAQFNKEGHDIVDHFTYVFMGDGCLMEGISH
FT                   EACSLAGTLGLGKLIAFWDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHDSEA
FT                   INAAIEAAKADPRPTLICTKTIIGFGSPNKSGSHDCHGAPLGAEEIAATRKELGWEHGP
FT                   FEIPQEVYAEWSAKETGAAKEAAWNEKFAAYEAAYPELAAEFKRRVNGELPAQWEEKAS
FT                   QIIADLQANPANIASRKASQNALEAFGTLLPEFMGGSADLAPSNLTMWSGSKSLEASDF
FT                   SGNYIHYGVREFGMTAIMNGIALHGGFVPYGATFLMFMEYARNAMRMAALMKIQNIQVY
FT                   THDSIGLGEDGPTHQPVEQMASLRLTPNMSTWRPCDQVESAVAWKLAIERKDAPTALIF
FT                   SRQNLAQQERDTEQLANIAKGGYILKDCEGKPELILIATGSEVELAVEAAAQLTAEGKK
FT                   VRVVSMPSTDAFDKQDAAYREAVLPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTSFG
FT                   ESAPAGELFKMFGFTTENVVNTAKELLA"
FT   gene            complement(593943..595505)
FT                   /locus_tag="VEA_000496"
FT   CDS             complement(593943..595505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000496"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000496"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53182"
FT                   /db_xref="GOA:A7JYM7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYM7"
FT                   /protein_id="ACY53182.1"
FT                   /translation="MSANISHKAQETLVRESEELVSTTNLQGVITYCNEAFCRVAEYTH
FT                   EELVGQNHNIVRHNDMPKAAFGDMWTRLKQGKAWRGMVKNATKSGGYYWVDAYVTPIYE
FT                   NNHVVGYQSVRVKPKREWVDIATKAYKSMRAAEKSGRTWSLKLNETIRYAILLGALTAP
FT                   AAAYALSIEGPLAWLASALPASVLALLFRQELIDTPQQLKKLQKQYDSVSRLIYSGNTA
FT                   FSIADFHIKMLSARIRTVLGRMTDSALPLQHCAEELSQTTAEVSAALNQQNTDIHRVRD
FT                   ATQEVESSANSVSSSTNDAHMLIDDTLKSCLMAKETIDQTHTNLTQLSLQAEKATETTY
FT                   QLSDQAQKVNHLMEEIGGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALSGRTS
FT                   NATEQIQASISAMLATIQSWQKDILANKEQTDTCSQVAEQSALRLSEVEQMMQSMSGLM
FT                   VDVAEAANNQLKLSSDVNQHIHSIASTAEQNLAATHSVEQNSRQLKEQVQDFYQLALRF
FT                   EDK"
FT   gene            complement(595717..596889)
FT                   /locus_tag="VEA_000497"
FT   CDS             complement(595717..596889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000497"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000497"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53183"
FT                   /db_xref="GOA:A7JYM8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYM8"
FT                   /protein_id="ACY53183.1"
FT                   /translation="MNRNVWLLSLCQALLMTGNILLISVIALIGKTLAPSSSFITLPVA
FT                   LQFLGLMAATIPASLIMGKLGRRLGFSLGNVIGILGASLATYALSQQNFYLFCVSTFLL
FT                   GVGIGFGTLYRFAAIEVCEESARHRAISISMAGGVLAAILGPNLAVYSQQWSNDGLYIS
FT                   AFAVLIGLYITALIVLQTIRFPPAHTQVLHTKADKVGDIIRRPNFMLAVIAAMVAYAVM
FT                   NILMTATPLAMIGCGFDFDKAAGVIEWHVLGMFAPAFVTGRLIERFGAKNMILAGGLLF
FT                   VACIGINIHGVSIWHFSFALVLLGVGWNFMFIAATGLFSQSYEAKNRSKAQAFNEFFVF
FT                   SCVTITALLSGWLESTVGWQNLNLYVLPFVLLVIVMFALKTNKETESQTA"
FT   gene            complement(597032..598084)
FT                   /locus_tag="VEA_000498"
FT   CDS             complement(597032..598084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000498"
FT                   /product="2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   synthase I alpha"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000498"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53184"
FT                   /db_xref="GOA:D0M9B7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9B7"
FT                   /protein_id="ACY53184.1"
FT                   /translation="MFQTDDVRINRVKELLPPVAVLEKFPATETASSTTFDCRNAIHNI
FT                   LEGKDDRLLVIVGPCSIHDPAAAVEYGKKLKVLRDELGEQLEVVMRVYFEKPRTTVGWK
FT                   GLINDPYLNDTYKLNDGLRIGRKLLLDLTDMGLPTASEFLDMITPQYVADLISWGAIGA
FT                   RTTESQVHRELASGLSCPVGFKNGTDGNIKIASDAIRSASASHHFLSVTKYGHSAIVET
FT                   AGNPDCHIILRGGKEPNYSAAHVAQIKNELDGAGLPKKVMIDFSHANSSKQFKRQMLVS
FT                   DDVSEQIAGGEEAIFGVMIESHLVEGRQDLVDGKAATYGQSITDACIGWEDTETVLRQL
FT                   SDAVKARRNK"
FT   gene            598546..599538
FT                   /locus_tag="VEA_000499"
FT   CDS             598546..599538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000499"
FT                   /product="outer membrane protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000499"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53185"
FT                   /db_xref="GOA:A7JYN1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN1"
FT                   /protein_id="ACY53185.1"
FT                   /translation="MNKVAIAVAAVVAGSSALLNSAQAEMYIGGKVGMTTLDDACYLNS
FT                   PCDDEAFGAGLHIGYDFTDIIGLEYGVDFLGDYKANFKSGANTVNTIDGNLTALTLAPK
FT                   FNWHLNESWNLFAKIGGAYMMSDDEKDFVPTGSLGAEYTIDRNWSVRAEYQRYQDLSDD
FT                   VWDDMDANFFGIGFNYKFAAAPVVAAVVTEEVVEPDPEPVMMSKVHKEEYGTGTFEFDS
FT                   AKLTESVSERLDNFVSFLNEYPQAQVEITGYTDSSGPATYNQKLSERRAQSVADYLTAA
FT                   GIDSDRLTVKGMGEENPVADNSTREGREKNRRVEVVVPSFEYQELVQPE"
FT   gene            complement(599626..600183)
FT                   /locus_tag="VEA_000500"
FT   CDS             complement(599626..600183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000500"
FT                   /product="putative phosphatase YqaB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53186"
FT                   /db_xref="GOA:A7JYN2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN2"
FT                   /protein_id="ACY53186.1"
FT                   /translation="MDGTLIDTMPAHLAAWQATADRFDFPFCQEWFHSLGGMPSFKIVE
FT                   ELNRVHELSLDPKTVATFKMETFAAMELHGDVIPCTNIVLEEYLGHKKIAVGTGSQRES
FT                   AMRLLSHSGLLDKLDVVVTASDVENHKPFPDTFLVAAEHLGLEASQCLVFEDTELGKRA
FT                   AHAAGMDCVMVQDNELIFFPKP"
FT   gene            600305..600718
FT                   /locus_tag="VEA_000501"
FT   CDS             600305..600718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000501"
FT                   /product="class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000501"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53187"
FT                   /db_xref="GOA:A7JYN3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN3"
FT                   /protein_id="ACY53187.1"
FT                   /translation="MLKISNSVTIQEWEIQLSPIRAQGNGGQNVNKVASAIHLRFDIRH
FT                   SSLPDFYKERLLALSDSRITKDGVIIIKAQQFRTQEQNKEDALNRLQALIKAAALQEKK
FT                   RIKTKPTRASQRRRLDTKNKHGAKKQQRKKVLY"
FT   gene            600820..602589
FT                   /locus_tag="VEA_000502"
FT   CDS             600820..602589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000502"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53188"
FT                   /db_xref="GOA:A7JYN4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN4"
FT                   /protein_id="ACY53188.1"
FT                   /translation="MTIRQKLYFLGVIAILGIVALLGTSSHFANKSNELNHAIKLVGDL
FT                   EIRLLNLRRNEKDFLLRSNDKYLNKFDANVDKFLNTEKELASILTSNELPSSQRFKQDL
FT                   LAYQKGFQNLVSAYQRYGLDAKSGLLSGYEQALLEAKQRSDHQQLLALVRFDSAIKSGQ
FT                   FNSDLLVGLYAPELIKTGKLVAAQKQVVGVAYDQGLLGETRALSHAVEEQFETFSTALS
FT                   SAAAKRDEQMSTIKQVITALILGVIFALIWQISRSINTRVNSLLGTIRSISETNNMGLR
FT                   SDLKGKDELFDISHHLNDLLDKLEQLISGTQEKSAQLTASTDNMHRELEGVMEQFHTQT
FT                   DHTASMATAVQQMVATIGEISESTSVAVEGVHQAASNAEQGRSVVETTVTNIGQLTSIL
FT                   SNSQQSIGSLNQHVDKIGGAVNIIQEIAEQTNLLALNAAIEAARAGEQGRGFAVVADEV
FT                   RALASRTHQSTEEITRVVVDIQAQMSTVVADIDQCNDQGQQTLNASEKLDSSLQQIITD
FT                   MHAIQGNSERIASAIEEQGIVMNQVSGSITELNAISENNMQSAQECLHEVNSVSAQAHD
FT                   MDEAVAQFKTALK"
FT   gene            complement(602681..605599)
FT                   /locus_tag="VEA_000503"
FT   CDS             complement(602681..605599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000503"
FT                   /product="inner membrane efflux transporter of RND family
FT                   multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000503"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53189"
FT                   /db_xref="GOA:D0M9C2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9C2"
FT                   /protein_id="ACY53189.1"
FT                   /translation="MSSKSANDGSYSLNVTFDVGTDPDMAQVNVQNRVSQIESKLPQEV
FT                   RMVGVTVKKRSPDLLMVLNFYSPDGKYDDQFLINYINLNVKDQLARAKGISEVNVIGGG
FT                   EYAMRVWLDPEKMANLKLTTSDVYAALAEQNVQVAAGRVGAAPYNNPQEVQFNLVTKGR
FT                   LESVSEFENVVLRANPNGSTVYLKDVARVELGKKFYDGNGKFRGQDASIVALSLQSDAN
FT                   ALESGQAVMELLEDLSKNFPEGMAYETSYDTTVFVSESIKGVVKTLIEAILLVIAVTYL
FT                   FLGSARATLIPVVAIPVSLIGTFAIMQATGFTINTVTLFGLILAIGIVVDDAILVIENV
FT                   DTTMAKDPTISPRKATLLAMKEVTGPIITSTLVLLAVFIPVAMLPGITGIMYRQFALTI
FT                   CISVVISSINALTLSPALCSLVLKQGGGNTANWFQAFNRGLERITTRYGQVAGFLVKKS
FT                   LLLVTFFIVAIAAVTFFAKTTSTAFVPQEDKGILLVNVQLPDSASLSRTEEVTNDLMNM
FT                   IGEEPGVDGVTVANGYSFMTGAAASNGASVFIKLHDWDTRNSLQGEHSANAIAARINGR
FT                   AATELPQAVVFAMGPPAVPGMGAASGFEFVLEDTLGRSRTDLSMVMGEMIQAANQAPEI
FT                   AYTFSTFRANVPHYYVDIDREKAQQLGISLSSIFQTLQGNLGSLYVNDFTIFGKNFRVT
FT                   MQADSQHRSSMEDLERFHVRSSNGDMVPLSTLVSYEQVFEPDVAWRYNMYRSAIIQGQP
FT                   APGYSSGDAIAAMERVAAEVLPQGYTYEWTGMAYQEVLAGNQAIYAFALALIFIYLFMV
FT                   AQYESWSIPLAIILVVPVATLGSFLALNLTGTPLNLYAQIGLVLLIALAAKNAILIVEF
FT                   AKQEREEKDADIDSAAVKGGTLRFRAVNMTSWSFILGIFPLIFAAGAGHVSQNSLGVSL
FT                   IGGLLCVLLAGTFLIPGFYALVQRQREKVHGGNTKLVPLDDE"
FT   gene            complement(605843..606970)
FT                   /locus_tag="VEA_000504"
FT   CDS             complement(605843..606970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000504"
FT                   /product="probable Co/Zn/Cd efflux system membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000504"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53190"
FT                   /db_xref="GOA:A7JYN6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN6"
FT                   /protein_id="ACY53190.1"
FT                   /translation="MQKKPLVALMAATAILAGCGDANNAQREGQAPLVVTQDVTVIDYQ
FT                   PSKSYIGRIEAVEDTNITAQISGYLKARHFEEGQMVEKGQLLYSIEPSSFEAQVASAKA
FT                   ALAQAKAALKKAELDHTRGKNLLPRGSISQSEFDALTAALLGAKAELEAANAQLKLAEV
FT                   NLSYTQIRAPFSGRISDTKVSTGDLVSPSSGVLTTLVSLDPVHTSFSVSERERLAMGMD
FT                   QVKGDGSAESNRVEVQLELENGQFFEHLGKLDFLGNRIDTKTGTIAMRALVPNPEQKLL
FT                   PGQHIKVNLRDKNTKDVIVIPRRAVQTDLEGDFVMVMAEGSVAERRNVELGPQVEQGII
FT                   IREGLDQEDTVITQGLQRVRNGVEVRIQTPAEDKQ"
FT   gene            607388..607852
FT                   /locus_tag="VEA_000505"
FT   CDS             607388..607852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000505"
FT                   /product="deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000505"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53191"
FT                   /db_xref="GOA:A7JYN7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN7"
FT                   /protein_id="ACY53191.1"
FT                   /translation="MISKWAKRFYQMAELVASWSKDPSTQVGAVITKQNRIVSVGFNGY
FT                   PHGVSDSVDTDERELKYLKTLHAEENAILFSKRDLDGCDIWVTHFPCPNCAAKIIQTGI
FT                   SHVHCPEQSEDFLSRWGDKIQVSQDMFDQAGVKVDWLPLEDIEIEDKDVR"
FT   gene            complement(607932..609170)
FT                   /locus_tag="VEA_000506"
FT   CDS             complement(607932..609170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000506"
FT                   /product="tripeptide aminopeptidase"
FT                   /EC_number="3.4.11.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53192"
FT                   /db_xref="GOA:A7JYN8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN8"
FT                   /protein_id="ACY53192.1"
FT                   /translation="MKHLVERFLRYVTFDTQSNPHVTLCPSSPGQLVFAELLKKEMIEL
FT                   GLSDVTLDKNGYLMARLPANVDYEVPPIGFIAHMDTAPDASGKNVKPQFIEDYQGGDIA
FT                   LGLGDEVLSPVQYPDLHHLHGHNLITTDGTTLLGADNKAGIAEILSAVALLLENPDIPH
FT                   GDIRIGFTPDEEIGRGADLFDVEKFGAKWAYTIDGGPQGELEYENFNAANADVIFHGVS
FT                   VHPGTAKGKMVNAMNLAAKFQVQMPQDQTPETTEGYEGFFHLKSAGMGVARSELGYIIR
FT                   DFDRQGLEERKAFMQKLVDDMNAGLRHGSVELKITDSYYNMREMVEPYPHIIELAKQAM
FT                   EACDVAPIIKPIRGGTDGARLSFMGLPCPNIFTGGFNFHGIHEFISVEMMEKSVLVIVK
FT                   IAELTAKKTRLTD"
FT   gene            complement(609341..610174)
FT                   /locus_tag="VEA_000507"
FT   CDS             complement(609341..610174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53193"
FT                   /db_xref="InterPro:IPR016875"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYN9"
FT                   /protein_id="ACY53193.1"
FT                   /translation="MLRYGLLFCFVFLLAGCTKKFLYSNIDWFVIDYIEDYVSLQGEQE
FT                   VLVEERLLLLAEWHKKEELPLYIDHLKELEGLKANDITLNYLQENRDRMRAHYDRVVSK
FT                   AAPDLFALSLQLTKDQEREFLSNVQEHYQERNAKYADKTEDEIREIILDNTEEWMEEWL
FT                   GSLSESQRQLAQTFSQQVTLNSPLWRGYRATIYQELEYLFDNKSNAVTYQDIFMRLLFE
FT                   PESYYSEQLSKNIDSNFVLVDQLTLDISQSMTDKQWRHFRGKVKEWRVLAEELLD"
FT   gene            610466..610639
FT                   /locus_tag="VEA_000508"
FT   CDS             610466..610639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000508"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53194"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP0"
FT                   /protein_id="ACY53194.1"
FT                   /translation="MAAAEQLDTSVEYEIRYFEQGKMHCMRVIAESKKVAYQYYLECGK
FT                   HNSDLYSIRPDK"
FT   gene            complement(610729..611361)
FT                   /locus_tag="VEA_000509"
FT   CDS             complement(610729..611361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000509"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000509"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53195"
FT                   /db_xref="GOA:A7JYP1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP1"
FT                   /protein_id="ACY53195.1"
FT                   /translation="MTVCKVMLVDDHPLMRRGIHQLLSFEPEFEVVAEASNGADAVAKA
FT                   HELELDLVLLDLNMKGMSGLDTLQALRADGCEARIVILTVSDSPADIEAIVRSGADGYL
FT                   LKDTEPDELVELLKQAHQGDKAYSQEVSKYLSERSGQEDVFDTLTDRETQILREVARGF
FT                   RNKQIADRLFISESTVKVHMKSLLKKLQVPSRTAATVLYLERFGDIK"
FT   gene            complement(611348..613084)
FT                   /locus_tag="VEA_000510"
FT   CDS             complement(611348..613084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000510"
FT                   /product="nitrate/nitrite sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000510"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53196"
FT                   /db_xref="GOA:D0M9C9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9C9"
FT                   /protein_id="ACY53196.1"
FT                   /translation="MFKNVKKSVTRTIASAMLLILLLSVATTGFAIFTLASSLNDAEAV
FT                   NVAGSMRMQSYRLANDIQVKSVDYSSHIDAFEHSIYSPSMKALQHWSVPEDITHDYYRL
FT                   IMRWHELKSVLRGDNPAEYQLLVAGFVKQIDEFVFKLQSFSEQKLINLAWIGGLGLGGI
FT                   LCVSMFVVHFVRLEVVRPLRALVFASEQIKNRSFNISLDVSSDNEMGILTRTFNRMATD
FT                   LGKLYRGLEQAVDEKTRKLQHANQSLEVLYDSSKELTASRINQDNFQAILQHIASLEGI
FT                   KAVKLEIEQLGEPSWILMEGEECCHDCDEDCHSKALTLDGEHLGYLYWKAGLPCPNEAL
FT                   IDNFVQILSRAVYYNRAQRQAEQILLMEERATIARELHDSLAQALSYLKIQVALLKRSV
FT                   KNLPDEKAIAQANQVIAELDTGLSAAYTQLRELLTTFRLTIKEGSFGQALQDMVETLNE
FT                   QTVADITLKNRLSSTELDAHQQVHLLQLIREAAINAIKHAQADNIHIQCLDNDGKVTVT
FT                   VTDDGIGFEHQDEKLNHYGMSIMQERAARLHADLHIEASINKGCTVKLEFQHSKEVNSD
FT                   SV"
FT   gene            613332..613817
FT                   /locus_tag="VEA_000511"
FT   CDS             613332..613817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000511"
FT                   /product="nitrate reductase"
FT                   /note="ferredoxin-type protein NapF; periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000511"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53197"
FT                   /db_xref="GOA:A7JYP3"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP3"
FT                   /protein_id="ACY53197.1"
FT                   /translation="MVDLSRRRLFARKAHPDNAVRLPWLTKPEQFTDDCTRCGKCIEAC
FT                   ETKIITKSDGGFPSVDFSIDECTFCYQCADACPEPLFLPKTEQPWQAKASINDSCLAKQ
FT                   NVECRSCGDMCDPMAIQFKLELGKVAQPNLDLDECNGCGACVSVCPTSSINVSNITA"
FT   gene            613859..614167
FT                   /locus_tag="VEA_000512"
FT   CDS             613859..614167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000512"
FT                   /product="periplasmic nitrate reductase component NapD"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000512"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53198"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP4"
FT                   /protein_id="ACY53198.1"
FT                   /translation="MSLNEVHISSLVVHVLPEHLDEIKQQIEAHENAEIYGDSPEGKII
FT                   VVLETENQGFITDTIDAINNLPNVLSTVLVYHQIETGLEETDEEDTGTQHSQIEGEV"
FT   gene            614164..616653
FT                   /locus_tag="VEA_000513"
FT   CDS             614164..616653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000513"
FT                   /product="periplasmic nitrate reductase precursor"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000513"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53199"
FT                   /db_xref="GOA:A7JYP5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP5"
FT                   /protein_id="ACY53199.1"
FT                   /translation="MKMTRRAFVKANAAASAAAVAGVTLPASAANLIASSDQTKITWDK
FT                   APCRFCGTGCSVLVGTQNGKVVATQGDPEAPVNKGLNCIKGYFLSKIMYGQDRLTQPML
FT                   RMKDGKFHKDGEFTPISWDDAFDIMAEKWKASLEKKGPTSVGMFGSGQWTVMEGYAASK
FT                   LMKAGFRSNNIDPNARHCMASAVVGFMRAFGIDEPMGCYDDFENADAFVLWGSNMAEMH
FT                   PVLWTRITDRRLSHPHVKVNVLSTYYHRSFELADHGYIFNPQSDLAIANFIANYIIEND
FT                   AVNWDFVNKHTNFTQADTDIGYGLRDDDPLQKAAKNPNSGKLTSISFEEYKKSVAPYTA
FT                   EKASEISGVEKEKLIELAKQYANPNTKVMSLWTMGMNQHTRGVWMNNLVYNIHLLTGKI
FT                   STPGNSPFSLTGQPSACGTAREVGTFAHRLPADMVVANPKHRKIAEDIWKLPEGTIPPK
FT                   PGFHAVLQDRMLNDGVLNCYWVQCNNNMQAGPNINTERLPGYRNPENFIVVSDPYPTAT
FT                   AQAADLILPTAMWIEKEGAYGNAERRTQAWYQQVGTVGQAKSDLWQLMEFSKRFKMEEV
FT                   WPEELLAKAPQYRGKTMYDVLYRNGNVDKFPIEEARELNDDAHHFGFYVQKGLFEEYAT
FT                   FGRGHGHDLAPYDRYHEVRGLRWPVVDGKETQWRFKEGSDPYAKEGSGWDFYGNADGKA
FT                   KIISAPYEAPPEVPNDEFDMWLCTGRVLEHWHTGTMTRRVPELYKAVPDAVCYMHPEDA
FT                   KARNVRRGEEVLMANKRGEVRVRVETRGRNRPPKGLVFVPFFDARILINKLILDATDPL
FT                   SKQTDFKKCPVKITKIA"
FT   gene            616729..617187
FT                   /locus_tag="VEA_000514"
FT   CDS             616729..617187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000514"
FT                   /product="nitrate reductase cytochrome c550-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53200"
FT                   /db_xref="GOA:A7JYP6"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR027406"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP6"
FT                   /protein_id="ACY53200.1"
FT                   /translation="MMKKLLVALLSVGALVTGIAQAELDNPGGIGGLESLRGMSQLEDT
FT                   RPADEFKDFPKDQIVEDSFVYQPPLIPHSIRHYEVSLNANKCLACHSWKNAKESGATKI
FT                   SVTHYVNREDAVLADMSPRRYFCLQCHVPQTNAKPLVENKFEAVDSLQ"
FT   gene            617282..617794
FT                   /locus_tag="VEA_000515"
FT   CDS             617282..617794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000515"
FT                   /product="cytochrome c-type protein NapC"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000515"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53201"
FT                   /db_xref="GOA:D0M9D4"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9D4"
FT                   /protein_id="ACY53201.1"
FT                   /translation="MFLGFAGGLLFWGAFNTGMEATNTEEFCSGCHAPIVAEIQETIHY
FT                   SNRSGVRAICSDCHVPHEWTDKIVRKVQASKELFAHYVLRTIDTPEKFQERRGHLAERE
FT                   WARMKKNDSLECRNCHEFDYMDYSQQGSRAAEQHSTALASGEKTCVDCHKGIAHKLPDM
FT                   SGVEGWH"
FT   gene            617806..617940
FT                   /locus_tag="VEA_000516"
FT   CDS             617806..617940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000516"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53202"
FT                   /db_xref="InterPro:IPR014175"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP8"
FT                   /protein_id="ACY53202.1"
FT                   /translation="MSTLESVIWHILGYSAMPVIILSGFVAVAAISLWLLSFGKDKEV"
FT   gene            complement(618144..619919)
FT                   /locus_tag="VEA_000517"
FT   CDS             complement(618144..619919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000517"
FT                   /product="polyhydroxyalkanoic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000517"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53203"
FT                   /db_xref="GOA:A7JYP9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYP9"
FT                   /protein_id="ACY53203.1"
FT                   /translation="MFQHFFSDYLVQLQQTNQQWWHDFEVNKAVVNSPLNKAMQEVNLE
FT                   DTAKLFEQAVNQPAAILKLQAEWWEQQLQIWQNVALAGNQKQIIEAEKGDKRFSNEAWQ
FT                   NEVMYSFIKQSYLLFSKTYLDTIESLEGLDEKSKERILFFSRQAINALSPSNFIATNPE
FT                   LLKLTLEQNGQNLLAGLEQLKEDVESSADILKIRMTNNNAFRVGDDVATTPGDVVFQNE
FT                   LFELIQYRPLTEKVNATPLLIVPPFINKYYILDLTAKNSMVRWLLEQGHSVFMMSWRNP
FT                   GKAQAHVEFGDYVTEGVVKAVAAIEDITGQEQINAAGYCIGGTVLASTVAYYAAKRMKK
FT                   RIKSATFFTTLLDFSQPGEVGAYINDTIVSAIEAQNNAKGYMDGRSLSVTFSLLRENSL
FT                   YWNYYVDNYLKGNSPVDFDLLYWNSDSTNVSAASHNFLLRELYLENKLVQDKGVKIGGV
FT                   WIDLNKIKIPSYFVSTKEDHIALWQGTYRGALNTGGNKTFVLGESGHIAGIVNPPAKNK
FT                   YGYWLNDTLDDSADEWLNNAEHKEGSWWTHWNEWLLQFNPKEQVEPFPIGSEDHPAIDE
FT                   APGQYVKQVLPVKES"
FT   gene            complement(620000..620347)
FT                   /locus_tag="VEA_000518"
FT   CDS             complement(620000..620347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000518"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53204"
FT                   /db_xref="InterPro:IPR014176"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ0"
FT                   /protein_id="ACY53204.1"
FT                   /translation="MYTDFFKTFSDQTEKNLEPYLKFNKLVTKNVEVLTELQLNAIRTY
FT                   SEVGLNQMKAASEIKDVTSLTAFNSQQLSVLTKLSQQMMDDSNKLQAIAKEFKEDVEKM
FT                   TSENLKTVTPA"
FT   gene            complement(620392..621603)
FT                   /locus_tag="VEA_000519"
FT   CDS             complement(620392..621603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000519"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /EC_number="2.3.1.9"
FT                   /note="enzyme with broad specificity; acetyl-CoA
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000519"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53205"
FT                   /db_xref="GOA:A7JYQ1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ1"
FT                   /protein_id="ACY53205.1"
FT                   /translation="MMEKVFIVAAKRTPIGAFGGSLKNTSAGNLAAVAIKGALEAAKLT
FT                   GDKIDEVIVGNVVGAGQGMGVGRQAALFAGIPDAVPAYGVNMVCGSGMKTVMDAVSHIR
FT                   SGDTEIVVAAGVEVMSQIPFAAPSSIRDGNKMGNLELKDLLVADGLTDVYNQYHMGVTA
FT                   ENVTKEIGLTRQQQDEYALSSQQKAVAAIEAGKFKDEIVPVEVKQRRETVLFDTDEYPK
FT                   ANATMEALSKLRPAFDREGTVTAGNASGINDGASAIIVASESAVKAHGLTPIAEIVSYA
FT                   QSGLDPKIMGLGPVESVNKALAKAELTVNDIDVYELNEAFAAQALGVIHQLAETNQVPV
FT                   NAIQDKANFNGGAIALGHPLGASGNRILVTLVHELHKQNGQYGVASLCVGGGMGTAVVI
FT                   KAVK"
FT   gene            complement(621613..622353)
FT                   /locus_tag="VEA_000520"
FT   CDS             complement(621613..622353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000520"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53206"
FT                   /db_xref="GOA:A7JYQ2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ2"
FT                   /protein_id="ACY53206.1"
FT                   /translation="MKKVALITGSKGGIGSAISSQLVNDGYRVIATYFTGNYECALEWF
FT                   NSKGFTKDQVRLFELDVTNTAECAAKLAQLLEEEGTIDVVINNAGITRDGVFKKMTAQA
FT                   WNDVINTNLNSLFNVTQPLFAAMCEKGGGRVINISSVNGLKGQFGQANYSAAKAGMIGF
FT                   SKALAYEGARSGVTVNVIAPGYTGTPMVEQMKPEVLESITNQIPMKRLATPEEIAASVS
FT                   FLVSDAGAYITGETLSVNGGLYMH"
FT   gene            623428..623979
FT                   /locus_tag="VEA_000521"
FT   CDS             623428..623979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000521"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53207"
FT                   /db_xref="GOA:A7JYQ4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ4"
FT                   /protein_id="ACY53207.1"
FT                   /translation="MTLALTLGMSIGYRRTLWMMIGELVGVALVSVSAVLGIAAIMLNY
FT                   PWMFIALKFIGGGYLLYLGVEMWRSRGKLAINVDNLETPRSGNVALIMQGFVTAIANPK
FT                   GWAFMISLLPPFIDQNAALAPQLIVLVSIILLFEFICMSLYATGGKGLKRVLGQSKNVR
FT                   LMNRIAGTLMMGVGVWLLLS"
FT   gene            623996..624262
FT                   /locus_tag="VEA_000522"
FT   CDS             623996..624262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000522"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53208"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9E1"
FT                   /protein_id="ACY53208.1"
FT                   /translation="MKNILRKITRNISEVLDFQARVWVVNVYAGEHKGESYVVNEDSFS
FT                   EPLQWMKKKGYHTSMLRLVESMKRSQIIEFDLGHVKHRLMRVK"
FT   gene            complement(624325..625227)
FT                   /locus_tag="VEA_000523"
FT   CDS             complement(624325..625227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000523"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TC 3.A.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000523"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53209"
FT                   /db_xref="GOA:A7JYQ6"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ6"
FT                   /protein_id="ACY53209.1"
FT                   /translation="MVEMLKQNIRKIRHFTTLVSIVLTVIALGALGFKGLNLGLDFTGG
FT                   MVTEVKVDKSLTNHDLLDALQPKLGESTSVTRTGEDGRWLIRYSAPEEGQTLPSVEEVL
FT                   KPVSHQVDVVSNSIVGAQVGQDLFDQGGLALLICVLSILGYLCFRFEWRLASGSVFALA
FT                   HDVIVVLGFFAVTQMEFNLTVFAAVLAILGYSLNDSIIISDRIRELLIAKQSWKMEDIN
FT                   DQAVIATFSRTMVTSGTTLITVGALWIMGGAPLAGFSTAMFIGVLSGTWSSISIGTVLP
FT                   ELFKLEPKHYLPVEIDTAP"
FT   gene            complement(625230..627068)
FT                   /locus_tag="VEA_000524"
FT   CDS             complement(625230..627068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000524"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TC 3.A.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53210"
FT                   /db_xref="GOA:A7JYQ7"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ7"
FT                   /protein_id="ACY53210.1"
FT                   /translation="MKKTAKQQKNRKLMNHYSAWKYVVLITTVIILTLSAIPTWFGEQP
FT                   SIQLTFSNQNSSEMSVVQLNQLLKTNHISADKIIEKDGKTTIVFDDENAQSKARALLNN
FT                   ELNKEDSITFSYVSVAPEWLNEMGFSPIKLGLDLRGGVQFLLNVDVNKAFEEQRNALID
FT                   EIKASLRDQRVRGVQIRAESGNRIAVNSESDTALAEVNKFLRQNYPGWVVKSSSRGFVL
FT                   EPSEQNIQEFQSTTLQQNLKIMRGRIEELGITEALVQRQGKDSIRIELPGVQDPAQAKN
FT                   VIGATASLAFYEVKDAGQARSGQDLVLKDNDGRTVVLEKRPVLTGEHIVNARAGVDNMG
FT                   MSEVNISLDHAGGKKMSDFSATHIGKPMATVYREYKTNDRGVTERSERVISVATIQSQL
FT                   GSQFRITGAGSMDEAQQLALLLRAGSLTAPVTIVEERTIGASLGAENIENGFAALALGM
FT                   GLTLTFMALWYRRLGWVANVALCANMLCLLGLIALLPGAVLTLPGIAGLVLTVGMAVDT
FT                   NVIIFERIKDKMREGRSFAQAIDLGFDSAFSTILDANITTMITAVILYAIGNGPIQGFA
FT                   LTLGLGLLTSMFTGVFASRAMINLIWGRDARRDVRV"
FT   gene            complement(627234..627713)
FT                   /locus_tag="VEA_000525"
FT   CDS             complement(627234..627713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53211"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ8"
FT                   /protein_id="ACY53211.1"
FT                   /translation="MSQICLKKLLFMLLAMVLLPAHVFAAQIDQKAHLPYFSKLQPFVA
FT                   SIAFANTSIDFSEVSEETTQSPISESHARLDTLALFNTQRWVSHLREGLDDEHVDVIGD
FT                   LNTPFYADAGYAYSLMDINWRQNQYTFYHFTSDHRISGWKETNAMYVALNSQFSA"
FT   gene            complement(627839..628507)
FT                   /locus_tag="VEA_000526"
FT   CDS             complement(627839..628507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000526"
FT                   /product="SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000526"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53212"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYQ9"
FT                   /protein_id="ACY53212.1"
FT                   /translation="MKKILIALIVILLLGGAGAGYYFFFMQKDEPEAPKAAQVEQAPVE
FT                   EEISKPILDLETAPPEVTEYYVIERRINVYNKPNVNALVVDTLYKGEKVSVLEKVDGWY
FT                   RISGYLVYEEGGEEKAEWLNSEGLSDAEPVIKEQERLEILDGYLQKSDDLKVHLDIFRK
FT                   KTQQLLDDETCDPSDFEELGGWVRSVTYDKRNVYFIYCGGLEQENKIYLDVDKGDIFYR
FT                   "
FT   gene            628506..629159
FT                   /locus_tag="VEA_000527"
FT   CDS             628506..629159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000527"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53213"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR0"
FT                   /protein_id="ACY53213.1"
FT                   /translation="MYFSFSFFVLISPATRMSRKFGYILKRVGQLTRAIMINKLNWILL
FT                   LLLFPIMGHANIQCNPSSWNDNLTQFNRLESNYNKHVEVFNALLAEHKQRQLLSQTFSL
FT                   HELVLLWRARSNQNAFKTQLKASIQYKEELTTKANELIKLSTQSQWSANGWKKLAQKCR
FT                   ELNETANQITAEWYNTNALQLTEDYKRLSSQYQALAQLYDKEARALQYAQDVSR"
FT   gene            629353..629661
FT                   /locus_tag="VEA_000528"
FT   CDS             629353..629661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000528"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53214"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9E7"
FT                   /protein_id="ACY53214.1"
FT                   /translation="MANFWLIYPLIKFNKKSHLAGDDATTMVINRLSNRDCPNATKAKF
FT                   LSVVRHVKEFGSISDLDLCKIFGETIWSDGREYHSAAFSFKVDRYTGNCEISQYKHQ"
FT   gene            complement(629686..630309)
FT                   /locus_tag="VEA_000529"
FT   CDS             complement(629686..630309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000529"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53215"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR1"
FT                   /protein_id="ACY53215.1"
FT                   /translation="MKFLDRLKIAHYHRKRYRQFGTDRARTLGWRDKYSQISRFEALCR
FT                   GLTLDGSSLLDIGCGYGDLLAFIEFNNLRPQSYIGIDQQKQFISEARKRDFRTQSEFVC
FT                   GDFSTLVLPRSDYVFASGSLNYQSANPNHTIEMIEKMYRAAEKGCVFNLLDEEKLPSMR
FT                   MLASHNKVGVLRYCRWLCPDAQLIEGYSDHDFTIAMIKKAESVS"
FT   gene            complement(630315..630770)
FT                   /locus_tag="VEA_000530"
FT   CDS             complement(630315..630770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000530"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000530"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53216"
FT                   /db_xref="GOA:A7JYR2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR2"
FT                   /protein_id="ACY53216.1"
FT                   /translation="MDKIDRQLINLMQKDATLTTAELADKVGLSASPCARRIKRLEQEG
FT                   VISGYRALVSRDTVGIAMTVFVEVSLNNHQASSIDEFEHAVVEMDEVISCHVVSGAYDY
FT                   LLEVVSKDLAGYETFTRKLQRLENVKDIHTHLAIRQVKGNGSLPIYA"
FT   gene            630919..631845
FT                   /locus_tag="VEA_000531"
FT   CDS             630919..631845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000531"
FT                   /product="permease"
FT                   /note="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000531"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53217"
FT                   /db_xref="GOA:A7JYR3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR3"
FT                   /protein_id="ACY53217.1"
FT                   /translation="MILGYAAILTTLLLWSGFFISLKGGAISNLQPADIALVRFLIPSL
FT                   VLLPFVIKHKQALRVVPKRYLTGVVVGSGLPYLLVVGTAMHFAPVAHGSALVPGTLPLF
FT                   VSAIAVLCYQQSLSAHRLIGLSTVLLGIFVFLLSNSGAEYNWSQLQGHILFLTGSIMWA
FT                   VFTISARVANLNAHVCAGFVAIASLALLIIAVGFGWVDSYLAITPISQWPWEELFGHAM
FT                   LQGVGAGLIASFTFIYAIRIIGAEASAAFGSLTPVVATLLAVPIFGEQPDSLTWLALML
FT                   VTCGSIVASQIFMKDGMSQTYRPPLHR"
FT   gene            632060..632602
FT                   /locus_tag="VEA_000532"
FT   CDS             632060..632602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000532"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53218"
FT                   /db_xref="GOA:A7JYR4"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR4"
FT                   /protein_id="ACY53218.1"
FT                   /translation="MKENAYLILDIPMRLLEEQVMRKLPNADVIVRGVSDTELGHVIAF
FT                   KSSVLTTAVRPSPLLFIRIPGTFATKPVREHERYKLQMDCKIVHAGNVYDGSLIDFSLA
FT                   GIGISTFIEPEFTVGESVTIDSSLSHYIGEENRCVIANIKKLVKGWVIGIKFESPIAMS
FT                   HELKTELLEQSFLTSNV"
FT   gene            complement(632605..633642)
FT                   /locus_tag="VEA_000533"
FT   CDS             complement(632605..633642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000533"
FT                   /product="permease"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53219"
FT                   /db_xref="InterPro:IPR016926"
FT                   /db_xref="InterPro:IPR022604"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR5"
FT                   /protein_id="ACY53219.1"
FT                   /translation="MKLWDHPMSENDFRQCLRIATGATIGFTLCKVFGWNYGVFFTVTP
FT                   MLLLGMVPVMSLHAARQLIFSAVVCGLEVGILGGLFGGHPGMMTIIAFGLFLYKFACMS
FT                   KGSLFLFGANSVLSLSIMLHFASYPTTDLNDLIFSNLQANVISVIVAYVVTFLIPDAEP
FT                   RQPSAKPSQPKQNHRMRHEALMGASIATMSFLVFQLFDLSDSMSAQATTLLLLFPMHWN
FT                   GALGYARKRAMGTLMGVTFGIAGQLVLYDWSDTLLFIVPLLWIGAMMFSYMHVKESSGS
FT                   GAGFGGLTTLGILFGQYLTPDGDLMFSALYRVSSILFAIVVTLLVTYAVHRVLNSFEAT
FT                   RFSQQ"
FT   gene            complement(633655..634713)
FT                   /locus_tag="VEA_000534"
FT   CDS             complement(633655..634713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000534"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000534"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53220"
FT                   /db_xref="GOA:A7JYR6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR6"
FT                   /protein_id="ACY53220.1"
FT                   /translation="MTPDQKFARWIKYSCVAFVLVFAYFLVADLAMPLTPQAMATRVVT
FT                   KVAPRVSGQITHLYVANNQEISQGDLLFQIDPQPYQLAVEKAQLNLERVIQNNEQLDAS
FT                   IAAAKADVEASKIVAEQKVREAKRLDTLFHRNGTSQQQRDDAQSSATAARANLLAARAR
FT                   LKELEVNRGDLGATNVNIRVAQNQLKQAELNLSYTKVIAEHDGVVANLQLETGAYAAAG
FT                   TPLVALVSDDVDIIADFREKSLRHFNQNSRALVAFDSLPGDVFEARITSVDAGVSSGQF
FT                   DADGRLATPTDSNRWVRDAQRLRLHLAIDEPQQRAFPAGARATVQLLPENSLSGWLARC
FT                   QIRFLSLLHYIY"
FT   gene            complement(634749..635204)
FT                   /locus_tag="VEA_000535"
FT   CDS             complement(634749..635204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000535"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000535"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53221"
FT                   /db_xref="GOA:A7JYR7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR7"
FT                   /protein_id="ACY53221.1"
FT                   /translation="MIQDINSLRDLSLAEKLSRVARLWKMVADRELEPLNLTYPRWTAL
FT                   WKLYRMGDNVSQKHLAEALEIELASLMRTLKLLEEQSLITRHCSEHDKRARIVSLTEEG
FT                   KTLLKQMETRILQVRSKLLTEINDQELQKLSLILDQIAHNALDSLSE"
FT   gene            complement(635507..638083)
FT                   /locus_tag="VEA_000536"
FT   CDS             complement(635507..638083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000536"
FT                   /product="autoinducer 2 sensor kinase/phosphatase LuxQ"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53222"
FT                   /db_xref="GOA:A7JYR8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015387"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR8"
FT                   /protein_id="ACY53222.1"
FT                   /translation="MTTTSKTRKRRSLSTLITKIIILVLAPIILGIFVQSYYFSKQIIW
FT                   QEVDRTKQQTSALILNIFDSHFAAIQIHHNSNSKSDVVLDFYTERDEEALNYFFMSIDQ
FT                   SDPSHTPEFRFLTDHQGIIWDDGNAHFYGINNLILNDLASQVTFSNNWYYLPSHTPMGT
FT                   RHLLLRRVPVLQPKTGEVMGYSYNVVVLDNNFGLMERLKNEGNVDNVVLVANDTPLASS
FT                   LVGDEAYKIFDVLKRRESQQKLDQLLIIKTPIEVNAATTDLCLLTVQDNQSVVTLQIQH
FT                   LLAMLASVIGMVMIALMTKEWIENRVVEELGSLMAYTRSAREEKGFERFGGSDIEEFDH
FT                   IGSTLENTFEELEAQKRSFRDLFNFALSPIMVWSESGVLIQINPAARKELVMENDIETM
FT                   HPVFKGFKEKLMPHLRMAAQGATLTGVNVPIGDKVYRWNLSPIRVDGDISGIIVQGQDI
FT                   TTLIEAEKQSNLARKEAEKSAQARADFLAKMSHEIRTPINGILGVAQLLKDSVETEEQN
FT                   NQIDVLRHSGEHLLAVLNDILDFSKIEQGKFNIQKHPFSFTDTIRTLENIYRPICENKG
FT                   VNLVIENKIDPNVEIFTDQVRLNQILFNLVSNSVKFTPSGSVRLHAELEQFYGAENSVL
FT                   VVEITDTGIGIEPDKLDQMFEPFVQEEATTTREYGGSGLGLTIVKSLVDMLEGDVQVRS
FT                   QKGLGTTFVITMPVKDRERVLTPLDSSLRVKPGELFAESLKVLLVEDNHTNAFILKAFC
FT                   NKYKMQVDWAKDGLEAMEFLKDHTYDLILMDNQLPHLGGIETTKEIRQKLKLGTPIYAC
FT                   TADTAKETSDAFMEAGANYVLLKPIKENALHEAFVDFKQRFLIERT"
FT   gene            complement(638083..639180)
FT                   /locus_tag="VEA_000537"
FT   CDS             complement(638083..639180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000537"
FT                   /product="autoinducer 2-binding periplasmic protein LuxP
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000537"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53223"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYR9"
FT                   /protein_id="ACY53223.1"
FT                   /translation="MKKALVFSLMSMATVAPIAQATQVLNGYWAYQEFLDQFPEQKQLT
FT                   NALADAVRETPVPVERDKKRPLKISVVYPGQQISDYWIRNIDAFEQRLDKLDIDYQLNQ
FT                   VFTRPNADIKQQSLSLMEALKSNSDYLIFTLDTTRHRKFVEHVLDSKKTKLILQNITTP
FT                   VRDWEDHQPFLYVGFDHAEGSRELAVEFGKRFPKQSHYSVLYFSEGYISDIRGNTFINQ
FT                   VNRDNNFELQSAYYTKATKQSGYEAAKASLEKYPDVDFIYACSTDVALGAVDALKELGR
FT                   EDVMINGWGGGSAELEALSKGELDVTVMRMNDDTGIAMAEAIKWDLEGKPVPTVYSGDF
FT                   EVVTKSDSPERIEALRKRAFRYSDN"
FT   gene            complement(639501..639821)
FT                   /locus_tag="VEA_000538"
FT   CDS             complement(639501..639821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000538"
FT                   /product="excinuclease ABC C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000538"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53224"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9F7"
FT                   /protein_id="ACY53224.1"
FT                   /translation="MIENTAQRWSVYLIRNNRNALYCGVTNNVERRFNQHQTGKGAKAL
FT                   KGKGPLVLEWSSDFDSKTLAMRAEYYIKQLTKAKKELLVTSKASIVVDENQQMMLEMAL
FT                   SK"
FT   gene            complement(639818..640468)
FT                   /locus_tag="VEA_000539"
FT   CDS             complement(639818..640468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53225"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYS1"
FT                   /protein_id="ACY53225.1"
FT                   /translation="MKVELTAIEARVIGCLIEKEVTTPDLYPLSLNALTNACNQKSNRD
FT                   PVMSLSESDVLDAVDALIERRLVSDESAFNSRVSKFQHRFCNTEFGDLKLTEQEKGIVC
FT                   CMLLRGAQTPGEIRTRTSRLATFHDVKEVETVLEHLASEDKGPLVVKLPREAGKRESRY
FT                   MHLFCGDVDVSELAVPVSAAGSNSDRVSQLELEVAQLKEELDELKAKVESLLS"
FT   gene            640470..640589
FT                   /locus_tag="VEA_000540"
FT   CDS             640470..640589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000540"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53226"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYS2"
FT                   /protein_id="ACY53226.1"
FT                   /translation="MHFLIIFAFDLVPKSLRNHASYIGKEMQEALAIQVSVSG"
FT   gene            complement(640634..640858)
FT                   /locus_tag="VEA_000541"
FT   CDS             complement(640634..640858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000541"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53227"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYS3"
FT                   /protein_id="ACY53227.1"
FT                   /translation="MQNDELDMDSGNTAEQVSSQDNEQATRSVAEKLKTAYINAREQLE
FT                   IIEVELNRSKIMMVDQDGNLTKVPILSEH"
FT   gene            641079..641393
FT                   /locus_tag="VEA_000542"
FT   CDS             641079..641393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000542"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53228"
FT                   /db_xref="InterPro:IPR007458"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYS4"
FT                   /protein_id="ACY53228.1"
FT                   /translation="MSSVFEIVNQARRKNKLKRELLDNEKKVRDNRKRVDLLENLLDYI
FT                   KPEMTHDEIVAIIKNMKADYEDRVDDHIIKSAEISKARRDISRRIRELTEEDKQTSGKK
FT                   "
FT   gene            641569..642852
FT                   /locus_tag="VEA_000543"
FT   CDS             641569..642852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000543"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000543"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53229"
FT                   /db_xref="GOA:D0M9G2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9G2"
FT                   /protein_id="ACY53229.1"
FT                   /translation="MTWPMLFGVLSLMSFQLVDSAFIGQLGVLPLAAQGFTLPLQMVII
FT                   GIQVGLGIATTAVISKALGANESRYAKQLGGLVLMIGSIGVAVFGGLIWLLRYPILSLL
FT                   SAPESVMPIIDSYWPWWLLSSWTGAVLYFYYSICRANGNTMLPGTMMMVTSGVNLVLDP
FT                   LFIFTFDLGINGAAIATIVAFGFGILVVAPRVKKNHWATTQWQDLNVAKSVASIGNIMG
FT                   PAMISQLLPPLSSMLATKLLASFGTAAVAAWALGSRYEFFAIVSVLALTMSMPPMVGRL
FT                   LGAKNYQDIQSLVSIAVKFILGFQLLIAAITFAVANPLALLMTSDVQVEQVLEMHLLIV
FT                   PISLGSLGVCMLMVSLCNALGKSYTALTISALRLFVFFLPCLWVGAQMGGIRGLLLGAC
FT                   MGNILAGISAYLTYRQTIRKLAGAQANA"
FT   gene            complement(642915..645401)
FT                   /locus_tag="VEA_000544"
FT   CDS             complement(642915..645401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000544"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53230"
FT                   /db_xref="GOA:D0M9G3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9G3"
FT                   /protein_id="ACY53230.1"
FT                   /translation="MISQASHFIYSIEKARRQPTLQASAALNIEEQDGVISSMHQKFVS
FT                   NPNTAEYADELKEAMLGVLSGRLDEMDDLGDWAFQLLQNMSRSLLQNHQWYGSEDGIRM
FT                   QNFIAYLAQLSFWTQKEAWLTHRLVQDPKSRLSQSLFFQAIDRQQQNLDAFLNLGGSYD
FT                   QVDKLLGLFTSPRYQRNLASRGRLMSGDMSRSDYEAYLRELDFRVQRLQVLIDGFTKQT
FT                   EQSLLTQVHEQKTNIAMITSGVILVIVMLCWLGFGTWFRVNSKLDAIIHTLTALINDEE
FT                   KQTKVKVDGSDELTIFAQQVNRVVEEKQRQTDEILHAKESAVSANRAKSVFLANMSHEI
FT                   RTPLNGIMGMTEILSQSELSSHQQEVVDDIDSSSQTLLTLLNDILDLSKIESGRLELSL
FT                   VEADIREVVYQSMVLFQSKATSKQLELGINLAENIPTRVMVDDHRIKQVITNLVSNAVK
FT                   FTESGHIRVDVSYDELSEKECGVLMFKVEDTGIGIEQDKLTTIFEPFTQEDEGVSRQFG
FT                   GTGLGLAICRQLVSMMGGQLIATSTKGVGTCFEFSIEVDVIPVFGWRSDVINKGLLICT
FT                   NYDYADQLLKECRLAKINLFGANNVNEVKAINDDFDVIFLCHRDDSNTDEALDELSLKY
FT                   DLRRVIICQHHLSTPYDNAERVHAVLTLPFLGNRFKHVIDDLAKVEKTISSDAVTNGIP
FT                   KSEYRTSRSHRRILIAEDNLMNQKIASFFLDKAGYDYLITSNGQEALEAITKGEEFDAI
FT                   LMDCMMPVMDGLTATKEIRRWEKKAGREKTTIIALTASVLEEDIHNCFAAGMDAYLPKP
FT                   YKSNQLFELFNELKLA"
FT   gene            645381..645506
FT                   /locus_tag="VEA_000545"
FT   CDS             645381..645506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000545"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53231"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYS7"
FT                   /protein_id="ACY53231.1"
FT                   /translation="MRGLGYQLETLDIDYRLIETAYAQRIVRKLLNCKNHYHHRG"
FT   gene            645627..645755
FT                   /locus_tag="VEA_000546"
FT   CDS             645627..645755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53232"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYS8"
FT                   /protein_id="ACY53232.1"
FT                   /translation="MVTLKQHSPTKIMVIPLISSSVNEMVIVTRIILFDLQAEYKQ"
FT   gene            645808..645945
FT                   /locus_tag="VEA_000547"
FT   CDS             645808..645945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000547"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53233"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9G6"
FT                   /protein_id="ACY53233.1"
FT                   /translation="MFTYFVALSRQITQKCKRINSDNKTNLKTHVIIAKKVDDFLNVNT
FT                   "
FT   gene            646167..647600
FT                   /locus_tag="VEA_000548"
FT   CDS             646167..647600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000548"
FT                   /product="NADPH-dependent glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000548"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53234"
FT                   /db_xref="GOA:A7JYT0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT0"
FT                   /protein_id="ACY53234.1"
FT                   /translation="MSPEKYLQDWQTSQTIAESISPLIGKLYRQKGIEVVLFGKTLINA
FT                   TTIDILKTHRVARRYTGSPLSLEHTMPIIQALCEMSISSCRVDVGQLATKYWNEHDDTA
FT                   SLNDFLITALDGARDADSSLKARDVVLYGFGRIGRLLTRLLIEKSGPGYPLRLRAIVVR
FT                   GGKKGDLEKRASLLRRDSVHGQFNGSIVIDEERKALIVNGNYIQIIYANNPSEVDYSAY
FT                   GINNALVVDNTGVWRDSEGLSQHLACQGAEKVLLTAPGKGDIKNVVFGVNESVIQEDDT
FT                   IISAASCTTNAITPVLKALNDKYGVLSGHIETVHSYTNDQNLIDNFHSGDRRGRSASLN
FT                   MVLTSTGAAKAVAKALPELAGKLTGNAIRVPTPNVSMAVANLNLGEDVDRDSLNDYLRE
FT                   MALNSELSAQIDYTDSTEIVSTDLVGSRHAGVVDGQATIAQDKRCVLYIWYDNEFGYSC
FT                   QVVHCMEQMMGVRYQTFPR"
FT   gene            647841..648062
FT                   /locus_tag="VEA_000549"
FT   CDS             647841..648062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000549"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53235"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT1"
FT                   /protein_id="ACY53235.1"
FT                   /translation="MNRIIVTALALITGFFTLVFSLIIAIPLTIAALITGKRIEKRVKK
FT                   MQKEMHEEYEFNTGKADAIEGEFEEVRR"
FT   gene            complement(648207..648821)
FT                   /locus_tag="VEA_000550"
FT   CDS             complement(648207..648821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000550"
FT                   /product="putative threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000550"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53236"
FT                   /db_xref="GOA:A7JYT2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT2"
FT                   /protein_id="ACY53236.1"
FT                   /translation="MTLTVWLSLFTVCLLGAMSPGPSLAIVAKHALAGGRINGLATAWA
FT                   HAFGIGIYAFITLIGLAVVLQQSPMLFKTISLAGAAYLAYLGFNALRSKGGVAAKLESG
FT                   EETTVSQSAREGFFISILSPKIALFFIALFSQFVALGNDLSNQMIIVATPFVVDGFWYT
FT                   FITLVLSSSKVVDRIRSKAVLIDRLSGIVLMLLALRVVVTV"
FT   gene            complement(648917..649831)
FT                   /locus_tag="VEA_000551"
FT   CDS             complement(648917..649831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000551"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000551"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53237"
FT                   /db_xref="GOA:A7JYT3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT3"
FT                   /protein_id="ACY53237.1"
FT                   /translation="MLNNINLNLLRSLHVLLEECHVSRTAERLHITQSAVSRQLAQLRD
FT                   LCGDPLLIRQGNQLIPTPRAIALKSKLDALLAEFDHLLDDKPFEPQLWQGELVIASSDY
FT                   VAQYVLPDIASHLGEQAPQLDLAYRLWQLDFIDKLHELGIHLASSMYPTQPEGVSSINI
FT                   GSDKSVCLMKASHPLAGKASISVEDLISHSHIQVTGGGDKDSSTDMALKDRGLMRHVTF
FT                   KVPFFSAAVNRLVSSEHLMVVPEHIANNLAKHWPLVHKVLPFETPTHEYWLMWHPKYDN
FT                   DPAHQWVREQIHAVMKISEYSIH"
FT   gene            complement(649875..650330)
FT                   /locus_tag="VEA_000552"
FT   CDS             complement(649875..650330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000552"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53238"
FT                   /db_xref="GOA:A7JYT4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT4"
FT                   /protein_id="ACY53238.1"
FT                   /translation="MDKFDHKIVDLLRHNARLSVTEIADKVNLSRSAVTARIRKLEHDK
FT                   VILGYHAEIASSGGDSICAYFALKFDKSTSTYYCESYADELYKIDGVKWCHAISGETDM
FT                   MVFVEVPTMTRLNEIRDQIQRYPELRHLMTHTVLAEFFNTTGNQFVK"
FT   gene            650658..651920
FT                   /locus_tag="VEA_000553"
FT   CDS             650658..651920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000553"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000553"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53239"
FT                   /db_xref="GOA:A7JYT5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT5"
FT                   /protein_id="ACY53239.1"
FT                   /translation="MEQLKKDISLTSGIAQLSTTLMGTGLFMIPAIAAGIAGHFSLWAW
FT                   ILLFIAICPIALTFAQLGKRYPNAGGTAFFVRKAFNAKLESSVAWLFVSVIPVGVPAAI
FT                   ALAAGFLQQILPEPISNNLFAQILTVLLLVFVNLMGTKSSGHLQTLIALSVFALVGTFL
FT                   WKGDVNSADLVMPAITQESIWPITAALGVMFWCFVGIEAFAHMGEEFKNPQRDFPIAII
FT                   VGCFVAGATYWACSVVILKFGAYGNAQFDNASIPWLSAQLLGDGAKWIISLIGFSACFA
FT                   SVNLYTQSLARMVWAQAREHRPYSPLAKISRRGVPFSATLLVGGVLLISCVIGTLSQLD
FT                   LEFFLKLANSVFVLVYMLAMLAAYKLLRGFGKALAGLSLLLCTGVFICLGWSMFYALGI
FT                   FTLLLLPWKQWRHKRQTRAVE"
FT   gene            complement(651921..653366)
FT                   /locus_tag="VEA_000554"
FT   CDS             complement(651921..653366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000554"
FT                   /product="transcriptional regulator GntR
FT                   family/aminotransferase class-i"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000554"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53240"
FT                   /db_xref="GOA:A7JYT6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT6"
FT                   /protein_id="ACY53240.1"
FT                   /translation="MDGSSLSLIDIGDLHLKDSDGTRQQALFFAIRKKIVQGLWVKNGK
FT                   LPSTRKLSQALNLSRNTVISAYEQLVAEGYLNSQKGSGFYVAVELPEQYLPEPNSVQRD
FT                   SSPKTNFDINRAFAPGVPDLDAFPMAQWQKLLARHMSRPCLLGNQDIQGSWALRSALAD
FT                   YLASSRSVNCSPERIIITSGAQQALSIATMVALKQGDKVLMEQPGYAQMRKLIQFQNYQ
FT                   FEPLFVREKLGFDVEAVTSSDADALYITPSNQYPMGTTLNTEQRGKIINWAVEQSSWII
FT                   EDDYDSEFQFAHRPYTSLQGLAAQMGRDEHVLYVGSFSKVMFNGLRLGYLVVPERLVEQ
FT                   CLVVKDALSGDSPTHTQEALADFITEGGLLRHIRKMRRLYKTKHEQMHLSIQQHFGDSV
FT                   CVVSQAAGLHITLKWQNGIDELRFTKLAEHEGIILRPLSYYEHPGFQARHWHGAVLGYG
FT                   NIALENIDAGIQRLAQIFRHGKR"
FT   gene            653467..654123
FT                   /locus_tag="VEA_000555"
FT   CDS             653467..654123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000555"
FT                   /product="predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53241"
FT                   /db_xref="GOA:A7JYT7"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT7"
FT                   /protein_id="ACY53241.1"
FT                   /translation="MLSNTNRTEIKKGAHKAVSDVSKLHAIIDESLIAHIAITNESGPV
FT                   VIPMLAWRVDDYVYIHGANNSRLLRSLKQGVQTCLTFTLLDGWVLARSAFHHSAHYRSA
FT                   VVFGQFEMVEDNQEKDRLLNHFIEQIAPGRTKQVRLSNEKELKATMLLRIPLTEASVKI
FT                   SNFGVNDDAEDMDIPVWAGVLPYRTVVGPLQACEDLYEGIAEPDYRSAYSNRWQE"
FT   gene            complement(654104..655426)
FT                   /locus_tag="VEA_000556"
FT   CDS             complement(654104..655426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000556"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000556"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53242"
FT                   /db_xref="GOA:A7JYT8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT8"
FT                   /protein_id="ACY53242.1"
FT                   /translation="MFSLFTRLYVGLVTGLALTVALFLFMGEEYMRKTEVGVFLSDGAY
FT                   FVDQYIEQRGTPDSLYKKLTENGKQDFFIFDLTLVENWDGSSPCRDCKLLYRIQGIPVY
FT                   LIDGSTYAAVFPLPNTSQSLVFKEKTDFFSPDVDWNEDSEIVFILTLLLVVVCSLGIMV
FT                   YIPVRRLDRQIRQLTAAQQQFGYGELNTRVDLKQFSQPVKELAQGFNCMSEEIERRVRQ
FT                   THIFTQAIPHEVRTPLSRIQLATDLARRTSGEMQAELHDDIERYVDVVTDLTSDIVMLS
FT                   RLSVKNHSWIDSVETMELPLWCKSRMNYLGFESVMLRAENELANQLIHFQPTLGNLVLD
FT                   NLLQNAKRYGESCVEVTIRMVADCWSIDIEDDGPGVPEAMREEVFMPFSRLDKSRNADV
FT                   KGFGLGLAIATSAARQLGWELSVGESHLGGARFTVLIPAND"
FT   gene            complement(655430..656122)
FT                   /locus_tag="VEA_000557"
FT   CDS             complement(655430..656122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000557"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000557"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53243"
FT                   /db_xref="GOA:A7JYT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYT9"
FT                   /protein_id="ACY53243.1"
FT                   /translation="MVGNTILLVEDDSEIARLTKMYLEAEGYTVIVIDNGQNALETIKE
FT                   LKPDLVLLDLMLPGKNGAEICQEARKFYHGIIIVLTATDDEMSEVSLFKFGADDYLTKP
FT                   IKGNILLARIEAALRRYRRQVDTVEEEKLSRYGISLCLRRSQAFYLQKDIGLTSSEFEI
FT                   LELLMLNVDKPVSRESCCRLARGIEYCITDRSIDMRISSLRKKFSKAHIHTATIKTIRH
FT                   HGYMLTGK"
FT   gene            complement(656472..656618)
FT                   /locus_tag="VEA_000558"
FT   CDS             complement(656472..656618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53244"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU0"
FT                   /protein_id="ACY53244.1"
FT                   /translation="MLNVGAGGVGGVVVDGFELDSLPLQAVRLIAQNMAKGVNWEYLIS
FT                   CYS"
FT   gene            656668..658029
FT                   /locus_tag="VEA_000559"
FT   CDS             656668..658029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000559"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53245"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU1"
FT                   /protein_id="ACY53245.1"
FT                   /translation="MAADAGFTHYVKISLSEANNNDTFHIVAVDDGANNEKIFRAAKII
FT                   QHLLTNQPDSKYGADKSRIAKTLAERDATLMLTENDEQNDEMLTKIFINELIRQDKLND
FT                   AVTNSGLAHSFDTSSLEKFVVSMMVLNEDDMDTLVTSIVATLVNSKETPNWLRNSQSLM
FT                   YRELTVEGDCHYMSNFADYCANLGKKAERDAAFEEILHLVQAQGIAPNTGTAALQNDIQ
FT                   AHALKIYNDIQAGKPTVWRPTQYDWDDWKSDDFDPESVKQTGPSYSHEYFAAAFEAYMG
FT                   VAKANGQGLDGYQALTREEMQTQDPQAVDWISGLFHGYLQYTANIDSAGVKLYTEKTNP
FT                   GTVPTFRMAPNKDGLIEAYTYKSQWLTRVKIIGDDAMNVIGNDQDNTFEGNSKDNSIYG
FT                   EGGINTYIVPHKLAECTVIKAKSVSVKCPSTGSDELYDIQKIQFTDQILDVTEL"
FT   gene            658102..658731
FT                   /locus_tag="VEA_000560"
FT   CDS             658102..658731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000560"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53246"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU2"
FT                   /protein_id="ACY53246.1"
FT                   /translation="MDRTDAVKAQPEMLIKTDGDFWGFGADGHFDFAGKYKGNYSRSAS
FT                   NSSWFNHISFKEGTMGAEVTRIDNGETWLLSCSGGGMSVNYMGVDFGGNDPYTCDITQD
FT                   GVKVGEFAMEPKSALIDISFEKKETGVVRIGSTHFNVETVHTSPDAMMAVDIPLGYSFK
FT                   EGTQEIAAVQTNGTIAVQMLPELSEQKKDVIAIGAVASALSWRPKK"
FT   gene            complement(658817..659818)
FT                   /locus_tag="VEA_000561"
FT   CDS             complement(658817..659818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000561"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53247"
FT                   /db_xref="GOA:A7JYU3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU3"
FT                   /protein_id="ACY53247.1"
FT                   /translation="MKTVRFIRAMGILNMHNLALSKYNLGSDELGIPSSVFHNPMTLIP
FT                   LKAVAEWYRCVEQASSDPDVVLSLSRGIELQKLGPVGRWLFSGNDLASAIRRVNYGASN
FT                   LQSGAFFAGEQSGKIIKWTYHNPFIETSVKVHDSIRCAVFMIKVLREFLGKDYQPLRVK
FT                   VSGSRKNTEPYREYFGCEVEWSQPKTEIWIPGDDRLASRQVSHREDSRLAMSFSDLDDL
FT                   LNMPDPEDELKVIYEVVNYSSHYGLPTLERVSSLLDLSEQQFQRRLHKLGLNFSMVSGY
FT                   VLSNVAAGLLSKRVSIDDIAMRLGYTNVASFNRMFKKHRGLTPKQYAGRLEK"
FT   gene            659926..660252
FT                   /locus_tag="VEA_000562"
FT   CDS             659926..660252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000562"
FT                   /product="permease"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000562"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53248"
FT                   /db_xref="InterPro:IPR011223"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU4"
FT                   /protein_id="ACY53248.1"
FT                   /translation="MSLLSVPFVGTGADTALHVVAAVVLIASVAGACYGFWKIHELPIN
FT                   KAHSKDHHQIGLITALTWIGFVWHWVWVLAVIFAFVDMEKAIINLRDTWKSKPQTETQP
FT                   QEEA"
FT   gene            660252..661475
FT                   /locus_tag="VEA_000563"
FT   CDS             660252..661475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000563"
FT                   /product="multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000563"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53249"
FT                   /db_xref="GOA:A7JYU5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU5"
FT                   /protein_id="ACY53249.1"
FT                   /translation="MLEGLAVWALFIYLLRLVGMPWNKATKSFAYLGGLGWLMFVWVGL
FT                   INFTPMDLSGGSVVQSPHIQLRPDSTNVKGKVDHIYIKPNQQVKEGQLIYELDPTQYEI
FT                   ALNQASVSADSARVALATAKGDIEIEEANHQALVQDLETSKSQLEAAKVDYKFQKKMLD
FT                   RYVEQNRVVQNTITESDIDKQSSAVDMARHNVLTLESQIKKKQVDISRAKLAIHKAELA
FT                   VETKQAELRQAEEQIAKAQWDLNSTKVHAPTDGFVTNFILREGQRVSMMPRINMYTNEK
FT                   YVLMRVNHQAIRNIKPGQPAEFSSSVYPGKIFSATVEGIVEATGESQGNLLGFDDSVRV
FT                   TTGKNLQNKHHFVRLKIDEPEGYDIPVGSVGLAWVSGEKPIGFMAFLDVIRGIIIRMKS
FT                   QLYFFYSI"
FT   gene            661577..662899
FT                   /locus_tag="VEA_000564"
FT   CDS             661577..662899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000564"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53250"
FT                   /db_xref="GOA:A7JYU6"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU6"
FT                   /protein_id="ACY53250.1"
FT                   /translation="MSAKERSLPTHRISRFSKFASLATRVAGNVIAEGTKQIAKGNKPK
FT                   AKDLLLTPQNIARLTDQLAHLRGAAMKLGQMLSMDAGDVLEPELADILSRLRSDADPMP
FT                   AKQLNAVMESSLGTNWKAEFLSFNFKPIASASIGQVHQAYSDAGDNLAVKVQYPGIRKS
FT                   IDSDVDNVGTLLKVVGLIPESVDYKGLLEEAKKQLHDEADYAREAQFAIRYHDALKEHP
FT                   HFVVPKIHTESCSDSVLAMEFIDGSPIEKIEHYDQSTRDFVMHSLLELLFRELFEFKMV
FT                   QTDPNFANYLYIENTRQIGLLDFGATREYSERFSTGYRQAFASVVNNDEQGLNDALEQI
FT                   GFFSQTILPDQRQAILDLVKMACEPMLVDEPYDFKASGLAQKLREAGTILSMEQEYWHT
FT                   PPADALFLHRKIGGMYLLAARIGAKVNIRQLVQPYLTINSE"
FT   gene            663012..664358
FT                   /locus_tag="VEA_000565"
FT   CDS             663012..664358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000565"
FT                   /product="putative magnesium transporter MgtE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000565"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53251"
FT                   /db_xref="GOA:A7JYU7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU7"
FT                   /protein_id="ACY53251.1"
FT                   /translation="MSKFQDLSTLIQQIGQAEEADQVATLNESIEAGLEPGAAALILEA
FT                   FPIDDRVRLWRALPLELHIDVLTEMRADVRFSIINALSEVELKLTLAKLDNLSLIEWAD
FT                   SLPESIINEALALIEKDELELYDQANEYEDEELGHWAERKIITLPFNITIGTAKQLMER
FT                   YSYDTPQQVYLINRNKQYRGTVNYYEILRSDPDTRLKTLVIEAVTVLDSKMMLPEAVEA
FT                   LEHSTLPALPVTDADQTLIGEVDWQFALSTQREIYEARLMAGTGMDEGDDLFAPVLKSS
FT                   QKRGVWLGINLLTAILASVTIGLFEDVIAQVVALAVLMPIVASMGGIAGSQTLTLMVRA
FT                   MALNQITPGNRFKFLKNELGIGSLNGIAWALIIGGLAGLWFQSPVLGGTIALAIIVNII
FT                   TAALFGVLIPIILDKFKLDPALAGSVILTTVTDVVGFFAFLGTASLVML"
FT   gene            665164..666402
FT                   /locus_tag="VEA_000566"
FT   CDS             665164..666402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000566"
FT                   /product="cytosine/purine/uracil/thiamine/allantoin
FT                   permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000566"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53252"
FT                   /db_xref="GOA:A7JYU9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYU9"
FT                   /protein_id="ACY53252.1"
FT                   /translation="MAGDNNYSLGPVPNTARKGVASLTMVMLGLTFFSASMWTGGSLGT
FT                   GLSFNDFFLAVLIGNLILGIYTSFLGYIGASTGLSTHLLARFSFGSKGSWLPSALLGGT
FT                   QVGWFGVGVAMFAIPVHKATGIDTNTMILVSGLLMTATVYFGISALMVLSAIAVPAIAL
FT                   LGGYSVIEAVNSVGGISELQQVQPTEPLDFSIALAMVVGSFVSAGTLTADFVRFGKKPR
FT                   SAVMITMVAFFIGNSLMFIFGAAGASVTGQSDISEVMIAQGLLIPAIIVLGLNIWTTND
FT                   NALYASGLGFSNITGLPSKYISMANGLVGTLCALWLYNNFVGWLTFLSLAIPPIGGVII
FT                   ADFFTNRKRYANFEAAQFQSVNWAGIIAVAIGVGAGHFLPGVVPINAVLGGAISFLILN
FT                   PILNKKALATQPA"
FT   gene            666412..667689
FT                   /locus_tag="VEA_000567"
FT   CDS             666412..667689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000567"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000567"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53253"
FT                   /db_xref="GOA:A7JYV0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV0"
FT                   /protein_id="ACY53253.1"
FT                   /translation="MTTLLIKNVTLKGQEGLQQILIEDGQFKRIESNDVELNHNGDTID
FT                   AEGGMAVAPFCEPHIHLDTTQTAGEPSWNISGTLFEGIERWAERKEMLSIEDVKTRAKQ
FT                   TLKWQIANGVQHVRTHVDVSDPTLIALKAMVEVRKEMKEWVDIQIVAFPQEGILSYPNG
FT                   KELLEEAVKLGADVIGAIPHFEFTREYGIESLHYVFELAQKYDRLIDVHCDEIDDEQSR
FT                   FVETLAALAHKFDMGNKVTASHTTAMGSYNGAYASRLFRLLRMSGINFVANPLVNIHLQ
FT                   GRFDDYPKRRGVTRVKEMLNANINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQVMG
FT                   YDQINNSLDLISTNSARTLNIQDKHGIEEGKPGSLLILPAENGFDAVRRQVPVRYSVRH
FT                   GKVIAETQPATTHIHLEQAEQVTFKR"
FT   gene            667951..668589
FT                   /locus_tag="VEA_000568"
FT   CDS             667951..668589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000568"
FT                   /product="metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000568"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53254"
FT                   /db_xref="GOA:D0M9I7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9I7"
FT                   /protein_id="ACY53254.1"
FT                   /translation="MTLLSQIESQFLEFMQQEMQVDAAHDISHVQRVVNTAKKLAVEEG
FT                   ADLSIVLPAAYLHDCFTYPKDHPNRKQSSIIAAKKAVAFLESIDYPQQYHDAIAHAIEA
FT                   HSFSANIRPNTLEAKVVQDADRLDALGAIGITRCIQVSTEFDAQLYDNKDIFAQQRELD
FT                   DKQFTLDHFQTKLFKIAETMNTESARREAQKRKAFMQAYIEQLHDEVTA"
FT   gene            668590..669348
FT                   /locus_tag="VEA_000569"
FT   CDS             668590..669348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000569"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000569"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53255"
FT                   /db_xref="GOA:A7JYV2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV2"
FT                   /protein_id="ACY53255.1"
FT                   /translation="MSESYTLIKELKRQLKLAGLHYVDVAQHLDLSEGSVKRLLAEGQH
FT                   ISLERLERICQLIGLEMAELFKLAAAHNKGLESLTLEQEKQLVDDKALLLVAICVVNGY
FT                   QFEQVVQQYTFNELELVQKLAHLDRLNIIDLQPNNKIRLRISPTFKWQMGGPIQRFFQQ
FT                   QVQDAFFQSYFSGEDEQLSMATGLMSVPTNKKLQQKLQKVIDEFYQACQSDSSLDMDEK
FT                   HGTSLIIAMRRWTFPLFEPWERKPTQKSRN"
FT   gene            669495..671348
FT                   /locus_tag="VEA_000570"
FT   CDS             669495..671348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000570"
FT                   /product="lysophospholipid transporter
FT                   LplT/2-acylglycerophosphoethanolamine
FT                   acyltransferase/acyl-[acyl-carrier-protein] synthetase"
FT                   /EC_number="2.3.1.40"
FT                   /EC_number="6.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000570"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53256"
FT                   /db_xref="GOA:A7JYV3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV3"
FT                   /protein_id="ACY53256.1"
FT                   /translation="MFFSKRFFPYFVTQCLGALNDNIYKNVLLLMVTYSQIDNLPISVN
FT                   LFVNLAAGLFILPFFLFSAHAGAVADSMDKAKLIRRLKLIELAIMSCAATAIATQSAML
FT                   MLALLFMTGTQSAYFGPVKYALLPQALKPNELVKGNAWVEMGTFLSILIGTLSAGLLLA
FT                   IPNGTLIASCVVIALSLLGFMSSVNIPTMPSQSTDKAKFEPISGLKNTLKVAKKQRGIW
FT                   MSILAISWFWFMGATYLTQFPNFAREHLFADSTVVSLLLALFSIGIATGSWLCEKLSFN
FT                   HVELGILPFGILGLTVFGVDLLWAVPSYPSLPVHFYDVQNFVAESKHLRVMIDLFLVGV
FT                   SGGVFIVPLYAFIQSRSNKGECARAIAANNIMNALFMVVSALVSIVALSVLELSIVELF
FT                   AMMAIGNFFVAIYVYRQVPEFTQRFISYLLSHCMYRVSVKGRQHIPEQGAALIVANHVS
FT                   YVDALILMGTSTRPVRFVMDKSISELPVLKYVFRHAGVIPICSPRKCADTYRRAFEQIK
FT                   QALNDGEVVCIFPEGRLTSNGELGEFRPGVEKILERNPVPVIPMALKGLWGSFFSHKGG
FT                   HALTKRPTRFWSKVDVVIGEVLSPASLNRHQLQQQVQDLLG"
FT   gene            671466..672083
FT                   /locus_tag="VEA_000571"
FT   CDS             671466..672083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000571"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53257"
FT                   /db_xref="GOA:A7JYV4"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV4"
FT                   /protein_id="ACY53257.1"
FT                   /translation="MKIIILHGLYMHGLVMQPLSQKLRKLGYETQVLSYNTVAIDESSL
FT                   FDSIDHSLNPLTTNVLVGHSLGGLMIKRYLANRKPTTSLISHVVAIGSPLKGASIVGRI
FT                   QDLGLGAILGNSPHHGLNRHNDAWAFPQKLGSIAGTMPIGARPLLIRNDNTMSDGTVTV
FT                   EETRLDGMQDHIEVKQTHTSLIYNTFVPQQIDHFIRTDYFRR"
FT   gene            672441..673097
FT                   /locus_tag="VEA_000572"
FT   CDS             672441..673097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000572"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000572"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53258"
FT                   /db_xref="GOA:A7JYV5"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV5"
FT                   /protein_id="ACY53258.1"
FT                   /translation="MNQSSLLAEFGDPITRVENALIALKEGRGVLLLDDEDRENEGDII
FT                   YSVEHLTNEQMALMIRECSGIVCLCLTDAQADKLELPPMVVNNNSANQTAFTVSIEAKV
FT                   GVTTGVSAADRVTTIKTAANPHAKPEDLARPGHVFPLRARPGGVMTRRGHTEGTIDLMQ
FT                   MAGLQPAGVLCEVTNPDGTMAKAPEIVAFGRLHNMPVLTIEDMVMYRNQFELKLA"
FT   gene            673202..673747
FT                   /locus_tag="VEA_000573"
FT   CDS             673202..673747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000573"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000573"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53259"
FT                   /db_xref="GOA:A7JYV6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV6"
FT                   /protein_id="ACY53259.1"
FT                   /translation="MKGLLKLVALVGFLSMNSLALASECPDILQGKQRLLNSTEEVDLC
FT                   ESFKGKTLLVVNTASQCGFTPQFEQLETLYQTYKEQNFTVIGFPSNDFRQDRGSETNTA
FT                   KVCYLDYGVTFPMMARSSVLGVDANPVFSEITNQAGIKPKWNFYKFLISSEGKVIATFP
FT                   SSTSPTSTTLTNMIEQQL"
FT   gene            673758..674201
FT                   /locus_tag="VEA_000574"
FT   CDS             673758..674201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53260"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV7"
FT                   /protein_id="ACY53260.1"
FT                   /translation="MTTRSTMLQLGYLGLVPFVFSLGLIFTDISLFNLSGQQFFIAYSA
FT                   VILSFLSGILWGNGIEHYYHRLSRNILILSNLFVLLAWGALLQGHKHYAVATLLLAIGY
FT                   LAVWYAEKLVRKVEQDAEPKGYQGMRSKLTFGVIVMHGLALVS"
FT   gene            674354..674599
FT                   /locus_tag="VEA_000575"
FT   CDS             674354..674599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53261"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV8"
FT                   /protein_id="ACY53261.1"
FT                   /translation="MFFRKLLFSTAMINATTGCVSYQAQQAAAQTVNNTGAVLTNVIKT
FT                   TIAQPCNVAITAASLFYPHAIFMTSVPTQACTSVLR"
FT   gene            complement(674670..675269)
FT                   /locus_tag="VEA_000576"
FT   CDS             complement(674670..675269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000576"
FT                   /product="periplasmic thiol:disulfide interchange protein
FT                   DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53262"
FT                   /db_xref="GOA:A7JYV9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYV9"
FT                   /protein_id="ACY53262.1"
FT                   /translation="MKKLLALCSALLLTFTAHAAQFEEGKHYKVLDVKKASKPVVTEFF
FT                   SFYCPHCYKFESLIERLKPALPKEAKFEKVHVGFMGGDMAIPMAKSYATMVSLGVEDTM
FT                   IPAMFAQIHQKRQAPKDDAELKQLFVDNGVEGKKFDAAYNSFAVNSMQKGFDKQFSAST
FT                   LRGVPGVVVNNKYIVLANEIRTYDEYNQLVNYLLTL"
FT   gene            complement(675354..675638)
FT                   /locus_tag="VEA_000577"
FT   CDS             complement(675354..675638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53263"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW0"
FT                   /protein_id="ACY53263.1"
FT                   /translation="MKTIEVRDIIVQQAALHKQLGVNDDCVELHHDESTINKVQQSHTS
FT                   CSSSCMVKIPANLSQNDLLLLPYSLALIDRPLVEKVVTVITKLYRPPIV"
FT   gene            676018..676314
FT                   /locus_tag="VEA_000578"
FT   CDS             676018..676314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000578"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000578"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53264"
FT                   /db_xref="GOA:A7JYW1"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW1"
FT                   /protein_id="ACY53264.1"
FT                   /translation="MLKKRFFKTKDEVEVTFELDKDQWDSIHIAGDFNNWQPEPMKLVK
FT                   KSRQFKFKTRLPKEQNVQFRYLLNDAKWENDPQADAYVPNAFGSDNSVVCTTE"
FT   gene            676529..677242
FT                   /locus_tag="VEA_000579"
FT   CDS             676529..677242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000579"
FT                   /product="putative DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000579"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53265"
FT                   /db_xref="GOA:A7JYW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW2"
FT                   /protein_id="ACY53265.1"
FT                   /translation="MNAQQVKPSLIIVEDDPKLQAMLGEYFVEQGFQVKCIDNGTDAPE
FT                   AIIDTQPDVVLLDLMLPGQDGLSVCRQIRECYKGKVLMLTASDDDFDHVAALEIGADDF
FT                   VTKPIKPRVLLARIRMLLRRKEAASTESENGLQIGVLCLNRLRKSCVMNQEEIALTDGE
FT                   FDLLWVLATHAEKTLSREWLTKTLRGIEYDGTDRTIDNRIVTLRKKLGDASCSPQKIIT
FT                   VRGKGYLFMPDAWNE"
FT   gene            677242..678537
FT                   /locus_tag="VEA_000580"
FT   CDS             677242..678537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000580"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with RstA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000580"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53266"
FT                   /db_xref="GOA:A7JYW3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW3"
FT                   /protein_id="ACY53266.1"
FT                   /translation="MRRIYLESFVGLIILFMVSLWGYEFLVYEINTDYDYLLQEQEGQA
FT                   FHDLIYPIYEEHGLEYTQQQLEQFATSSHRLLIPHTLEELPEDIRKAFESDTSVNVAYD
FT                   EERDIWFRLDADTPIFKMIDDPDSSVIQAINFDDNIVWLFFLAGFALYCILLIWFLSRR
FT                   IRELERVTVEFASGNFKARASTSSAKSVGTLNKSFNTMADKVSRLITSNKMLTNAVAHE
FT                   LRTPIFRLQWQADLLSDSTLTEQQKKHVRSIVEDIDEMEDMVEELLYYAKMERPDTALQ
FT                   TENVALAKLVSELKQRWQKETKLSISLNETNSENARAFADPKLLKRALDNLLRNAMRYA
FT                   NTQIMVEIKSDQQSCLIHVHDDGIGIEEQHWPHLFEAFYSADESRNKNTSGFGLGLAIV
FT                   RQIMELQHGEVSISHSPLGGACFTLRLPKSDS"
FT   gene            678655..679047
FT                   /locus_tag="VEA_000581"
FT   CDS             678655..679047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000581"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53267"
FT                   /db_xref="InterPro:IPR025693"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW4"
FT                   /protein_id="ACY53267.1"
FT                   /translation="MYKPFILVMTLASTLSACTYNQKPVVDMTNVDPAKYEQDFLYCQG
FT                   YADNVDKTEAAKSEAANGAVTGALIGAAAGALENGIGGAAVGAAAGGAVGAGAGALSGS
FT                   NDSTKTQSLVLRKCLQNKGYTVYDLD"
FT   gene            679191..679547
FT                   /locus_tag="VEA_000582"
FT   CDS             679191..679547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000582"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53268"
FT                   /db_xref="GOA:D0M9K1"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9K1"
FT                   /protein_id="ACY53268.1"
FT                   /translation="MKPGKTGLRRVMDATGYSFQGLKAAWKYEAAFRQELILALVLSVC
FT                   AFFLPVTTFERVLMISSLLLVLIVELINSAVEAVVDRVSDDWHELSGRAKDIGSAAVFV
FT                   ALTLALFVWASFLL"
FT   gene            679570..681225
FT                   /locus_tag="VEA_000583"
FT   CDS             679570..681225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000583"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53269"
FT                   /db_xref="GOA:A7JYW6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW6"
FT                   /protein_id="ACY53269.1"
FT                   /translation="MKTHNLQQKGISYVTFTFLLAFYFALVVNIPIYKELNGIFSSLDN
FT                   VKIGFIITIPIFFLAALNFLFNLFSWPWVGKPFFITLLIISSMVSYASYNYGTLFDSGM
FT                   IANIAETDSSEASSYLSTYSVIWTLLMGGVPAMIVYKVKLQSQRHQLLYFSLTKLVSML
FT                   SSLAVIAVIASVYYQDYASVGRNNSYLKKIIIPTQFVYSATGYVKEKYFTTPEPYREIG
FT                   IDAKQSDSAVKQAQNKPTLLVFIVGETARTQNYQLNGYKRETNPYTSKLDVISFQEVAS
FT                   CGTATAVSVPCMFSQLTRSEFERTKADNQDNALDIMQRAGVDLIWKENDGGDKEVAHKI
FT                   KKIEVNRKQASPLCNGQTCYDMALLDHFDQEVADMHGNRVVAMHLIGSHGPTYFQRYPR
FT                   DKAFFKPDCPRADIENCSVEQIVNTYDNTIRYTDLVLAETINKLKALESQYNTALIYVS
FT                   DHGESLGENGLFLHGMPYGLAPDFQKRVPLLMWLSSGFKQVKQINTDCLSNEAQKAGQY
FT                   SHDNVFHSLLGIMDVQTQAYDGKLDIFKDCRTTS"
FT   gene            681349..682281
FT                   /locus_tag="VEA_000584"
FT   CDS             681349..682281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000584"
FT                   /product="oxidoreductase Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000584"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53270"
FT                   /db_xref="GOA:A7JYW8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW8"
FT                   /protein_id="ACY53270.1"
FT                   /translation="MKIGIIGLGDIAQKAYLPVITQLPNIELVFCTRNANVLESLAKQY
FT                   RISETCQDYQQLLHFGVDAVMIHAATSVHPQIAAFFLQHGIPTFVDKPLADNADDVEKL
FT                   YDIAEKEKQPLYVGFNRRHIPLYNQHMPEVQQGNISDLKSLRWEKNRHQLPGDIRTFIF
FT                   DDFIHPLDSINVTAKTDLKEAYITHQLEGDQLARLDIQWQHGDTLLHASMNRHFGMTME
FT                   RVQACYANKAMEFDSFVEGRRWQANQEQKINLKDWTPMLTSKGFHAMLLDWFNVVESGK
FT                   IASEVVKRNIASHQLAEQICQYIEKVTSR"
FT   gene            682499..682930
FT                   /locus_tag="VEA_000585"
FT   CDS             682499..682930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000585"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53271"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYW9"
FT                   /protein_id="ACY53271.1"
FT                   /translation="MRTLGNIIWFVFGGVFMGLLWWFFGILAFISIIGIPWGRACIVMG
FT                   NFSFFPFGKEAISRDELTNEMDIGTSPLGVIGNVLWFVFAGLWLAIGHVLSAAACFVTI
FT                   IGIPFALQHLKLAVISLAPIGKTVVSSEEAAMARYNINR"
FT   gene            complement(683179..683340)
FT                   /locus_tag="VEA_000586"
FT   CDS             complement(683179..683340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000586"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53272"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX0"
FT                   /protein_id="ACY53272.1"
FT                   /translation="MRSGGFDREETRFRNGLRLLRKSKRWNYRWIGVSYLSSKIININY
FT                   AYSSTFRK"
FT   gene            683564..683902
FT                   /locus_tag="VEA_000587"
FT   CDS             683564..683902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53273"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX1"
FT                   /protein_id="ACY53273.1"
FT                   /translation="MDKYQAAYAKRLEKLKGNQSPKTIARLSAWEAFLNKEYELQDLEY
FT                   QLSDAAHLHYEQSHVKNDISFKAFKRAFYNESIKIYNLTDGASIQKVFTPLLALTTVWV
FT                   LFICFFDK"
FT   gene            684290..685138
FT                   /locus_tag="VEA_000588"
FT   CDS             684290..685138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000588"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53274"
FT                   /db_xref="GOA:A7JYX3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX3"
FT                   /protein_id="ACY53274.1"
FT                   /translation="MEQVGDRALIVEGGAMRGVFSCGILDHFLANEFSPFDSFWGVSAG
FT                   ASNLAAYLAKMPGRNLKIYLDYSLRKEFISPSQILRGGDMMNLDWMWDVTLEELGIDKS
FT                   ALKADSRPFFLGVTRQDNGQAEYHTPNVDELAETMKASSALPVLYRNGVLLNGTRYVDG
FT                   GVSDALPVAEAIKRGAKKIMVLRSQPSSYQKPKGKFSALTKRMLKETPGLIEPMLTREV
FT                   RYNQTLALIDNPPSGVEIIQVCPPESFKLKRLSRSPAPLRQAYELGIEAGKEAIMRWNQ
FT                   K"
FT   gene            complement(685282..686130)
FT                   /locus_tag="VEA_000589"
FT   CDS             complement(685282..686130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000589"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53275"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX4"
FT                   /protein_id="ACY53275.1"
FT                   /translation="MSTFREIRQLIQSQPTADGDGVKIRRVAGFNHASFSPFLMMDELK
FT                   SDDRADYVGGFPPHPHRGIETLTYMLKGHFQHRDHMDNVGELRSGGAQWMAAGRGVIHS
FT                   EMPIMQEGELHGFQIWINQPAKNKMSPAQYHDFQPETITEFETQSSGVVRLIAGHLTID
FT                   NERIQGPLTETGVAATVADWRAMVGHALNLTTEQYHNMMLYVYKGRIQVKDREINQGEM
FT                   AILSKGEWVELKAEKESGALIFIGEPINEPVVHYGPFVMNSMEEIEQAIQDYNSGLFES
FT                   Y"
FT   gene            686522..686731
FT                   /locus_tag="VEA_000590"
FT   CDS             686522..686731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000590"
FT                   /product="cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000590"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53276"
FT                   /db_xref="GOA:A7JYX5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX5"
FT                   /protein_id="ACY53276.1"
FT                   /translation="MSKVNGSVKWFNETKGFGFLSQDNGGQDVFVHFNAIVSDGFKTLT
FT                   EGQKVSFNVEQGKKGPQATEVTPL"
FT   gene            687232..687372
FT                   /locus_tag="VEA_000591"
FT   CDS             687232..687372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000591"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53277"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX6"
FT                   /protein_id="ACY53277.1"
FT                   /translation="MARKSKKQAEKDKKESEQNAAAVKQKTRRRIEDIMEQREFDKLFD
FT                   L"
FT   gene            687811..688824
FT                   /locus_tag="VEA_000592"
FT   CDS             687811..688824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000592"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000592"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53278"
FT                   /db_xref="GOA:D0M9L1"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028892"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9L1"
FT                   /protein_id="ACY53278.1"
FT                   /translation="MNAFIQGLPKVELHLHIEGSLEPELLFKLAQRNGIDIPYSSPSEL
FT                   RSAYQFEDLQSFLDLYYQGADVLRTEQDFYDLTWEYLLHCKADNVIHTEIFFDPQTHTE
FT                   RGIDFDTVTHGIARALKDGHEKLGITSQIIACFLRHLSEESAMETLQAVLKHRDKIIGV
FT                   GLDSSEQGHPPAKFKRVFKQAVEAGLLTVAHAGEEGPAQNITDAIEMLHVSRVDHGVRC
FT                   VENEALVESLIESKMPLTVCPLSNLKLCVFDDMKDHNIVELLRKGVAVTINSDDPVYFG
FT                   GYMTDNFLAVNNAHPMSNNELAQFTMNAIDASFIDNELKAKYRHLVSQYVSQHEAL"
FT   gene            688954..689427
FT                   /locus_tag="VEA_000593"
FT   CDS             688954..689427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000593"
FT                   /product="antioxidant putative"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53279"
FT                   /db_xref="GOA:A7JYX7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:A7JYX7"
FT                   /protein_id="ACY53279.1"
FT                   /translation="MIQQGQALPVATLSELTADGMVNHDVTELFANKKVVLFAVPGAFT
FT                   PTCSEAHLPGYVVLADELKAKGVDLIACVSVNDAFVMQAWGEAQNASEILMLGDGDASF
FT                   TKALGLEMDTGGFGGIRSQRYAMIIENGIVTKLNVEEPKEFEASKAETILAAL"
FT   gene            complement(689478..689789)
FT                   /locus_tag="VEA_000594"
FT   CDS             complement(689478..689789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000594"
FT                   /product="putative DamX-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000594"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53280"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9L3"
FT                   /protein_id="ACY53280.1"
FT                   /translation="MTSQDAYGYLNPNHYTMQVLALKQEKDVKDYIRYIDPKHPVWVNW
FT                   KNSRGTRWYTVTVGDFKTKQDAYNALSSLPSRVKQSSPFVLTFAEMQRKQQTSVVRMR"
FT   gene            complement(690100..691269)
FT                   /locus_tag="VEA_000595"
FT   CDS             complement(690100..691269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000595"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53281"
FT                   /db_xref="GOA:D0M9L4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9L4"
FT                   /protein_id="ACY53281.1"
FT                   /translation="MRKSTILNTVLITGFAAVSSLAYAAPTVVPNAPELSSRGYVLMDF
FT                   HTGKVLVERDAHKRLNPASLTKLMTAYVAGQEINAGNITLDDEVVISRNAWAKNFPDSS
FT                   KMFIEVNTSVSLSDLYRGLVVQSGNDASVAIAEHVAGSESGFVSLMNSWAAKLELNNTA
FT                   FTNPHGLDSDGLYSTPYDIAKLGQAIIRDLPDIYPLYSETSFTYNGITQYNRNGLLRDR
FT                   SMNVDGMKTGYTSGAGYSLATSATQGDMRLIAVVMGAKSENIRESESKQLLSYGFRFYD
FT                   TVMPTEAGTEVANARVWMGEQDELKVGVANDVYLTLPKGDVKKLQAEVEYNGDLVAPIS
FT                   QQQVVGKVLYKVEGKVVNEAELVALESVEEGSLFKRILDWFKQLVASWL"
FT   gene            complement(692467..693324)
FT                   /locus_tag="VEA_000596"
FT   CDS             complement(692467..693324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000596"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53282"
FT                   /db_xref="GOA:A7JZQ2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZQ2"
FT                   /protein_id="ACY53282.1"
FT                   /translation="MANEYIPPKVWTNDNENGGQWASINRPDSGARHEQELPVGEHPFQ
FT                   LYSMGTPNGQKVTIMFEELLAAGVKEAEYDAYLIKIGDGDQFGSGFVAVNPNSKIPALV
FT                   DRSGSEPVNVFESGNILFYLAEKFDHFLPKEGAKRAEVMNWLFWLQGSAPYLGGGFGHF
FT                   YAYAPEKFEYPINRFTMEAKRQLDVLDKRLANNEFLGGDEYSIADIATWPWYGNLVLGR
FT                   AYDAAEFLDVESYKNVVRWAKAIDEREAVQRGRIVNRSWGEEWEQLPERHSAEDIDKVL
FT                   KLKP"
FT   gene            complement(693769..695223)
FT                   /locus_tag="VEA_000597"
FT   CDS             complement(693769..695223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000597"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53283"
FT                   /db_xref="GOA:D0M9L6"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9L6"
FT                   /protein_id="ACY53283.1"
FT                   /translation="MSLNNRWTVEQRYRRLEQIPQCDIEEMTLLRQQDKGFPSFHIAPR
FT                   FGLLNDPNGLCYFNGEHHIFYQWTPVGPVHGMKYWYHLSTKDFIHFTDHGVGLHPDQDY
FT                   DSHGVYSGGALVENDKALLFFTGNKRDQNWNRIPTQCFATMDSDGNIEKHGVVIENEHY
FT                   TEHFRDPKVWKKGDDYLMVVGAQTKTEHGSMALYQSKDLKTWQHKGPIKTKFSDLGYMW
FT                   ECPDFFEINGQSVMLFSPQGVSSSNSYDFKNIYSVAYIVGDQLNLESMTLENHQDILQP
FT                   DYGFDFYAPQTYLDENGRRILIAWIGLPEIDTPSVTHQWAGMLSLPRELTLKDGFLVQT
FT                   PLPELKSLRKEEVVFAQSHTLESTNCLIQLDLEGDGFELELSNLKGDNIVFSATEHEFM
FT                   LDRRYMSHLYAEEFGGIRKAPRLDAKQTIDIYIDNSVIEIFINGGKHTMTSRFFIDDLN
FT                   KVTLKGLEQARLFPLKGITGLFESAK"
FT   gene            complement(695255..696268)
FT                   /locus_tag="VEA_000598"
FT   CDS             complement(695255..696268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000598"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53284"
FT                   /db_xref="GOA:D0M9L7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9L7"
FT                   /protein_id="ACY53284.1"
FT                   /translation="MAWLAFFNFYLVVKVFNTLGYQGFNFKVSKMNQVWVTGDAVVDLI
FT                   PESETSLLKCPGGAPANVAVAIARLSGKSAFFGRVGDDPFGRFMKSTLDQEGVCTEFLV
FT                   KDPEQRTSTVVVDLDDQGERSFTFMVKPSADQFMSVEDIPNFKQGDWLHVCSISLANEP
FT                   SRSSTFEAIKRAKAAGGFISFDPNLRDEVWQDQSEIQAVVMKAVAMADVVKFSEEELLF
FT                   LTDSTSMAQGLQQIAAMNIALVLVTQGAKGVWRVFESQSELITGQVVSPIDTTGAGDAF
FT                   VGGLLACLSQHDDWKNHPVVSSAIQWANGCGALATTQKGAMTALPTQTELLQFIGQ"
FT   gene            complement(696344..697783)
FT                   /locus_tag="VEA_000599"
FT   CDS             complement(696344..697783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000599"
FT                   /product="phosphotransferase system sucrose-specific IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000599"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53285"
FT                   /db_xref="GOA:A7JZQ0"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZQ0"
FT                   /protein_id="ACY53285.1"
FT                   /translation="MNYPAVAKELLTLLGGKSNITALAHCATRLRLAVADEQKIDEQAI
FT                   DNLEGVKGQFKVAGQYQIIFGSGIVNQVYAEMAKLTGMSEMSTNDVASAGAEKQNIVQR
FT                   AVKGLSDIFVPIIPAIVAGGLLMGIYNLLTAQGLFIDGKSLIEANPGLTDLANMINTFA
FT                   NAPFVYLPILLAFSASKKFGGNPYLGAALGMLMVHPDLLNGWGFGGASVSGNIPVWNIL
FT                   GFEIQKVGYQGSVLPVLVSAFILAKVELGLRKVIPSVLDNLLTPLLAIFIAGLLTFTVV
FT                   GPFTRDIGFLLGDGLNWLYNTAGFVGGAVFGLIYAPFVITGMHHSFIAIETQLLADIAT
FT                   TGGTFIFPIAAMSNVSQGAAALAVGIMSKDKKMKGIAIPSGVTGLLGITEPAMFGVNLK
FT                   LRYPFIAAVCAAALSSAFITMFNVKAQALGAAGLPGIISITPDKIGYYIAGMVIAFLTA
FT                   FVLTIVLGMRDRAKVGKKAAA"
FT   gene            698019..699005
FT                   /locus_tag="VEA_000600"
FT   CDS             698019..699005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000600"
FT                   /product="sucrose operon repressor ScrR LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000600"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53286"
FT                   /db_xref="GOA:A7JZP9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP9"
FT                   /protein_id="ACY53286.1"
FT                   /translation="MASLHDVARLAGVSKSTVSRVINDEYGVKEATKQKVRQAVAECGY
FT                   VPNQVAKDLKSQKTNLVGVIVPRVSSHATSQGVDGLTDVLEKAGKHVLLASTHQAHEKE
FT                   LEYIQIFNQKRVEGIILYATHLDSKLVKAIQNSAVPVVLVGQDGSMFNIPSIIHDDARV
FT                   GFEAGNRLVAKGCQTMGFIGVQGDDIAVDKQRSEGFVQALQHHGFELAFHARGDFTIDS
FT                   GYALAKQHLTENRKLDGLFCATDRIAIGAMRAIQELGLTPGKDVLVLGVGDDELASVCT
FT                   PTLSTFNYAFDKAGENGAKLLLDRIANRSFEMSKMVLTFKAIERQSC"
FT   gene            complement(699069..700508)
FT                   /locus_tag="VEA_000601"
FT   CDS             complement(699069..700508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000601"
FT                   /product="maltoporin"
FT                   /note="maltose/maltodextrin high-affinity receptor, phage
FT                   lambda receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000601"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53287"
FT                   /db_xref="GOA:D0M9M0"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9M0"
FT                   /protein_id="ACY53287.1"
FT                   /translation="MFAIFLGNVCKTLSINLRETMEMKLHTLTMAVALGLVTAPAFATT
FT                   DVDALEKRINELEQRLEQTEKVSTEANEKASSFEFHGYARSGLLINDDLNGAVGTGPYM
FT                   TAAGAIGAPIGRLGVEDDHYVEANLIHKRFADDGSSALFRIMLADSTETNNEWTASESQ
FT                   LNVRQVYAELNKLSMFSESSAFADATFWAGKRFDRDNFDIHFFDSDIVFLSGTGAGVYD
FT                   VQMSDSWKANFSIYGRDFGEIDSSSTDIENYIATMNNRFGNWQLMLSGMTSADNNDRVE
FT                   GAADKGLHAMFAYHGDNFFGMSEGFSKTGILMGDGLGAELKGIGSNGDLLEDAKAVRLF
FT                   SYGVTRIGDNWRVAPALLAEHSQDRFAKNDEFTWASFNIRLAQEFTQNFEMVYEGSYQY
FT                   MDLDNAIDKASGSFYKATIAPTLKMSTAAGFFDRPELRFAVSYVDWSEDLNGYSISQDA
FT                   GAATMGDGGEVLFALQMETWF"
FT   gene            complement(700974..701705)
FT                   /locus_tag="VEA_000602"
FT   CDS             complement(700974..701705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000602"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53288"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9M1"
FT                   /protein_id="ACY53288.1"
FT                   /translation="MYLKTVLFSASTLLILGCNSESTNPSTEESGWIVVSSHSEPRKHQ
FT                   VIYEKHSRKGLSLATNVPDLDLPLTYQLANQIIEVKEELTFGENIDGNRLTWKAIGNSK
FT                   LRENQVHYGVNKDYSASNEGIAIGYVNFESRFEAEGKLGIEKLFIAMYDDVKSVKFYSG
FT                   WDSSKISCYQNTFDEDLACYGEILINDDIVHVFDKYLPYEYVNMVYDTVMSKGREEIIE
FT                   ADFQHQIKYLLVAKENNVEMH"
FT   gene            complement(702017..702736)
FT                   /locus_tag="VEA_000603"
FT   CDS             complement(702017..702736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000603"
FT                   /product="putative 3-oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000603"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53289"
FT                   /db_xref="GOA:A7JZP7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP7"
FT                   /protein_id="ACY53289.1"
FT                   /translation="MKDEKVAVVTGAARGIGQAICEQLLEDGFHVVGLDISPVEWSQSP
FT                   NLSSYQVNLCEAAAVSEVVDRIVAKHQRIDVLVNNAGITRDALLPDMLEQDWDSVIDVN
FT                   LKAVFLLTQRVAPVMLEQGVGSIVSISSIVGTDGNIGQSNYGASKGGVIAMSKGWAKEL
FT                   ARKGAQIRVNCVAPGFIATDMTKSLPEKVIQMMESKTPLGRMGSAQDIANGVAFLASDK
FT                   SAFITGQVLKIDGGLVL"
FT   gene            complement(703009..703812)
FT                   /locus_tag="VEA_000604"
FT   CDS             complement(703009..703812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000604"
FT                   /product="zinc ABC transporter permease protein ZnuB"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53290"
FT                   /db_xref="GOA:A7JZP6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP6"
FT                   /protein_id="ACY53290.1"
FT                   /translation="MGEYLWLAPAVLCGLIALVGNIVLGQQVLNRQIIFIDLAVAQVAA
FT                   LGAALSHYWLNSSSWYAGSPWLSESWLGSMLGPWMMSLVLCGVIAALEKRKHPHLEPMI
FT                   GSLFVVSASLAVLLVSKDPHGADFIQGILNGQLLWSTWQDVWPLAVITGAMLLLLTLKP
FT                   EFMHGSGFYLIFAILMPITVKLTGIYLEFALLVIPALGAASLKGRRFLIASLGIGTIGI
FT                   LLGIAASAKYDLPSGATIVITLFIIGVIFNLLPPFKRHVLLETKH"
FT   gene            complement(703815..704741)
FT                   /locus_tag="VEA_000605"
FT   CDS             complement(703815..704741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000605"
FT                   /product="zinc ABC transporter-binding protein ZnuA"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53291"
FT                   /db_xref="GOA:A7JZP5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP5"
FT                   /protein_id="ACY53291.1"
FT                   /translation="MRSKLAISKCSLVMMAAGAAIISSPALALNIFVCEPEWKAFLESH
FT                   APNATIYSATTAKQDPHYVQARPSLIAKMRQADMAMCSGAELEVGWLPMLQNRSGNSAV
FT                   QNGAQSMIYATDFVRMLDSHDHVDRSMGDIHAHGNPHVQFAANDMIPLSRKVTERLKAI
FT                   DPDNAQSYQVNGMKFRAKWQKKLNEWEQKAQPLQGKRVVGYHSTYRYLFDWLGMVQVAD
FT                   LEPKPGISPTTSHLQSLTQLDAKQFDAIVFSSHQDQRPAMWLKQQTDKPVAQLPLTVSK
FT                   QQSLDELYDEVITDLLATLVSPSSVKF"
FT   gene            complement(704731..705873)
FT                   /locus_tag="VEA_000606"
FT   CDS             complement(704731..705873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000606"
FT                   /product="zinc-regulated TonB-dependent outer membrane
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000606"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53292"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP4"
FT                   /protein_id="ACY53292.1"
FT                   /translation="MNKKLVSLAIGSIFASPVFADTLSNPQIGVVVDGYYQDGQRHNSE
FT                   REEGFGLGHTELNLSSNIDDKFHGALTAVLESHGDETELELEEAFIETLALPYGVNVRA
FT                   GRFLSDFGYLNNQHMHTDSFVERPIAYRTFLGSHYYDDGVRANIVLPTDLYVKFGVEAL
FT                   SGNKMSSVEDGSKVGIYTTTMKLGNDFSESSSWQFGLSYLRNENGKVKEFEDHDHGHGH
FT                   EEEHDHSHAAAVTGANLYGADFVWKWAPDGNYKYSNFTLSAEYMLLDGVVDSKYKNDAE
FT                   SPDNLSAYYVSGVYRFNPSWSAGLRYGEAESYDGHAHGDHMHFTALNDKEMDAMIAWDS
FT                   SHFGTIRAQYTRIDNQDSETDNVFTLQYVMTFGAHGAHAF"
FT   gene            706081..706752
FT                   /locus_tag="VEA_000607"
FT   CDS             706081..706752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000607"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53293"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP3"
FT                   /protein_id="ACY53293.1"
FT                   /translation="MLNMDFSKRIVIETGEQEWIASPSKGVWRKPLEREAKESGHTTSV
FT                   VKYEPNSHFSTHPHPHGEEILVLEGVFSDEHGDYPAGTYLRNPPGSQHAPYSKEGCVIL
FT                   VKLNQFNSDDLETVRINTNEANWLPGIGGLKVMPLHDFENEHVALVKWPKDEKFQPHRH
FT                   FGGEEIFVLSGEFKDELGTYPPYSWIRSPHMSEHFPFVEQETIIWVKTGHLPLQAPAQQ
FT                   P"
FT   gene            complement(706826..707065)
FT                   /locus_tag="VEA_000608"
FT   CDS             complement(706826..707065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000608"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53294"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP2"
FT                   /protein_id="ACY53294.1"
FT                   /translation="MLGENHSLTHEFPEHLDTITQLAENDASFAETVKNYNALDKEIRV
FT                   LELQGSPIDDHEMNVLKHNRAELKDWLHSRIMGS"
FT   gene            707298..708335
FT                   /locus_tag="VEA_000609"
FT   CDS             707298..708335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000609"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53295"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZP1"
FT                   /protein_id="ACY53295.1"
FT                   /translation="MNSMKIGLISASIAVALIGCNSDSDSVSTMTPVTLSVSDAPIDDV
FT                   SEVVITYNKVAFLPLDGGTPQVFDVYKTDEEGNLVDEDGNPLPEGEDPLPLSVNLLNFQ
FT                   GSDAQELVDDELIPTGNYKLCVFANDGDHPNYPSYVIDEETGNQIPLTVKGDGACPQGV
FT                   GKDPDSGVLFFNNTFAVNPDNNEFVVEFDLRRGLKDGTGQNEGYSIQRTSVTLINTVTT
FT                   GEIQGDVATLTYQSCETDTPSANGYAHAVYLYQGNIAEENMGPFAGAEGQAMPIAAANV
FT                   VQDVDDANYEYEFGFVEPGTYSVGYTCTANDDSEEGIVAGETFSIYQSTSGLNVSVGTN
FT                   TDANF"
FT   gene            complement(708313..708447)
FT                   /locus_tag="VEA_000610"
FT   CDS             complement(708313..708447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000610"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53296"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9M9"
FT                   /protein_id="ACY53296.1"
FT                   /translation="MKTNVLSCESICGEQRADQERHEEKAELVLALPFLGDLKSLRLY"
FT   gene            complement(708450..709319)
FT                   /locus_tag="VEA_000611"
FT   CDS             complement(708450..709319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000611"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000611"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53297"
FT                   /db_xref="GOA:A7JZN9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN9"
FT                   /protein_id="ACY53297.1"
FT                   /translation="MSHQQVSRINDVLFYIHQDISRELSAKELADVAAYSEQHFHRIFK
FT                   DVVGESIHQYIRRTRMEYAANQLMFDTSSSVLDIANKCGFSSVSSFSRAFKATFAMSPG
FT                   AWRKHDLQVAEKPYLKDPEVAAGYHRVAKRELPEPKIMEVPQRFAAYVRHEGYSRSIRN
FT                   AWLILKAWASSENRDFSVQYGLHHSNPAWVELDKCRYVACMAIDTPLKVRGVVNQMTIP
FT                   GGLHAVFRLTGVYGELLPQLSMVLEKWLPNSGFKQRSTPAYVHYHKNHFLSHDEAFELD
FT                   FYLPISFF"
FT   gene            709444..710592
FT                   /locus_tag="VEA_000612"
FT   CDS             709444..710592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000612"
FT                   /product="transcriptional regulator GntR family/aspartate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000612"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53298"
FT                   /db_xref="GOA:A7JZN8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN8"
FT                   /protein_id="ACY53298.1"
FT                   /translation="MEIAQSLQQTKSSYIREILAAASDKNVISLAGGLPDEKTFPIDLM
FT                   KPTLENLANMPEVFQYGATAGYAPLLNFLTDYYQLPESHLAMITTGSQQGLDLIARAYV
FT                   NPGDKVVMEAPSYLGAMQVFGLVQANIVTVSQTECGPNLEELEQCFATQQPKMFYAVPD
FT                   FHNPTGVCWALETRQKVAELCIQYDVAFIEDAPYRELRFSGEALPLVSDFCPQHSIVLR
FT                   SFSKIASPGLRIGVVTGKRSYLEPLIKIKQGADLHSSIPMQALLHGLLQHDNFETHIST
FT                   ICALYKSRYDVMFAELQKQLPESCVLKPVDGGMFVWVEIPECDTFELAKTLLANWVAVV
FT                   PSPVFYPEGSKVKAALRLNFTNATPEELTTAVTRLADVLNAL"
FT   gene            711005..712033
FT                   /locus_tag="VEA_000613"
FT   CDS             711005..712033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000613"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53299"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN7"
FT                   /protein_id="ACY53299.1"
FT                   /translation="MNTRTTTGLVATGWSVIFSLFTAFAAYANTSPNCSDVLAGNTTAV
FT                   SQKMMVLLGEDITKSNRITTVIPAENNPFVTEELVSVSNDVSPNGRLPQKTLEEIRKVR
FT                   SDLEKAAQEVSRLQGTFEVAFVSLIDGYCQFSNHELTQHAKIDFDHLEGLTLYSIPALL
FT                   AMVDQSYAMAENRIASEQEQLSNIEKEQQRQKQQASAAAAARYQDGNVLVKVENFDGSN
FT                   VTFSVTNVGSQGSLQPNFNTFNAYRTESGELVYKSESLLNLADTAGNTFETMGIAELSS
FT                   RGGNNLSISPGETRKFVTSIASEVAPHTQLSLEFPAKVLNTEQDFTLSFSDTTAVATAN
FT                   VN"
FT   gene            complement(712137..712466)
FT                   /locus_tag="VEA_000614"
FT   CDS             complement(712137..712466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000614"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000614"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53300"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN6"
FT                   /protein_id="ACY53300.1"
FT                   /translation="MKKRVMCLALAASLTGCVTFPTQESEQVQVLWDNVNAIENCELMG
FT                   MVIGSEGHFYDYWLHADKDMVWGTLNQMRIKAADLGADTLYLYEPLDFSTSVTMFANAY
FT                   KCKQP"
FT   gene            712662..713372
FT                   /locus_tag="VEA_000615"
FT   CDS             712662..713372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000615"
FT                   /product="lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000615"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53301"
FT                   /db_xref="GOA:A7JZN5"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN5"
FT                   /protein_id="ACY53301.1"
FT                   /translation="MVSKNKLIRYTATEVADAFEKEDELIKQVQSNQLSQVLLLWQVKS
FT                   PTLVLPAGKKWPISNELEHALNASGWKLFSRKTGGAPVPQVPGIINLSHIYHWPDGEPY
FT                   DIKKAYLDLCAILTVFFEQLGVKIDVHATPYSYCDGEYNLNIGGQKVVGTAQRVLLKKG
FT                   GGQVVLSQACILIDADVEKIVAPVKLCNQLCGHNDDIRGDVHTPLFHHISDRPSVDSLF
FT                   QRLTSAFLMHAKGD"
FT   gene            complement(713436..714473)
FT                   /locus_tag="VEA_000616"
FT   CDS             complement(713436..714473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000616"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53302"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN4"
FT                   /protein_id="ACY53302.1"
FT                   /translation="MKVNFHLDKKNKPQSENGMKVVYGQAKRGGYRLRWYLILAIVISP
FT                   LLFMAYYLFRTQVLVTAPAIITSHPLTVTATRSAIVGPVPVNVGTEVTQDQALLLLKDN
FT                   ALNKEIDFIKDELVKLSKNQVQSTDELYKSAIESSAEGLKKVRDIQKKYDLYRKKGQVS
FT                   EVDYAAIVSVNNSLSNQLSSQKIAYVDAMRNLEELELAGPVTQEYRSLMRELVVKRAQQ
FT                   EDLTFRSPMDGRVLDIHVHEGQNVSENTPLLTIARNVTPEITAFLNPKYLEYSNMETKA
FT                   KVVFPDGRKFRATVSKPVEVVNKLPSELQSPFEGQPAYLKVTLSFDEPLEKSRWIEGVE
FT                   VEVRF"
FT   gene            complement(714475..715749)
FT                   /locus_tag="VEA_000617"
FT   CDS             complement(714475..715749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000617"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000617"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53303"
FT                   /db_xref="GOA:A7JZN3"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN3"
FT                   /protein_id="ACY53303.1"
FT                   /translation="MLLHNEELWLLLFPVMIIIELPLYLLVLTGIFRWSYAQEDPELKR
FT                   FPSVSFVITCYGEGDAIGITIDTLVEQVYPGHIEVLAVVDGAVQNQDTYQAALNGEKRH
FT                   AGVRNRKVRVLPKWQRGGRVSTLNAGLSMASGEIVINVDGDTSFDNDMVFTMMKQFADK
FT                   NVIASGGALRVRNHNANLLTKMQSLEYMLSMQAGKTGMATWGVLNNISGAFGAFRKNLL
FT                   KQVGGWDTHTAEDLDLTMRLKQYKRRYPDNKLAFSTHSIGHTDVPDTLKGLVLQRLRWD
FT                   GDLLFLFLRKHNEGLSPRLLGWGNFLFTLAYGVIQNVLLPLLVVIFSVYMVIVYPIKFV
FT                   LALMLMLYFVYLFLSALIFVVYIGLVSERKTEDLKSAKWLFLYPVYQFFMRLITAFSMV
FT                   NEVVRRSHEESSMAPWWVLKRGKKF"
FT   gene            complement(715778..717133)
FT                   /locus_tag="VEA_000618"
FT   CDS             complement(715778..717133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000618"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53304"
FT                   /db_xref="GOA:A7JZN2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN2"
FT                   /protein_id="ACY53304.1"
FT                   /translation="MSSINNNFYWVGEQPVSELAEDMVLVNHIDEVATGLGGMVCIAYQ
FT                   DPHQIDTALKAFYQEKGRWSWAVYVTVETPYSRCVTDGVFEARESIKIWRSIQNKLDAI
FT                   DEPEVLDPLIGWLGVNRQRRVTALKSLESMSVYSYPIIDMLFPDIYSTYRYVLSEQGRG
FT                   VLEAEVLIDRIRVCSHCNSGHLNYVEVCPDCSSIDIDSQSSLHCFTCGHVGEQHSFQRR
FT                   GKLECPKCLTQLRHIGVDYDRPLENHVCNSCSSLFVEAATISQCLSCDSKIKVEELVVR
FT                   KIYQYRLGEVGEYIFQHGKSIQAPELSIKGKVEVSFFQNLLAWLNKVALRHKDQHLLLG
FT                   LHLPTIDEYGKQYGDAKLFSLMDQLTRRLSGLFRDTDICCQYKQDVLLVLMPNTTNASL
FT                   SILQQKLSDLGELVEDEEFELDVFAWDLPDPIIEDGVSVWMESLMGEIYAAR"
FT   gene            717852..719420
FT                   /locus_tag="VEA_000619"
FT   CDS             717852..719420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000619"
FT                   /product="ATP-dependent RNA helicase RhlE"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000619"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53305"
FT                   /db_xref="GOA:A7JZN1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN1"
FT                   /protein_id="ACY53305.1"
FT                   /translation="MGFTSLGLSAPILKAIQEKGYDTPSPIQAKAIPAILEGKDVMAAA
FT                   QTGTGKTAGFTLPILERLSNGSRVRANQVRALILTPTRELAAQVQENVFMYGRHLPLSS
FT                   AVVFGGVKINPQMQRLRKGADVLVATPGRLMDLYNQNAVKFDQLEVLVLDEADRMLDMG
FT                   FIRDIRKILALLPKQRQNLLFSATFSDEIRDLAKGLVNNPVEISVNPANSTARTVEQSI
FT                   YPADVKKKAPMLVKLIKDGDWKQVLVFTKTKHGANRLAKFLIEQNLPAAAIHGNKSQGA
FT                   RTKALADFKSGEIRVLVATDIAARGIDIPQLPQVVNFELPKVAEDYVHRIGRTGRAGEV
FT                   GKAISLVCALEASELFAIERLIQEVLPRKELEGFAPTNVVPESKLDTRPIKPKKPKKPK
FT                   KPKAPNAAGENAPATEKKAGNGANKPKRRFNGGNNGNKNSTNQGGAGKPKSNSEGQGRT
FT                   NSKPDDRKPNGNKPNGNKPNGNKPNGSKSGNAGKPSGNRKPNNAKPAGNKPSGQRRKPR
FT                   PQTAN"
FT   gene            complement(719526..722405)
FT                   /locus_tag="VEA_000620"
FT   CDS             complement(719526..722405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000620"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53306"
FT                   /db_xref="GOA:A7JZN0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZN0"
FT                   /protein_id="ACY53306.1"
FT                   /translation="MKPSFIALAVASCIGLAGCGSDSSDAPVPVDKPIISADLYLRGLN
FT                   GDWGTAEHAKLNYLGNNEYETVLRVARGSNQFKIADPGWQIQYTYFEEPAAFDKAQEYL
FT                   PKPDTNEACMNDDCNSEITFEDKGYYKFSVSFADESRATMTVTKATQEEAEKYYSDAIL
FT                   DPAMVHEGHQSKEVKLFANYDDSSDTVIFSVKDPKAKQREFGISTTTELRDALDQGLVI
FT                   NEQTGPRVVSGDVAFDALFALTMKELDQLAVSEIKDGNYNYNNPIKAEVFETGAKWHYV
FT                   WTRDLAYAADLSLALMNPTRVQNGLNFKLSAFRDTTDQKYDGEQIVQDTGTGGSWPIST
FT                   DRTTWALGAERLLSALDGEEYNQFAERAYNAISNTLEADRLAAFDAKSGLYTGEQSFLD
FT                   WREQTYSMWTPNDVNAIGSSKALSTNVVHYRAIQLAAKLAEKYDSTNAVKYTEWAEQLK
FT                   TAINEQFWNAERGMYVSYLFDNGKDIAVDKYDMLGEALAIISGVASDAQAKQIMANYPH
FT                   SEFGVPVYFPQQPDVPVYHNRAIWPFVTAYSLRAAHQTQNVAAANNAIQSLVRGTATNL
FT                   SNMENLEWLSGKSFIIHSDHGEDPSLDGPVINSQRQLWSVGGYLNMVVETLFGIHTETG
FT                   KLEVKPFITSWVRNNLLAQSEQITLENFAFKGKNYSVTIDLPEVSKDETGYYPVENVTM
FT                   DEEGHFHVTMGALVNVDSSITLVSGVKPYVSEDSRVYSPQEPTLVVTSVDNSVSIDVTS
FT                   KYNVNLYRNGELIQKNVIAQSYSDTPTGFACYLAESINDKGFRSNPSQPACVGEEIRIK
FT                   LDGEYQPLKDNVSVVTVSKDSGIVKGAESFTAPVTGTYQFDAWYNNNLGQLNTGITNTV
FT                   KLLEVLDDAGKVVGQGYLQMGHIGENQGMRYSTPIEVALEQGKTYQIALKDHFNMSYLT
FT                   SNETYIYAGGIEGEKNEAQIADIRITPLM"
FT   gene            722626..723537
FT                   /locus_tag="VEA_000621"
FT   CDS             722626..723537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000621"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000621"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53307"
FT                   /db_xref="GOA:A7JZM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM9"
FT                   /protein_id="ACY53307.1"
FT                   /translation="MDKSLQQFLLVARCQSISAAARMAGLSQPTVTSNLKKLEENLGVT
FT                   LFERHPNGMVLTEYGRILYRHSNAMQHEYNQMMQSIDERKQYQVGKIKMGTGDAWWPLF
FT                   VKQALNDHLTKQPSASTHVEFGNHLGLMDSLINEQIEFFIGHEIVGLSSKCDVTFIPLF
FT                   QTVDAYFVSPSHPLLGKTVTEEMLHEYPALSVTYDAKKFAHVIDNPIPKQNERERQQLD
FT                   DRPTYEVDSLLASIDVLKESVAVMSYTGHLKPYLESFGLRCLTMENEPNPGTVGIYRHR
FT                   RETSESHLDLVAGITQRAKLLN"
FT   gene            complement(723490..724425)
FT                   /locus_tag="VEA_000622"
FT   CDS             complement(723490..724425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000622"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000622"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53308"
FT                   /db_xref="GOA:A7JZM8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM8"
FT                   /protein_id="ACY53308.1"
FT                   /translation="MDKFSDMTLFVSIVKHQGLAAAGRELGLSPATVTARLQAIEERYG
FT                   VKLLNRSTRHVSLTDAGAMYHQACLNIIDSVKETENLLQTGISEVRGTLKISAPRDIGK
FT                   QIISPMVSAFSEQYPDVTPYLYLNDNLSNLAESGLDLVIRYGELADSNLISRKLASSQR
FT                   VLCASPDYLAKQGVPNCPQDLVDHRSLAMVRSNEELKTWHFKDEESHQTITVTPKRFSD
FT                   DGEVIRQWALDGAGIALKSILDIQQDLKQQRLVTVLDGYMKNFSAFSQGAEADLHVIYQ
FT                   SRQYQPKRVRLFLDFLVEQFSALSDTSNQI"
FT   gene            724625..725254
FT                   /locus_tag="VEA_000623"
FT   CDS             724625..725254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000623"
FT                   /product="glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000623"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53309"
FT                   /db_xref="GOA:A7JZM7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR007494"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR011901"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM7"
FT                   /protein_id="ACY53309.1"
FT                   /translation="MKLYIYEHCPFSARVRFVAGMLNIQLDVINIAYDDEITTANIIGA
FT                   KQVPLLIKDDGEAMAESLDIINYFLELASSNESSQPSTPVLDWQKQAFLPLQKVGYPRW
FT                   SNMTLPEFATETAKQAWRAKKETEALNFEALINDTPAIAKEVAALIEQTKPLLNLSSEK
FT                   QTSLVDQAIMFSILRGFFSASEVQWDPAVLHWMATARKATNVPVLI"
FT   gene            725265..726389
FT                   /locus_tag="VEA_000624"
FT   CDS             725265..726389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000624"
FT                   /product="N-ethylmaleimide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000624"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53310"
FT                   /db_xref="GOA:A7JZM6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM6"
FT                   /protein_id="ACY53310.1"
FT                   /translation="MKQRPNKLFEPAQLKALSLQNRIVMAPMTRARTTQPGNIPNEMMA
FT                   TYYQQRASAGLIISEATQISDDSQGYSFTPGVYTDAQVAGWQGVTQAVKSQGAAMFCQL
FT                   WHVGRVSHPTFQNGEQPIAPSALAPVETQVWIADEQGNGNMVDCVEPRAMTQADINRVV
FT                   GDFANAAKRAIESGFDGVEIHGGNGYLIDQFLRTNSNHRTDNYGGPRENRIRFLIEVVD
FT                   AVIAAVGAHRVGVRLAPFITFKDMDCPDIVPTILEASKQLQERDIAYLHLSEADWADAP
FT                   TIPEAFRVELRKRFRNAIIVAGRYDPQRANEVLEKGYADLVAFGRPFVANPDLVSRLQH
FT                   HHPLAELDGSTLFGGNERGYTDYPALQQKCAEQA"
FT   gene            complement(726473..727531)
FT                   /locus_tag="VEA_000625"
FT   CDS             complement(726473..727531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000625"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000625"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53311"
FT                   /db_xref="GOA:A7JZM5"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM5"
FT                   /protein_id="ACY53311.1"
FT                   /translation="MQQMNSIVMLDGRVRLQQVEIPQPAAGQVLVRSLACGICGSDLHI
FT                   TRHADEVFDVFHQLGLMPDEVGEHAQVMLGHEFCAEIVEYGADTQQTLPVSSRVTSVPM
FT                   LLSQNGAGVGVTPGTYGAYSEYFLLDEALLLPVPDEMPSEAAALTEPLAVGLHAVNRSE
FT                   IETEDTALVVGCGPIGLAVIAALKQRGVSNILAVDLQEEKLQLASEFGANRLINPTKED
FT                   EIAVGAQYAMNSRLVIYECVGKHTLIDDFMRRAPARARIVVSGIHTAPATINYAYATVK
FT                   ELDLRFSYYYQPQEFEQCLQAIAEHKLPWQKMLTAKVGIDGVEDAFRQLMTPNDHIKVV
FT                   IEPWRRGALEVI"
FT   gene            complement(727536..728048)
FT                   /locus_tag="VEA_000626"
FT   CDS             complement(727536..728048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000626"
FT                   /product="2,4'-dihydroxyacetophenone dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000626"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53312"
FT                   /db_xref="GOA:A7JZM4"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM4"
FT                   /protein_id="ACY53312.1"
FT                   /translation="MSLPEVIQHQDFLLTLNTNEESIIKDALPGVDVYPLFLDPENGTW
FT                   VIRAKFKPGVTLPKHFHTGVVHFYTLSGAWHYIEYPDQVQTAGSYLYEPGGSIHTFHCP
FT                   EESGGADGFMVIQGANINFDEEGNFLNIMDAGWIEQVVVAAANAQGFTARYIKPGAIAG
FT                   LSDDLAE"
FT   gene            complement(728089..728850)
FT                   /locus_tag="VEA_000627"
FT   CDS             complement(728089..728850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000627"
FT                   /product="putative sorbitol-6-phosphate 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000627"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53313"
FT                   /db_xref="GOA:A7JZM3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM3"
FT                   /protein_id="ACY53313.1"
FT                   /translation="MELINKTAIVTGAAGGIGQAIIAKLREQGAKVLAVDISEQSLQMY
FT                   ASFGSKQLETFVVDVTDYQQVEAMVKYAVEQFGSLDIMVNNAGIGAPKPLLEHDPIADF
FT                   EPISKVNQNGVYYGILAAARQFQAQGTPGVILNTSSVYAQMASEMTFTYNVSKAAVDMM
FT                   TKCAALELAPLDIRVCAVAPGRVDTPMLRQYEEIGLWNHIRKEQMRQNFTQPEEIANVV
FT                   AFLVSEKANCINGCTISASDGFENFKYPLMG"
FT   gene            728982..729983
FT                   /locus_tag="VEA_000628"
FT   CDS             728982..729983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000628"
FT                   /product="putative transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000628"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53314"
FT                   /db_xref="GOA:A7JZM2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM2"
FT                   /protein_id="ACY53314.1"
FT                   /translation="MYIVRSGAADKFDSLVSELGQNPQEIMAAVGLSAAQFRDPDTYLA
FT                   YPRLAELLEEAAARCKQPLFGALLAERQNLQSLGDLPMLVSRAETVGNALARVNDYLYL
FT                   HSSGVTLNMTPQDDWVRLSLNIDVNSDRGIAQLMQLSVSHLAMFIASLLDIEASHFALH
FT                   LTQHATLEVEQSKFAQQNKLRFGDKFDGILLKASLLNAKDHQDEDALDRHFQQHLKYLQ
FT                   TRYPNNLSDQAANMIGRLLSTGECSVERVARALDLHPRMLQSKLKQQETSYRQLLQQVR
FT                   QDFAEQRLSENIQSITDIALQLGYAETAVFSRHFRSWTGKSPSQWRLENRIS"
FT   gene            complement(730048..731325)
FT                   /locus_tag="VEA_000629"
FT   CDS             complement(730048..731325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000629"
FT                   /product="TRAP-type C4-dicarboxylate transport system large
FT                   permease component"
FT                   /note="COG1593"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000629"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53315"
FT                   /db_xref="GOA:A7JZM1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM1"
FT                   /protein_id="ACY53315.1"
FT                   /translation="MTTALVATMITLLAFGFPMLVPLLAATMLGFIVFLGLGPDFMIQQ
FT                   MLAGIKPAALIAVPMFILAAEIITRGVAATRLLDVAMAFVGHVRGGLAITSSLSCAMFG
FT                   AVSGSTQATVVSVGSIMRPKMLEYGYKDSFALALIINASDLALLIPPSIGMIIYGVVSG
FT                   TSVAELFIAGIGPAIVILLMFSAYCYFYAGKSSVENAPRASWKERWTTIRKAVLPFGFP
FT                   IITVGGIYAGVFSPTEAASVSVLYAVLLEMVIFRKVKWKELGEIALSTGMVTAVVFILV
FT                   AAGAAFSWVISFAQIPQELLGMIGINDLSQTELLVVISIAFFIGCMFVDPIVVMLILIP
FT                   IFAPVIKSSGIDPVLVGTIVTLQAAIGSATPPFGCDIFTAIAVFKRPYVEVIRGTPPFV
FT                   FILLLVSVMLIFFPSISLFLRDLAFR"
FT   gene            complement(731322..731879)
FT                   /locus_tag="VEA_000630"
FT   CDS             complement(731322..731879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000630"
FT                   /product="TRAP-type C4-dicarboxylate transport system small
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000630"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53316"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZM0"
FT                   /protein_id="ACY53316.1"
FT                   /translation="MKGIFQWLDKYIQKAEAALLIGSVLLIALNSIANVLGRYLFSQSI
FT                   YFSEELNYFLIIAVTFIGCSYAARQSRHIRMTAFTDMLPKRIQTLANGIIYLLTAALVA
FT                   VLTWYSWQYIGKVSQMGRLSPAMQVPLSWVYLIAPIGLFFSTVQFARVGSRHIKRFIML
FT                   TKLSRSSRPDGIGSATKQEKAL"
FT   gene            complement(732012..733445)
FT                   /locus_tag="VEA_000631"
FT   CDS             complement(732012..733445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000631"
FT                   /product="transcriptional regulator GntR family threonine
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000631"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53317"
FT                   /db_xref="GOA:A7JZL9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL9"
FT                   /protein_id="ACY53317.1"
FT                   /translation="MNQLKYCVMTISLNPIIRPGTAKYISIGNYLVECVRSGYLKPGTR
FT                   LPTHREFAEQIGVSVQTVSHAYGYAEKKGALESWVGNGTFVKSGFVDESTDTEFMLTQE
FT                   MKETPDEIDMSIAHPVVTDRHITLFNQALMEIAGQTNNRSLISKAKPVTGQPHHIESGA
FT                   RFLSSQGLDVGTDQILLTNGACHGLTLALSTVVEHSDLVACGHLVDHGLISRSRMLGFK
FT                   LQPLEMDGFGITPDAFEWACKHKPIKALCCTPSMANPNSAHMDISRREAIANIAKQYEI
FT                   YVIEDDVYGALEPNRVPPLAALLPEQAFYVTSLTKVVAPGMRTGYLTVPRHFLQHAIGR
FT                   LAATSWSATPLPFEVAHLWIENGTLNRLVRFQVNEFAKRQRIAKATLEGHVYSSHPNGQ
FT                   HIWLRLPEQWSSDDLVASAKRSGVQITGYKPFVLDTNQPMPYVRISLGAETNRGYIKHG
FT                   LSVIAEILDTNPPTSHFLV"
FT   gene            733719..734906
FT                   /locus_tag="VEA_000632"
FT   CDS             733719..734906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000632"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000632"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53318"
FT                   /db_xref="GOA:A7JZL8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR014335"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL8"
FT                   /protein_id="ACY53318.1"
FT                   /translation="MRGVALHFTLDEFQDRLTKVRQSMEERELDVLIIHDPSNMAWLTG
FT                   YDGWSFYVPQCVVVGSSGEPVWFGRCQDANGAYRTAYMSAENITYYPDHYVMNPPLHPM
FT                   DFLVEAVLAPRLWDRGRIGVEKDNYYFSATAYESLTTHLPNAQLLDATGLVNWCRAVKS
FT                   DQELAYMYRAARIVENMHRVAFDMIEPGLPKHHLVAEINRQAVLGHEDHFGDYTAIVPL
FT                   LPSGSDASAPHLTWDDRPFKKGEGTFFEIAGAHRRYHCPLSRTIFLGEPDDKFKRADEA
FT                   LTLGLEAGLEVARPGNTCADIANALNQVLDKAGFSREGARCGYPIGLSYPPDWGERTMS
FT                   LRDTDKTVLKEGMTFHFMPGLWFEDWGLETTESIVITRDGAKTLCDFPRHLFVKH"
FT   gene            734961..735968
FT                   /locus_tag="VEA_000633"
FT   CDS             734961..735968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000633"
FT                   /product="succinate dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000633"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53319"
FT                   /db_xref="GOA:A7JZL7"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL7"
FT                   /protein_id="ACY53319.1"
FT                   /translation="MQKSSITATVDFDREGVQHGFLALPYSHDDSAWGSIMIPITVIKN
FT                   GHGPTALLTGGNHGDEYEGITSLLKLANSLQAEQIQGRVIIVPMMNLPAVQNASRTSSI
FT                   DKGNLNRSFPGNPVGSVTEKIADYFTRYLVPMCDFALDIHSGGKTLDIVPFAAAHRLDN
FT                   LDQEEACILGAKLFGAPYTMILLEMDATSLYDTAVESQGKIFVTTELRGGGTSTPETIA
FT                   YADRGIRNFLRFSGNLSGDYEKPTLPTRLLDMPDASCYVQSQHNGITEYLFELGDTIKQ
FT                   DDVLARIYSTERTGSDPIEYKAQRSGIFAARRFPAMVNIGDTVAVIAEDCGELN"
FT   gene            736301..737314
FT                   /locus_tag="VEA_000634"
FT   CDS             736301..737314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000634"
FT                   /product="TRAP-type C4-dicarboxylate transport system
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000634"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53320"
FT                   /db_xref="GOA:A7JZL6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL6"
FT                   /protein_id="ACY53320.1"
FT                   /translation="MNPMKHSYLTSAVLIAASFATSNVYAETWKFALEEVKGSVQDAYA
FT                   QEFKKRIENATDGDVTVEVYPYGTLGQSEDLTELTANGIIQFTNASPGIFGSFVPEMQV
FT                   FSIPYLLSQDNDVNKKVLSSSPTIYDTLGKKLEQKNLKLLTMYPEGEMVWTTNREIRSP
FT                   KDFDNFKIRVMASPMLVEAYKSFGADPTPLPYSEVYGALQLKMIDGQVNPVFAIEEMKF
FT                   YEVNDYMIWAGQQQFTTTVITNNSWFETLPQTRQDQVNKVIAGMTDFIFEKQDEFNQER
FT                   LDQIKQAKPDMQMIKLDSDERAAFKQASMPMRDKYIELTGDSGKAVLSSLEQEFNQ"
FT   gene            737418..737897
FT                   /locus_tag="VEA_000635"
FT   CDS             737418..737897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000635"
FT                   /product="transcriptional regulator AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000635"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53321"
FT                   /db_xref="GOA:A7JZL5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL5"
FT                   /protein_id="ACY53321.1"
FT                   /translation="MRLDRYDVKILQILHDNGRITKSHLAEAINLSVSPCWERVKKLEE
FT                   AGIIEGYGAKVNTDVLFKRTSVMVEVTLKEHSAQAFKRFEQLVQHSPEVTDCYATGGGV
FT                   DYILKIQSEDIDQYQRLIDNWLESEVGIERYFTYIVTKTIKRDAGTLEVNQNALF"
FT   gene            738053..739573
FT                   /locus_tag="VEA_000636"
FT   CDS             738053..739573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000636"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000636"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53322"
FT                   /db_xref="GOA:A7JZL4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL4"
FT                   /protein_id="ACY53322.1"
FT                   /translation="MTALHISHAEELKASHDMMAIMKDVRLVRGLAYVNGKWVSGDQFH
FT                   PVDNPADGTVIGYITKLSQQQLYQAIDEADQAFRQWRKMQAEERAEILMRWHDLILESK
FT                   QDLARLMVMEQGKTLGDALGEIDYGASFVRWFAEEARRSYGETIPSHIPNAQLSTVREP
FT                   IGVAALITPWNFPNAMVTRKAAAALAIGCPVLIKPASETPFSALALAELADRAGFPPGV
FT                   FNVITGDAVMVSQTLCHSDKVKALSFTGSTRVGKLLLRDAAQTVKKCSMELGGNAPFIV
FT                   LPDMDVEQAAKAAVDAKFQTAGQDCLAANRIFVPDDKYEAFLEAFAKEMNHIVLGNGLD
FT                   EKTTMGPLINRAAVDKAHDLVRDALDKGARLVAGYHQPVPGENFFAPTLLADVTPDMAV
FT                   YREENFCPVAGVLPYQDLDTVIEMSNDTEYGLAAYVYGHDIHQIWRCMRGLEFGMVSVN
FT                   SVKMTGHPIPFGGVKQSGLGREGSRHGFEEYSEIKYCCLGALPTVSGS"
FT   gene            739615..741021
FT                   /locus_tag="VEA_000637"
FT   CDS             739615..741021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000637"
FT                   /product="gamma-aminobutyrate:alpha-ketoglutarate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000637"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53323"
FT                   /db_xref="GOA:A7JZL3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL3"
FT                   /protein_id="ACY53323.1"
FT                   /translation="MSNKTQQLLEIDRQRVFHASTHLKQYAAGELSGRIISSGSGIRIT
FT                   DSEGIELIDGFAGLYCVNIGYGRTEMADAIYEQAKELAYYHTYVGHTNEALVTLSDRII
FT                   KMAPEGMSKVYYGMSGSDANETQLKLVWYYNNARGLPEKKKIISRDRGYHGSSIASGSM
FT                   TGLPLFHAHFDLPLERIKHTMAPYYYRREDDSMSELEFSQYCADQLEAMILEEGPETVA
FT                   AMIAEPVLGTGGIVPPPEGYWQAIRKVLDKYDVLLIADEVVCGFGRLGSDFGSLHYDMK
FT                   PDLITVAKGLTSAYQPLSGVIVGERVWSVLENGTDQWGAIGHGYTYSGHPMGAAAANCN
FT                   LDIIEREGLVQNAAEVGAYLQQRMAETFNDHPLVGDTRGVGLLHALEFSSDKLRRAHFD
FT                   PNLKVGPQIAAACLEQGLIARAMPHGDILGFAPPLIANRNDIDTIVDKAHQAVNKVMDN
FT                   LVTSKQWQPK"
FT   gene            741108..742082
FT                   /locus_tag="VEA_000638"
FT   CDS             741108..742082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000638"
FT                   /product="pyridoxal-5'-phosphate-dependent enzyme beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000638"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53324"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL2"
FT                   /protein_id="ACY53324.1"
FT                   /translation="METQAIFAAKKAINGLVSRTPLLHSPLLSQQYQCEIWLKLETLQP
FT                   IGAFKLRGATHAMNKLSEEQKQHGVVTCSTGNHGRAVAYAGQRLGVRTVICMSNLVPQN
FT                   KVDAIKALGAEVRIVGQAQDDAEREALRLTEEESMTYLSPFEHPDIIAGQGTIGLEIIE
FT                   DLPDVDVIFAGLSGGGLIGGIGLAAKSNSSKVNVYGVSMDKGAAMVESIKAGKPVQVEE
FT                   HESFADSLGGGIGLDNRYTFKLVQEVMDKAFLVSEHNIAKGMADIFDAEKFAVEGAAAV
FT                   GLAAIHQHQLDLRGKKVVLVLSGKNVSSDTFETALKIGRQVKE"
FT   gene            742097..743056
FT                   /locus_tag="VEA_000639"
FT   CDS             742097..743056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000639"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000639"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53325"
FT                   /db_xref="GOA:A7JZL1"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL1"
FT                   /protein_id="ACY53325.1"
FT                   /translation="MKIYNKSQIEQVTQLDLNALAAVENGFKALGQGNVTMPPILSMAI
FT                   EEHNGEVDVKTAHIKGNERFAIKISPGFFDNPKLGLPSLNGLMVLFSAKTGLVDSVLFD
FT                   EGYLTDIRTALAGAISAKYLSNSEASKITVIGSGLQAELQVAAIKLVRPISQVNIWARD
FT                   NTKSQAYKQRMEQRYDLSVSVHSSIQQACQEADIIVTTTPSKEPLLNWEDIPSGAHVIA
FT                   MGSDSPHKRELATSVILNAEHLVVDRISQSESLGELRGVDKPLTRSLVELGDIICGKHP
FT                   YSRRVDDVSVCDLTGTGVQDTAIADYTAQQLTSIQSTM"
FT   gene            743113..743889
FT                   /locus_tag="VEA_000640"
FT   CDS             743113..743889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000640"
FT                   /product="asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000640"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53326"
FT                   /db_xref="GOA:A7JZL0"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZL0"
FT                   /protein_id="ACY53326.1"
FT                   /translation="MPELCTFQSLTTQFDFSADVSAYQRSIGLIQLATDYVLENEWREH
FT                   LPADVRLYTSRFLTTGTVDPLHLTDMQNSIRECVRTIVPMWPINVMAFGCTSASVLIGS
FT                   DQITDLIRQERPEAITTNPWQAALRALEHHQAQRIVMLTPYTNDVNHPLYESMTEHGID
FT                   VLAFGYFNLDYDPHIPTIGGQDVENALAHLLESIDCTVDAVFISCTNMRVMHLLPYFSS
FT                   RFGIPVLSSNQVMLWDALRLLESDNFSDVSSSPFPC"
FT   gene            743937..744458
FT                   /locus_tag="VEA_000641"
FT   CDS             743937..744458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000641"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000641"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53327"
FT                   /db_xref="GOA:A7JZK9"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK9"
FT                   /protein_id="ACY53327.1"
FT                   /translation="MAKLTLQEQMLKAGLVNEKKLKKAKKGSKKSRVQAREVKAAVEEN
FT                   KRQQLERDKQLSEQQNAERLNKEIKAQINQLIEMNKIDLKDGDIKYNFTHGTLVKSLYV
FT                   DALIREQLIKGILAIAIVGESYVVIPRGVANKIAQRDESVIIEQKEPESDIPAEDDPYA
FT                   DFVVPDDLMW"
FT   gene            complement(744552..745166)
FT                   /locus_tag="VEA_000642"
FT   CDS             complement(744552..745166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000642"
FT                   /product="transporter LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000642"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53328"
FT                   /db_xref="GOA:A7JZK8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK8"
FT                   /protein_id="ACY53328.1"
FT                   /translation="MDIWKLLLFIPACFALNMTPGPNNLLAMNNARCYGFRAAFVASLG
FT                   RITAFSGMIALSASGLAVILYTSEMLFLALKLVGALYLLWIAFNLWRSESSPISELTNS
FT                   RNYAGLAKQEFTLAAGNPKAILIFTAFLPQFVDVNANVQEQFFALGSTFLILEMVAISI
FT                   YAIFGLYLRHWFSNPKMAKRFNRGCSLFLAASGVNLLLSKQ"
FT   gene            complement(745246..745638)
FT                   /locus_tag="VEA_000643"
FT   CDS             complement(745246..745638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000643"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000643"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53329"
FT                   /db_xref="InterPro:IPR022253"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK7"
FT                   /protein_id="ACY53329.1"
FT                   /translation="MKDDDIIVSLPSLIHRIGGENAKRIKVIAADCGCDVKRVRRSRHW
FT                   QVSGEALNLKALLDQLKAGQCEELRFVMNKLEKGLSVHQDKLEPLEEKLIRLVVQNPNI
FT                   TLAELMTETHCTIAQARSARFEAEML"
FT   gene            complement(745642..746511)
FT                   /locus_tag="VEA_000644"
FT   CDS             complement(745642..746511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000644"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000644"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53330"
FT                   /db_xref="GOA:A7JZK6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK6"
FT                   /protein_id="ACY53330.1"
FT                   /translation="MLDLNWLRTFVTLAEVKHFGKTATELHMTQPNVSLHIKQLEQATR
FT                   TKLIERNPVQLTQAGKRLLDTAQRMLNELQICQSDLNAINDLTQGTLSIAASDIVSRLL
FT                   LIKPFQQFKSEYPGIDLALFNTTSSQAVDLVKSARADIGFVIAQKESQPLHFTPLTQIH
FT                   WCAFGDNIFEWQDNRKESQTLILLGHDTRTRELIDASLPELNLPKHRVMEVGSVEAQID
FT                   WAEAGFGTAIVPDFSLDPRLMLSREVTPLPSFPNTDFGYIVRQNQVLSKAAKQLLTWVG
FT                   ENVSVVGE"
FT   gene            746617..747873
FT                   /locus_tag="VEA_000645"
FT   CDS             746617..747873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000645"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000645"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53331"
FT                   /db_xref="GOA:A7JZK5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK5"
FT                   /protein_id="ACY53331.1"
FT                   /translation="MSSIVVVGANWGDEGKGRIVDFLAEQASASIRFQGGNNAGHTVVN
FT                   DLGTFKLHQLPSGVFNPDCLAVLGPGMVISPALLSQEIAEVEEAGVKVNMCISDRATLC
FT                   LPLHALEDTLEEQRLGDKAYGSTRQGIAPAYGDRVMKKGILVGWLKQPEVLVERLQFMM
FT                   DWKLPQLRALYPTFEFEQTAEEMANWLLEVSAPWRDSICNVTLPLKELQAKDKTLLFEA
FT                   QLGAGRDLVYGEYPWTTSSNVVSMYAGIGSGLPALRPERVIAVAKAFSSSVGTGTLITA
FT                   MEEQDAFRELAGEFGATTGRPRDMGYFDAVATKNGVELQAATEIALTKVDCLTGLNDLK
FT                   ICVGYEGDHSENPIWPQTAALAPIYEKMESWSEDITGCRKFEELPVAAQKYVLRIEELM
FT                   GVPVKMVSVGPGREQMIMR"
FT   gene            748244..749308
FT                   /locus_tag="VEA_000646"
FT   CDS             748244..749308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000646"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000646"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53332"
FT                   /db_xref="GOA:A7JZK4"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK4"
FT                   /protein_id="ACY53332.1"
FT                   /translation="MTKNLFRLSTITLGLCISSFSFAQSDLPNIKILATGGTIAGAGQS
FT                   ATESNYTAGKVGVESLISAVPSMTNIADISGEQVVSIGSQDMNDEVWLKLAKRVNELLA
FT                   QDDVDGIVITHGTDTLEETAYFLDLTVKSKKPVVIVGAMRPSTAMSADGPVNLYNAVVT
FT                   ATDEDSEGRGVLVAMNDTIFDARDVTKTNTTSVSTFQSPNFGPIGYIHNSDAKYQRSPE
FT                   RKHTTETPFDVSKLNTLPKVGIVYNYANASSLPVKAFVDAKFDGIVSAGVGNGNLYHTV
FT                   FDELEKASKDGVVVVRSSRTPTGSTTLDAEIDDDKYGFVASGTLNPQKARILLMLSLTQ
FT                   TKNYQDIQKMFQYY"
FT   gene            complement(749389..750225)
FT                   /locus_tag="VEA_000647"
FT   CDS             complement(749389..750225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000647"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53333"
FT                   /db_xref="GOA:A7JZK3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK3"
FT                   /protein_id="ACY53333.1"
FT                   /translation="MQINNQSRDVFYVSDGTAITCETLGHVVLGQFPFIPNEKTFPFVE
FT                   SQDKVADVVKEIETSYQRNGVKPLVFFSIVVPDVREMLLEAPAYSYDVLESIVQKVQDD
FT                   IQMAPKPKLQRSRSVGKDSDTYFDRIAAIEYTLAHDDGITLKGLEQADIILLGVSRSGK
FT                   TPTSLYMAMQFGLRVVNYPFIAEDVKMMRLLPEFEIHRHKLFGLTIDPERLTEIRENRL
FT                   SGSDYASTEQCKLELDTVEALFRREAIPYINTSSLSVEEITTRILEKAGMKRRLFG"
FT   gene            750477..752849
FT                   /locus_tag="VEA_000648"
FT   CDS             750477..752849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000648"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000648"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53334"
FT                   /db_xref="GOA:A7JZK2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK2"
FT                   /protein_id="ACY53334.1"
FT                   /translation="MQKNTLWFNGLSMDDVDKVGGKNASLGEMVSNLANAGVSVPNGFA
FT                   TTSYAFNQFLDHEGLDERIHQLLDELDVEDVEALRKTGATIRQWVLEAPFPADLEQEIR
FT                   ENYQELIEGNPELSVAVRSSATAEDLPDASFAGQQETFLNVKGIDAVLEATKHVYASLF
FT                   NDRAISYRVHQGFDHRGISLSAGIQRMVRSDKASSGVMFTLDTESGFDQVVFITSSWGL
FT                   GEMVVQGAVNPDEFYVHKPMLEAGEHPIVKKTFGSKLIKMIYSDNQEIGKQVDIVDTSD
FT                   EERNTFSLNDEEIKELAKQAMIIEKHYQRPMDIEWAKDGIDGKLYIVQARPETVCSQTE
FT                   QNVIERYELQNKADVLIEGRAIGQRIGKGAVRLVDSLDQMSLVQEGDVLVTDMTDPDWE
FT                   PVMKKASAIVTNRGGRTCHAAIIARELGIPAIVGCGDATSKLTDGATVTVSCAEGETGY
FT                   VYQGELEFDVKRSSVDELPLLPTKVMMNVGNPDRAFDFAQIPNEGVGLARLEFIINKMI
FT                   GIHPKALLNFDAQSDELKAEIKQRIRGYKDPIDFYVSKLTEGIATIASAFWPKRVIVRM
FT                   SDFKSNEYSNLVGGKAYEPHEENPMLGFRGASRYISPVFEDCFELETQAIKRVRNEMGL
FT                   KNVEIMIPFVRTPSEAASVIDLLAKFDLRRGDQGLKVIMMCELPSNAVLADEFLKYFDG
FT                   FSIGSNDMTQLTLGLDRDSGDVAHLFDERNAAVKIMLKMAIDAATKAGKYVGICGQGPS
FT                   DHEDLAEWLMEQGISSVSLNPDTVIDTWLQLGKVSSK"
FT   gene            753020..753799
FT                   /locus_tag="VEA_000649"
FT   CDS             753020..753799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000649"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53335"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK1"
FT                   /protein_id="ACY53335.1"
FT                   /translation="MKKSIALITTLMLLASPAYADWDDISNKMSELGEAVSDTAQDAWD
FT                   DTKAFSKQAWQDFTNWSEEAINTAGEWTEASIEKSKEWIDAADKKIDELMEGDTPEEAR
FT                   QAVDLMADSALLKLFNEKPEAKAIYDNAYGYAVFDSRKLSLLFHTNSGSGVAVNKETEK
FT                   RTYMNMFGLGVALGAGGKFYQQVILFESKEDFDTFVNEGWEATSEASAVAGEDSEQLSK
FT                   QFNSGVAVYQLNAKGLLIDANVSGSKYWVNEELTNSQ"
FT   gene            753921..754799
FT                   /locus_tag="VEA_000650"
FT   CDS             753921..754799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000650"
FT                   /product="transcriptional regulator LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000650"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53336"
FT                   /db_xref="GOA:A7JZK0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZK0"
FT                   /protein_id="ACY53336.1"
FT                   /translation="MVTSLSRWMAFRYACPKPSAIRYPMPDNNFNNLLAEAISALNTPN
FT                   FTPKLMRVIRTLFHFDCAVILGYREGKHPIYLYDSIENERELLFQRYLTDSFQNDPFFL
FT                   KLNETKQQGIFTLKDVARKGVDFTSYCEQFYHQTGWKDELSMLVEVEPGRWVMLYFGYM
FT                   NDGKYFSQQQINKLKPYFPIIQSLCQQHWKQTEFTFSEPVFAQSAYSGSMRLAIEQALA
FT                   TFGVESLTRREQEVASLLAQGFDTKEIAARLHLVQGTVKNHRKRIYSQLNVSSLSELFQ
FT                   LFLNHLILHSR"
FT   gene            754882..756141
FT                   /locus_tag="VEA_000651"
FT   CDS             754882..756141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000651"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000651"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53337"
FT                   /db_xref="GOA:A7JZJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ9"
FT                   /protein_id="ACY53337.1"
FT                   /translation="MTTPLLQDLQDRGLIAQASDLEEIQTLLSQPQTVYCGFDPTAGSL
FT                   HIGHLVPLIMLKRFQDAGHQAIALIGGATGMIGDPSFKATERSLNSKEIVSGWVNDLSN
FT                   QIQQLMNHQLAKPMIMVNNADWMKAINVIDFFRDVGKHFSINTMINRESVKQRLQRPDQ
FT                   GISFTEFSYALLQSYDFAELNRQYDCRLQIGGNDQWGNIVGGIDLTRRQNGEQVFGLTL
FT                   PLITKSDGSKFGKTEGGAVWLDPSKTSPYAFYQFWLGAEDADVYHFLRYYTFLSCEEIA
FT                   SIEAQDQASQGKPQAQRILAEEMTRFVHGEEGLASAERITQALFSGNMQQLSLGELKQL
FT                   ELDGLPSIESAQQDLVELLVESGLASSKRVAREHISNNAISVNGEKVSADNPSLSFPLF
FT                   DQYWLLQRGKKHFCLVKRTA"
FT   gene            complement(756220..756579)
FT                   /locus_tag="VEA_000652"
FT   CDS             complement(756220..756579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000652"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53338"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9S1"
FT                   /protein_id="ACY53338.1"
FT                   /translation="MLRFIQRRRIKKVIKLMSTRLVVGYGSREYFSVGQVKTSTSELST
FT                   CQQKIALALYANPQELDLENQPELQAIRSDVAHDFFAGADYTAQDVLNLFGAGGWKGGR
FT                   MEDGMSHHFGMHSRY"
FT   gene            756692..757573
FT                   /locus_tag="VEA_000653"
FT   CDS             756692..757573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000653"
FT                   /product="transcriptional regulator LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000653"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53339"
FT                   /db_xref="GOA:A7JZJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ7"
FT                   /protein_id="ACY53339.1"
FT                   /translation="MKIDDLKLFTKVVQLGSFTAAANALDLPRANVSRRIGELERYLGT
FT                   QLFHRTTRSLSLTNKGDAYYQDLQKVLTLLDSANQQASNESIEVRGKIKLGLLPETYEP
FT                   LQPILFEFQDQYPQVELDIRNINNGFIDMFQQGLDIALHGGMLFDSDIVARKILTLDRC
FT                   VVASPNYLQTHGTPATLEELSDHQCICFRWPNGNVDNLWHFQEQNVALKPKLISNNIGF
FT                   IKSSTVLDRGISYIPKLLVKNELESGALVQVLSQYAVTEETGWLLYPKPKTLNQASRLL
FT                   IEHLCNKIPKLL"
FT   gene            757678..758760
FT                   /locus_tag="VEA_000654"
FT   CDS             757678..758760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000654"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000654"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53340"
FT                   /db_xref="GOA:A7JZJ6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ6"
FT                   /protein_id="ACY53340.1"
FT                   /translation="MNHQIKTAALSTIALSLLGCNQTQPQVEEPSASRPVQVIEVNERN
FT                   EELNKSFSGIVKAKETASLSFRVPGTVESVFVNKGSLVEKGQVIAMLDKHDYQVSLEEL
FT                   QARMLEAQSAHKLAKAELKRVKQATSDDAIASVNLDRAISSYERSLSAVKVVEKNIQRA
FT                   KDALRYTTLRAPFTGIVADVSVDPHEQTLPGGSVVSIQQEGSWEVDIDVPENMIAQFAL
FT                   GQPASLTWYDSEQSYRATVSEIAPKKHLLKQTYTVTLDIDSISSALFNGKAVTVNTALN
FT                   TSHSSHCFPYSAILGEKQTLHVNVVRDAVIHSEPVNLDSIDAYQACVTGSFEQGDYVVI
FT                   SGSHYLSEGDAAPNLTIKTL"
FT   gene            758771..761833
FT                   /locus_tag="VEA_000655"
FT   CDS             758771..761833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000655"
FT                   /product="transporter AcrB/D/F family"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000655"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53341"
FT                   /db_xref="GOA:A7JZJ5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ5"
FT                   /protein_id="ACY53341.1"
FT                   /translation="MINLAEFAIRQRKFVLFFIVLSVIAGIYSYFDLGKLEDPSFTVKT
FT                   AVVVTLYPGASAEEVEHQVTDTVETKLQEMAELDRLRSLSRPGLSMVFVDLKESLNSKA
FT                   LPQEWDLLRRKVDDVKLQLPSSAQISVVQDEFSEVYGMLFSIHSTDAAPEELRRYAEEL
FT                   QRQIKAVDGIKKIELHGIQPRVVHIDMPDERLAQYGLSIAQVWNQLSTQNSTFEAGKFD
FT                   AGTERIRIAQTSEFQSLEDIRNLIINGGTGEFGSGLIRLGDIADITMGYQTPALAENRY
FT                   NGEPAVTLAVSPVQGINVVSLGDTIQDIIANYQATLPLGVDISTVAYQPEEVQKSIDDF
FT                   VGNLLESVAIVFVVLLVFMGFKSATIVGASLLLTILLTLVYMNIASIDLHRVSLGTFIL
FT                   ALGMLVDNAIVITDMMIAKLNKGIERTRAAIDSVKETAVPLLGATVIAIMGASPVLFSK
FT                   TDSAEFASSVFYIVASSLLLSWIVAMTFTVLMAWMFIKPKANSEETKPSRYKQLVFWTV
FT                   DNPRKALAALVPLILVTAVAIPYVAVNFIPQSDRSIVFLDYWLPNGAKIEQTSADMRKV
FT                   EEWLVAQPEVESISSYVGTSAPRFSVTVEPEPLDPAYGQILINTKDYESISHLVTRGDD
FT                   WLKKAFPDAEPRFRALKLATKDKFAVEVRFSGPDETVLHQLAAEAKTIFASNPDAKYTR
FT                   DDWRQESKVLKPILNQDKMRQAGINRADVAFALKRASDGMPLGQMNLNDELIPIQLRGT
FT                   SQNMASLETLPVRSLLGFNSVPLGQVVDGFELVTEESMIWRRDRVKTITVQAGVSRDST
FT                   PANVRNAIKDQVESIQLPAGYSMEWGGEYYDEDKAVTDIMKQQPKAMLIMVIILVAMFN
FT                   GFKQPIIILATLPLAASGAVFALLGFDKPFGFMALIGAITLTGMIIKNGIVLMDQIELE
FT                   RANGMSLSDAIKEATVNRTMAISMGALTTALGMIPLLSDLLFDQMAATIIGGLAAATIL
FT                   SLFVMPALYRLAYKEKAPSTQTNAELEEASS"
FT   gene            761830..763332
FT                   /locus_tag="VEA_000656"
FT   CDS             761830..763332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000656"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000656"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53342"
FT                   /db_xref="GOA:A7JZJ4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ4"
FT                   /protein_id="ACY53342.1"
FT                   /translation="MKKFILTPVVLALSLAGCAVGPDYQAPTTSMAETYLNAENAGLST
FT                   DSQPVEFWWTKFHDPVLNQMVQDIQSQNIPLKVAAERVKMANNYKTMVESFKVPTINLG
FT                   AGYMNYQFSKNDSSLGPILNPLSDSVSGLPPQIGNITLMDNQHDGVFAGASIAWEVDLF
FT                   GRIDRQANAAHIRLEQAQIYQSGLNTVITADLIHNYLQYQGASERLELAKSNLEDQRLT
FT                   LDLVEKVVRSGYGSDLDLAQAKATLAAMESLVPQLEIAQQAHKHRLAVLLGEPLTQVEI
FT                   RLSKQHSVPVMQDMVPVGLPSDLLKRRTDIRLAEREMAALNEELAASVADQYPKFFLTG
FT                   APGLSASSFDDLFSSDSFGWMGAAGVSWNLFDGGRGEAIEAINQARFDSATLSYQHTVE
FT                   AALAETESTLFTYGRSQENQRRIGDALKATNNAVNKAKSLYRAGLIDHLSVLDAQRQQR
FT                   MMQDQQVAAKLQTAHATIALYKSLGGDWTLQPEAQPDTNAKG"
FT   gene            763518..763772
FT                   /locus_tag="VEA_000657"
FT   CDS             763518..763772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000657"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53343"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ3"
FT                   /protein_id="ACY53343.1"
FT                   /translation="MNNSRWVGFIGGTIVLLSTFILFGSSVHSAWYRIPAEAIHGIAFT
FT                   LAFGLGLNSLLAYATAMLTLAALFYIGFVVGYRIHQKLK"
FT   gene            complement(763874..766282)
FT                   /locus_tag="VEA_000658"
FT   CDS             complement(763874..766282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000658"
FT                   /product="beta-mannosidase"
FT                   /EC_number="3.2.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000658"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53344"
FT                   /db_xref="GOA:A7JZJ2"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR028369"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ2"
FT                   /protein_id="ACY53344.1"
FT                   /translation="MAHFELNGQWLLTSPQRPDIEIPMFIPGDNVSALLQAEQIPDPYF
FT                   ADNENKVRWIEECEWHISREFDVDAFTLSAKQIWMTLTRVDTLATFYINGELALTCRNM
FT                   FTQQRVDIKPHLKQGTNTIRVEFARVDLEGIARAKKLPFPIPSAMGNNQIPHMNLIRKT
FT                   QCHSGWDWGICLMVSGIYDPIQIDIVNELWLKGFSTEQQWQADGSVFLDVVVEVETDSQ
FT                   RHEMMVEFNGERQCIQTNGSGHYHCQFHISEPQRWWPSGYGEAYLYPITISCREQKLTR
FT                   NVGLRQLTLNNQADEHGSAMEFIVNGVPINAKGANWIPVDAMPGRECETRYRNLLQSAV
FT                   DANMNMIRVWGGGQYESEIFYNLCDELGLLVWQDMMFACSLYPSDNDFLKEVEGELRYQ
FT                   ISRLKEHPSIALWCGDNEVIGAIGWYEESKHNKVKYTVNYDRLNRMIEQVITEHDSARR
FT                   FWPSSPCNGELDFGDAWHDDSKGDMHFWDVWHSGKSFNAYLDVNPRFCSEFGFQSWPSF
FT                   AEVKQFVPEQDWNITSLTFEQHQKNPRGNSIITEMFTRYFRFPSGFENMLYLSQVQQAI
FT                   AIKTACDHWRAISPVCRGMLYWQLNDNWPVSSWSSLEYSGRWKQLHYHAKRFFAPQYLV
FT                   FSEHTGKLSLHLLNDAKEPASVNALLKWVDWQGEEKQCWSLEQTVIADSNTILWQLNES
FT                   VEKDELTSGFLYVEAQIGEDRISNTWFCTHELKTLPMAKANIDVSIDGSQITLIADKPA
FT                   FFVHLESDVDGRFSDSSFTLLTNVPMTVEYLGDDVLGMQQSLRVYHLND"
FT   gene            766587..768173
FT                   /locus_tag="VEA_000659"
FT   CDS             766587..768173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000659"
FT                   /product="putative glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000659"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53345"
FT                   /db_xref="GOA:A7JZJ1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ1"
FT                   /protein_id="ACY53345.1"
FT                   /translation="MSNMTNAASHTAPIQDADYSAIHPPSLLKRLELTNPVFWLSGSFL
FT                   TLFVLLALTNTDSLTAMVNTGFGFATKYFGAYWQVLLLLNFLIGLALAFGRTGYVRLGG
FT                   LAKPDIDNFKWLSIVLCTLLAGGGVFWAAAEPIAHFVTAPPLYGEASPKTAAINALSQS
FT                   FMHWGFLAWAILGGLSSIVLMHLHYDKGLPLKPRTLLYPVFGDKAIKGWIGDVADACSI
FT                   IAVAAGTIGPIGFLGLQISYALNSLFGLPDTFVTQSMVIMAAILMYTLSALSGLSKGIQ
FT                   IVSRYNIILSVLLIGYILFFGPTSFIVDGYVQGVGRMVDNFFPMALYRGDTGWLSWWTV
FT                   FFWGWFIGYGPMMAIFIARISRGRTIRQLIMSISIAAPLITCFWFSIVGGSGLAFELDN
FT                   PGLISSAFEGFNLPAALLAITGELPYPMIISVLFLILTTTFIVTTGDSMTYTISVVMTG
FT                   STEPNAVIRSFWGLMMGIVAIALISMGSGGISALQSFIVITAVPVSFILLPSIWKAPGI
FT                   ASKMAKEQGLV"
FT   gene            complement(768236..768964)
FT                   /locus_tag="VEA_000660"
FT   CDS             complement(768236..768964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000660"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000660"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53346"
FT                   /db_xref="GOA:A7JZJ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZJ0"
FT                   /protein_id="ACY53346.1"
FT                   /translation="MRATGTGQFGTQLGKIRSSLKQQILSGIMSEGQKLPSERELSELF
FT                   STTRITIKDALVSLETEGLIYREERRGWYVSPERICYNPLSRSHFHQMIREQHRIAETK
FT                   LLNVRSEMAAGEYAKSLEVERITPIYVIERLRFIDGRAVLFVENVLKSALFEGILSENL
FT                   TMSLTGIYREKYGYETKRSRFDVIPTSAPAHVAKALNLAEGQPVLKIRRVNYKQDGKLM
FT                   DCEFEYWRPDAVIIRIDSVG"
FT   gene            769175..770242
FT                   /locus_tag="VEA_000661"
FT   CDS             769175..770242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000661"
FT                   /product="putative periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000661"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53347"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI9"
FT                   /protein_id="ACY53347.1"
FT                   /translation="MKTLLSRSITAPAAIIAVTLAAPTVAKEADIESLVTAAQKEGAVY
FT                   SVGMPDSWANWKDTWADLKSNYNLKHQDTDMSSAQEIAKFEAEKKNATADIGDVGFAFA
FT                   RVAVKKGVTQPYKPTTWNDIPDWAKDKDGHWALAYTGTISFISNNNLVKDAPKTWDDLL
FT                   QGDYKVTVGDVGVAAQANNAVLAAAFANGGDESNLKPALKFFSELAKQGRLSFTDPNIA
FT                   NLEKGEVEVAIMWDFNALNYRDKIDRDRFTVSIPQDGSVISGYTTIINKYAKNPNAAKL
FT                   AREYIFSDQGQINLAEGYARPIRTNITLPQAVQDKLIANDQYSNVHPVTDFSAWEKSAR
FT                   KLPRQWQESVLIHQQ"
FT   gene            770255..771079
FT                   /locus_tag="VEA_000662"
FT   CDS             770255..771079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000662"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53348"
FT                   /db_xref="GOA:A7JZI8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI8"
FT                   /protein_id="ACY53348.1"
FT                   /translation="MSNKVILVVLDGLNYQVARDCMGYLNGLLEQSRSQQETRATLYPV
FT                   QCELPSMSRPLYECILTGVRPVESGIVNNNIVRLSKHDSIFSLAKSQGKVTAAAAYHWV
FT                   SELYNRAPFEPVRDRFTHDETLNIQHGCFYHWDHYPDEALFLDAEYLRRSYQPDFLLIH
FT                   PMNIDDTGHKFGLDSRQYRNCARGADIILSNYIEQWLADGYQIIVTSDHGMNNDLSHGG
FT                   ILPEEREVPLFVIGDKFTHQDCHIKQTDICGTVCQLLNLDHTKPYTQELLAL"
FT   gene            771076..771966
FT                   /locus_tag="VEA_000663"
FT   CDS             771076..771966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000663"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000663"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53349"
FT                   /db_xref="GOA:A7JZI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI7"
FT                   /protein_id="ACY53349.1"
FT                   /translation="MSSSVLSPSSSESRSNLANTWLKRFKPAIWLVPFALFFYLFQLAP
FT                   MIWVLLNSFIYDGEFALDNYIEVLDSAFMMQAFGNSLWLAVWSSIFGLAIATLLVSSLR
FT                   RVDSKVRDGVIAFTNMSSNFAGVPLSFAFIIILGTNGAITLLLKQYGLLGDFDLYGKWG
FT                   LLAIYIYFQIPLAVLLLYPAFDALSDDWQAAAALLGAKTSQYWAKIALPVLSPALFGTF
FT                   IILIANAIGAYASVYALTSGNYNVITIRIASLVSGDLFLEPNLAAAISVILMALLAFIT
FT                   VINQWLISKSYAGRK"
FT   gene            771969..772757
FT                   /locus_tag="VEA_000664"
FT   CDS             771969..772757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000664"
FT                   /product="putative permease of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000664"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53350"
FT                   /db_xref="GOA:A7JZI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI6"
FT                   /protein_id="ACY53350.1"
FT                   /translation="MHNVNTRFHKTVVYSIVGIMLIPILATFVYSLSSRWGATVLPDGF
FT                   TFDWYVKLLTDPRFLQAFGRSLFICIASLTLSVLLVLPAIFVVFYYFPKLDKLMNVLIL
FT                   LPFAVPPVVSSVGLLQLYADSEISLIGTPWILIGTYFTIALPFMYRAISNSFEAINLND
FT                   LMDAAHLLGASTTKAFLMVILPNLKKGLMASLFLSFSFLLGEFVFANILVGTRYETLQI
FT                   YLYNMRQTSGHFTSALVMTYFLFIFLLTWLASRFSRGVKQ"
FT   gene            772754..773773
FT                   /locus_tag="VEA_000665"
FT   CDS             772754..773773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000665"
FT                   /product="spermidine putrescine transport ATP-binding
FT                   protein PotA"
FT                   /note="TC_3.A.1.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000665"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53351"
FT                   /db_xref="GOA:A7JZI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI5"
FT                   /protein_id="ACY53351.1"
FT                   /translation="MSYVTAKNLTKRFGDNTVFEDIHFNIEQGEFITLLGPSGCGKSTL
FT                   LRSLAGLNPVDGGEIWVNGEDITHQAPQERGIGMVFQSYALFPNMTVEGNIAFGLKMKK
FT                   LSNDDIRREVAKVIKLVDLAGKEKHYPHQLSGGQRQRVALARALVVKPRILLLDEPLSA
FT                   LDAKIRKHLRQQIRDIQKEMNLTTIFVTHDQEEAMIMSDRIFLMSKGEIVQAGTPEEIY
FT                   THPANEFVAGFMGHYNLVEANKAKQLFNIDTEWKVAIRPESIYVKEQGRQYDSHISAPQ
FT                   VGTITNHQLLGNVIRYQVNVEECELTVDLLNRSSERLLANGSQLELLFNLNEIQPVRA"
FT   gene            773776..774435
FT                   /locus_tag="VEA_000666"
FT   CDS             773776..774435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000666"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000666"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53352"
FT                   /db_xref="GOA:A7JZI4"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI4"
FT                   /protein_id="ACY53352.1"
FT                   /translation="MSKPLYVFDMDETLINADCAMIWNEFMVERGIATDPLFIKEDQRL
FT                   MALYSEGKMDMEDYLAFSMKPLENMPIEEVNALVEECVESHILAKQFPQAKTLIEQLSR
FT                   DGIDMVIISASVTFLVEAVGRRLNIPIALGIDLIEKDNRYTAEIDGVPSYREGKVTRLK
FT                   QWLKNQPEPYSEIHFYTDSINDLPLCEYADYTYLVNPCPRLKEHANRSHWTLLRWN"
FT   gene            complement(775078..775344)
FT                   /locus_tag="VEA_000667"
FT   CDS             complement(775078..775344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000667"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000667"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53353"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI2"
FT                   /protein_id="ACY53353.1"
FT                   /translation="MKSVFLSTLSLIVVMSSPIAAANTLDKEEWSSDLRQDFSEMKHEA
FT                   VADIQKMNMDAIHARDERIVKNIKDEQEQLVKVTCHKEKASKS"
FT   gene            complement(775686..778838)
FT                   /locus_tag="VEA_000668"
FT   CDS             complement(775686..778838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000668"
FT                   /product="RND multidrug efflux transporter"
FT                   /note="most likely function alternative not yet resolved;
FT                   acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000668"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53354"
FT                   /db_xref="GOA:A7JZI1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI1"
FT                   /protein_id="ACY53354.1"
FT                   /translation="MEDTKQKGLIAYFANNPVAANLLMVFIIIMGVVSFLFIQRQMFPN
FT                   IEVNYIDVRATYPGASPQEIEESILVKVEESIKDVTGIKKTVSTASRGSAYVSIEVDVN
FT                   ADIKRVLDDVNQRIDTLSNLPAGMEPINVYQVEWRQDVIEMGLVGDRPLEELKPIAKQV
FT                   EDELLQLKNVMLVYLSAPEEEIAIEVDPLVLRKYDLTLSDISSAISRYSANFSAGEVKT
FT                   NSGMIAVRIENQYYRGDEFRNIPVKLGANGAKVLLQDIATIKDGFTEEERYFEYSGQNA
FT                   IYMSVEATRDQNIIPVAESVRNYIEAKNKTLPQDVKLKVLVDTTYYLNGRLDMMLKNLL
FT                   QGAALVAIMLTIFLRFRLAMWVMIGLPVCFLGAVMMMPALGITVNIVSLFAFIMVLGIV
FT                   VDDAIVMGESAYSEIEEKGGGVENVVRGVKRVATPATFGVLTTIAVFAPFLLSSGIDSA
FT                   FFYGIAGVVILCLIFSLIESKLILPAHLAHTHFKPVKPGGWRDRFNQRFFGFVNGTYRN
FT                   FVTTCTHWRWTVFAVFCGLLLISAALVNANYVRVIPNPKVPTDYPAITIEMNDTVSSEQ
FT                   TISALKTIERVMQKIESETIAEHGQGMIRDVLSYNRSRTEGRVLVPLVDEELRPFNTFE
FT                   LARRWREAMPVIPGMKSIKIREQSAGGGDRDEFGYLLFGSNINELNEAGRYLIERLQQE
FT                   EGLYDISSSIDSGSKEVLLSLAPVAYDLGLDLTMIAEQVGGSFYGGEAQRLIRDGEEIK
FT                   VMVRYPQLTREAFSSLRYAVITTPAGKKVMLGDVVKINEQPGVSSIRREGGYQTVYVYG
FT                   SIDEELVEPQEAVKVIDDNILPDMKQVFPSVKTELGGDIEEQAAQRNEQILFFIAGMII
FT                   VYILLAVPLKSYTQPLIVMSVIPFSLTGAIWGHFWLGLDISMMSTFGLIAAAGVVINDS
FT                   LVMTDYVNQVREKGMNIKQAVVEAGCARFRAITLTSITTFAGVLPIMFETSLQARFVIP
FT                   MAVALGFAVLYATVLTLVLVPCLYLMLEDIKNIFRSIKGFVHRFINRFRKSPVTSSVEV
FT                   NT"
FT   gene            complement(778852..780009)
FT                   /locus_tag="VEA_000669"
FT   CDS             complement(778852..780009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000669"
FT                   /product="membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000669"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53355"
FT                   /db_xref="GOA:A7JZI0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZI0"
FT                   /protein_id="ACY53355.1"
FT                   /translation="MLAKPVLRWLLPFVVVGGSYAGYAAIAATAPEKESTKDAITEPTV
FT                   QASSLFPTDHKVVITSHGELVPFEKTHLSAQVSGEVISWHPNFVTGGIVKRGEVLFTIE
FT                   SDNYEASVLQAEANLASARASLIEEQAKAEVAKRQAKRLSDKQVTDLYLRKPHVLSAQA
FT                   QVKSAQAALKRAKRDLENCKVVAPYDALVVERDIGVGQFVTSGSRVATLNNIEVAEVHV
FT                   PIAGFDSAFLPESIGELTATVTQQGVFSTTREGRVVRDLGMIDSATRMINMVIQIADPY
FT                   GIDNQQPPIKFGSYVEVSFTGKELKHIYRLPQELVKNRTVWVVNGENQLQPRTVTVLRA
FT                   EGEFLLVGEGLEQSDKLVLTLPEYPQKGMAVQIAKKSDDSETVVQ"
FT   gene            780527..782044
FT                   /locus_tag="VEA_000670"
FT   CDS             780527..782044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000670"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000670"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53356"
FT                   /db_xref="GOA:D0M9T9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9T9"
FT                   /protein_id="ACY53356.1"
FT                   /translation="MLHTLAKLLFPSLFTILSACSSVSLNDPSEKSTSFQLGYQGDSVL
FT                   AQYFEAYGKDPKSITGFSPLNQGHDALLARTSLIESAQKSLDLQYYIYRGDETSQLITW
FT                   RLYEAAKRGVRVRLLLDDMQKRNDDVMAALNAHPNIEIRLFNPHQYRDSRWFALASDFE
FT                   RLNRRMHNKSLIADSVSAIVGGRNIGNEYFSFESQVEFGDFDLLLYGEAVQQTADQFDL
FT                   YWNSAYAIPMEWITPNSQQITDLAIQKQVDKLQLEEKFSTGRYDFTKLDMYQALKQGNL
FT                   KLYWGEAKVWFDLPDKVATRESQLIDNLTELVKSVEHSFVLISPYFVPTEVGTQALSNA
FT                   AKRGVDITIVTNSLASNDVFAVHGWYAKYRTDLLEAGVKLWEVKASAKLKSKWSLTGSS
FT                   RASLHAKAMTIDDKTLFVGSMNWDPRSAALNTEMAVVIEQPEYVQMFLEQLPNQLSNNA
FT                   YALTLRDGDIVWTDIKTGKEYDSEPEAGVWRKMGAWFSGILPIEDQL"
FT   gene            782134..782721
FT                   /locus_tag="VEA_000671"
FT   CDS             782134..782721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000671"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000671"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53357"
FT                   /db_xref="GOA:A7JZH8"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH8"
FT                   /protein_id="ACY53357.1"
FT                   /translation="MSAQWNEYYQKVLNQPHRPNVENAVNLLKLESKVALDIGCGIGRD
FT                   SHFLLEQGFNVHAFDSHEDAVKTCLTRFEGHKRFSISQCCFTEFDYPQCSLVIANASLF
FT                   FCPDEGFEQVWTKIDSALQPGGIFCGDFLGAKDSWVASEMHPNITALTKKEVESLFADY
FT                   ELISLNERDEDGTTVVGSPKHWHMFSVTARKR"
FT   gene            complement(782772..783242)
FT                   /locus_tag="VEA_000672"
FT   CDS             complement(782772..783242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000672"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53358"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH6"
FT                   /protein_id="ACY53358.1"
FT                   /translation="MDARAKDYLEQYLKLLSPEQRAAVPSVSADYYCADEYNANVCADL
FT                   VLIGQKIASCSMELWYREHGESMPQVGHLQVVTNWNGDPVCVIRITDVSTCKYEDVTAE
FT                   FAYAEGEGDRTLNWWRDAHTAFFKAECDELNIDWHEKRTLVLERFEVVYPVN"
FT   gene            783442..784287
FT                   /locus_tag="VEA_000673"
FT   CDS             783442..784287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000673"
FT                   /product="TPR repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000673"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53359"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH5"
FT                   /protein_id="ACY53359.1"
FT                   /translation="MRLFIGIFFSLILALPTMASDEKYSESDLLDRPLMERYILDELKA
FT                   LRQDYQSLEKRMITEITDRELTVADKSLNYANVTVTYFFYIIAGVASLIAFVGWQSLRE
FT                   FKHNTKEMADKRLEKIAQEYEKKFVALERDLKRKTRIISENNKEIEKINEIHNLWLRAQ
FT                   SSQTPEQRIEIYDEILLIRPGDLEALTYKADAAMEINEYHWALSICNRVLEVDYTNGPA
FT                   LYQRACAYSRLGIEEQAIEDLERAIEYSPSIRDLLAEERDLELLHGNERFEKLLHLANE
FT                   "
FT   gene            784301..784696
FT                   /locus_tag="VEA_000674"
FT   CDS             784301..784696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000674"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53360"
FT                   /db_xref="InterPro:IPR024464"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH4"
FT                   /protein_id="ACY53360.1"
FT                   /translation="MSSHFNLEDASQVLVGAFALAVPISFSEEAWRLGESLPMANLLML
FT                   LSLSVIFLSFFAYQSVFQSHIKNRVSIFIFRVVIAYLIAAVVVALVLFCLDKLPLMNEP
FT                   LVAIKRVIVITMPASMGAIVVDSFDKE"
FT   gene            complement(784706..785137)
FT                   /locus_tag="VEA_000675"
FT   CDS             complement(784706..785137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000675"
FT                   /product="redox-sensitive transcriptional activator soxR"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000675"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53361"
FT                   /db_xref="GOA:A7JZH3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH3"
FT                   /protein_id="ACY53361.1"
FT                   /translation="MEISVGEVAKRSGVKVSALHFYEQKGLISSWRNQGNQRRYHRSVL
FT                   RRVAVIKAAQQVGLSLEEIKHALDELPKHQAPNKDQWEVMASHWHEQLEQKIQKLKALQ
FT                   NDLGGCIGCGCLSLETCALRNPEDVLGKDHSGSNLTLEE"
FT   gene            785339..786547
FT                   /locus_tag="VEA_000676"
FT   CDS             785339..786547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000676"
FT                   /product="permease"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000676"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53362"
FT                   /db_xref="GOA:A7JZH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH2"
FT                   /protein_id="ACY53362.1"
FT                   /translation="MKNKTQPYLAGRLFDSISSGLFMMALPWVMLSEPNMGTFVALVSL
FT                   SCTAISFLATPFFSTLIDRHSRKVLLVLNQWIQSGMALVVFIAYWLGFESHWLLAFAQL
FT                   VYWVSSNFAWTTNNAFTQENYQHHEYAKISGQQEIVMQSTTLGAGALGIVLLEMWGMKE
FT                   FALFAASASALAAMFYILTPYTQQLRASKSVAFIAQLKESKQIFRLEPRFYGFILLSCL
FT                   SYPALTYLSKLVPIWFSEQGVSGDWFAGFNISFGFGSLLTGFIVTKVLSRASHSHIMFA
FT                   SMVMVSLAFIGMSFAISPLTILLFTALFGVFNALNRIARVNWMHHTVAVHQRGRVDGGI
FT                   SMFATTIQSLSYVLIAMLSHYELTQYGFAIAAVVMVLAVVLMGLLSRDVEPFNDLPLHA
FT                   AAK"
FT   gene            786702..787583
FT                   /locus_tag="VEA_000677"
FT   CDS             786702..787583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000677"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000677"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53363"
FT                   /db_xref="GOA:A7JZH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH1"
FT                   /protein_id="ACY53363.1"
FT                   /translation="MNLRQLEVFYAIMQAGTVSGAARLLHVSQPNVTRVLAHTEQQLGF
FT                   ALFERVKGRLVPTQEAKALLPEAEKVYQQLGQFRSLTNKVKQGTQHLRVGAPPVLAAHL
FT                   LAPTVALLSKQHGISFELLTANRDELCSGLLKHELDLAIAFGEETPPAIMGHVLLKEYL
FT                   TLIAPKSAAIPAEKTVILEELISHDLPIIGLDSRDPLGLLLHQTLSARDEHYQHAITVR
FT                   SYSAAAELVKHQAGFAIVDPWTAKQYRQDNAVSVHALEPNMSFSVSILFAEHTPQSIAT
FT                   KQFITALKQQMV"
FT   gene            787685..788689
FT                   /locus_tag="VEA_000678"
FT   CDS             787685..788689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000678"
FT                   /product="EBNA-1 nuclear protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000678"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53364"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZH0"
FT                   /protein_id="ACY53364.1"
FT                   /translation="MQIAQPYLLFLGDVTDPLAAKTARGIYQWRPEICLGQIRLTPETV
FT                   SLGLTDMTLQQAQQQGAKTLVLGTANPGGVIPEAWQATLLEAAEMGFEIASGMHQRLAE
FT                   FAPLADLEQRGLTKLNDVRHYDAPLKVGNGKARAGKRVLTVGTDCSVGKMYSALAIEHA
FT                   LKRKNCRAEFKATGQTGILIAGSGISIDAVVADFISGAVEAISPDFTDHDWDIIEGQGS
FT                   LFNPSFAGVSLGLLHGAQADALVLCHEIGRPHIRNLPHASLPTIEQTIEANLAAARLTN
FT                   PNAQLVGICLNTSAISEEDAAQLFQDWSDKYQVPVTDPVRFGVDAVADWLLTI"
FT   gene            788740..789732
FT                   /locus_tag="VEA_000679"
FT   CDS             788740..789732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000679"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000679"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53365"
FT                   /db_xref="GOA:A7JZG9"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG9"
FT                   /protein_id="ACY53365.1"
FT                   /translation="MKIHVEPVTIAMATPFRISRGSRTECHVVLVTIEHLGMLAQGECT
FT                   PYPRYGESVESVIKAISHAAHELQSLYAKGDADVMTLKSQLQSLLPAGAARNALDCALW
FT                   HLLALLSHKQQVHDLFTLPEAIVTAMTVSIDTPQAMAKQAQAYLSQGAKLLKVKLDGEN
FT                   VIERVAAVRDAAPHVQIVLDANEAWQNLDLATVFDQLEPFNIIMIEQPLPQDRDDVLAS
FT                   IPHPIPLCADESCHTREQLHQLLGKYEMVNIKLDKTGGLSEALLLADDAKKLGFSLMSG
FT                   CMLGTSLAMRAALPIAAQASVVDLDGPVLLGQDITPSLVYRDGEIVLSK"
FT   gene            790026..792050
FT                   /locus_tag="VEA_000680"
FT   CDS             790026..792050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000680"
FT                   /product="translation elongation factor G-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000680"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53366"
FT                   /db_xref="GOA:A7JZG8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG8"
FT                   /protein_id="ACY53366.1"
FT                   /translation="MPINKIRNIAFVGQTGTGKTTLIEKLLFTCDATHHLGSVEKGDTV
FT                   TDFDPQSIQYQHSIEATPVALRWNKHRLNIIDTPGQNELLGRTISVFPAVETSALVIDP
FT                   QTPLNQTSDRLFTFAKEQQKCQMIIINKLDNHGSQLERLMENIVEHFGDHCLPINLPSA
FT                   DGESVVDCYFEPELGRETLLATVDEAHETLIDQVIEVDEELMELYLEQGSELTAEQLHD
FT                   PFEEALRTGHVIPVCFVSAQTGAGVELLLRTLAEIMPMPNEGNPPLLEKNGKKIKVNCE
FT                   TLEHTVAHVYKVSVDPYMGKLAYLRVYQGEINAGSQLYIGESNKAFKVGHLYQLQGKDR
FT                   TEIPRALAGDFCVLAKVDDLEFDSIVHDSHEEDGVQLKTLDLPDSMYSLCLKPLKRGDE
FT                   QKLGDVLNKIASEDPSLRIEHRARTNETIISGQGEFHLKVALEKMANVYKLDVETCQPS
FT                   VEYFETITKPAEGHYRHKKQSGGAGQFGEVQLKVRPLERGAGFKFINKVVGGAIPTALI
FT                   PAVEKGILQALEEGAISGNPIKDVEVTVYDGKYHSVDSKEIAFVIAGKKAFLDAINNAD
FT                   PIVLEPIVQMELHVPTTNVGDVSGDLSGNRGLIEGTEPIDSQFTLLKAKSPVNELQDYA
FT                   RRLRAITGGEGSFSMTLSHYEPAPPAVQKQVCQGSAQQG"
FT   gene            complement(792122..792316)
FT                   /locus_tag="VEA_000681"
FT   CDS             complement(792122..792316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000681"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53367"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG7"
FT                   /protein_id="ACY53367.1"
FT                   /translation="MAVIKQDIPNRVTVYHDNVDQEQELKNAMLPEKPRYFNGAPTYKA
FT                   NSIEEFENKISQIGLSLDK"
FT   gene            792527..793321
FT                   /locus_tag="VEA_000682"
FT   CDS             792527..793321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000682"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53368"
FT                   /db_xref="GOA:A7JZG6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG6"
FT                   /protein_id="ACY53368.1"
FT                   /translation="MSRQELNQMGSAKVYLVEKHGISFIEKQQVEQVEVAFYQHQAKPF
FT                   NELGILVPELIDYDHQQNTLRIEYIPHSVNQEFLLEEPRVIEQLAKIHRLSPTSNGVYH
FT                   PHQWAQPATSQALSTLKLDAKTERFFYQLQEQSGPLFNAKNLISGDTNAGNWGRRDNGD
FT                   LVLFDWERFSTGHIAIDLAPLVKGMGTLEDYLGVAHTYTKTAKQGDVSNLARTIAIAKT
FT                   WMVVEVVNILVSRQNPQTSKYIDWFKQTLPKWAKDLSAQMTN"
FT   gene            complement(793299..793508)
FT                   /locus_tag="VEA_000683"
FT   CDS             complement(793299..793508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000683"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53369"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG5"
FT                   /protein_id="ACY53369.1"
FT                   /translation="MVWLFTFLGFLAIILLMSLGVIFHNKRIQGSCGGLNNVGVDKVCN
FT                   CETSCAEPERRLYQISEPNSSSER"
FT   gene            complement(793510..794025)
FT                   /locus_tag="VEA_000684"
FT   CDS             complement(793510..794025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000684"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53370"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG4"
FT                   /protein_id="ACY53370.1"
FT                   /translation="MIYAIPNDGERVANHFVKAPYIAIYSDTDGMLKNLANIASMPQAG
FT                   CNAKSQLIQSLQEYNVDAVLVRNIGERALAKLLRSGTQVFRLSTRSSLEDVLAVPREPL
FT                   IEPSQGRPSNNHKKSAHKSKGGCGSCGCGGKKSKPSLLTRPKAPTGLLKVTSRPAILRL
FT                   KTMANKAG"
FT   gene            complement(794022..794312)
FT                   /locus_tag="VEA_000685"
FT   CDS             complement(794022..794312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000685"
FT                   /product="HTH DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000685"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53371"
FT                   /db_xref="GOA:A7JZG3"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG3"
FT                   /protein_id="ACY53371.1"
FT                   /translation="MARPKIERRICGRAAHHCFKPNGVPFHQLEQVAILPEELEALRLA
FT                   DLEGLSQQQAAEQMGVSRQTFGNTVKSARLKVAKSLVEGHALVFPDEESNL"
FT   gene            794815..795714
FT                   /locus_tag="VEA_000686"
FT   CDS             794815..795714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000686"
FT                   /product="L-proline Glycine Betaine ABC transport system
FT                   permease protein proW"
FT                   /note="TC 3.A.1.12.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000686"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53372"
FT                   /db_xref="GOA:A7JZG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG2"
FT                   /protein_id="ACY53372.1"
FT                   /translation="MSDSNWLSEFPEMDRSDLRAIRKTLDGAYRDFSREYGELIESLFD
FT                   PLLSFLVWFEKLLISTPWVVVLGVCTALVYAASRSWKLAIACFGSLILIGYFGMWEDTM
FT                   RTLSIITVCTMLAITLGIPIGIAMASSNRIQSVVTPLLDVMQTMPAFVYLIPVVMLLGI
FT                   GKIPGLIAVVIYAIPPVIRLTNLGIRLVDKEVLEAATAFGASSKQRLFGVQLPLAMPTI
FT                   MAGINQTIMMALSMVVIASMIGVKGLGQPVLKSITNQYFTLGLLNGLAIVALAILFDRA
FT                   SQAYAKRTQAHLGDLKHD"
FT   gene            795707..796936
FT                   /locus_tag="VEA_000687"
FT   CDS             795707..796936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000687"
FT                   /product="L-proline Glycine Betaine ABC transport
FT                   ATP-binding protein proV"
FT                   /note="TC 3.A.1.12.1"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000687"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53373"
FT                   /db_xref="GOA:A7JZG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7JZG1"
FT                   /protein_id="ACY53373.1"
FT                   /translation="MTSPLIEISGLYKIFGPKPNSVIERVKLGHSKEHVLAETGHTVGL
FT                   KDINLQIKKGEIFVIMGLSGSGKSTMIRHFNRLIDPTMGQILVEGVDVMQLSNKELEQF
FT                   RRHKMSMVFQRFGLLPHRTVIDNIAYGLEIQGISKEARLSKANEWLDTVGLTGYENQYP
FT                   AQLSGGQQQRVGLARALATNAEILLMDEAFSALDPLIRSEMQDQLIELQQQLHKTIVFI
FT                   THDLDEALRLGDRIAILKDGELVQQGSPDEILLHPADEYVEAFVKDVNRARALTVETVM
FT                   QPPSYRIAAKTIEEALSEMKRVKRDYAYHVTDSGYQGVITQQGLLDATKLAQTPSWDDD
FT                   IYEEVPIISPHSAIEQILTETMSCEYSLPVVDEHGHLKGELERRTVAGLFADEDSTKRS
FT                   TSRSNIDKAS"
FT   gene            797193..797729
FT                   /locus_tag="VEA_000688"
FT   CDS             797193..797729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000688"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000688"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53374"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9V7"
FT                   /protein_id="ACY53374.1"
FT                   /translation="MKKTMLALTGAVIILAGCQDEKPAETSAVEVPQATETEVTTSAEV
FT                   TTETIDTLPVAEEQVITEETFVDSEHNAQNALDWNGTYKGTLPCADCSGIDMIITLNQD
FT                   GTYVLEESYQDKEDGQSKSEGQFTWDANGSIVTLTNEDAPNQYFVGENVLMKLDMNGEK
FT                   VTGDLAPLYNLTKQQ"
FT   gene            797948..798724
FT                   /locus_tag="VEA_000689"
FT   CDS             797948..798724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="VEA_000689"
FT                   /product="outer membrane protein OmpV"
FT                   /db_xref="EnsemblGenomes-Gn:VEA_000689"
FT                   /db_xref="EnsemblGenomes-Tr:ACY53375"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="UniProtKB/TrEMBL:D0M9V8"
FT                   /protein_id="ACY53375.1"
FT                   /translation="MKKTLIALLTLTAAASAVAGDTYIRNGNIYNNEGGWNAEVGVAHG
FT                   SDLFKDQKYNTAPILNGGYHGDDFNADLSGINYRFFGNTNELINMSAYLVGSGVMRDGD
FT                   IAKSLKGTDKRRFAVDLGLNTDFTLDQHNVISTYLQHDISGAYKGYLAGATYFHIMNFG
FT