spacer

EBI Dbfetch

ID   CP000961; SV 1; circular; genomic DNA; STD; PRO; 5935403 BP.
XX
AC   CP000961; AAUO01000000-AAUO01000105;
XX
PR   Project:PRJNA17455;
XX
DT   14-MAR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Shewanella woodyi ATCC 51908, complete genome.
XX
KW   .
XX
OS   Shewanella woodyi ATCC 51908
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-5935403
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Lykidis A., Zhao J.-S., Richardson P.;
RT   "Complete sequence of Shewanella woodyi ATCC 51908";
RL   Unpublished.
XX
RN   [2]
RP   1-5935403
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Lykidis A., Zhao J.-S., Richardson P.;
RT   ;
RL   Submitted (27-FEB-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; ac2dcef4ba4078c6cd6059fa6d430a1f.
DR   BioSample; SAMN02598391.
DR   EnsemblGenomes-Gn; Swoo_R0001.
DR   EnsemblGenomes-Gn; Swoo_R0002.
DR   EnsemblGenomes-Gn; Swoo_R0003.
DR   EnsemblGenomes-Gn; Swoo_R0004.
DR   EnsemblGenomes-Gn; Swoo_R0007.
DR   EnsemblGenomes-Gn; Swoo_R0008.
DR   EnsemblGenomes-Gn; Swoo_R0009.
DR   EnsemblGenomes-Gn; Swoo_R0010.
DR   EnsemblGenomes-Gn; Swoo_R0011.
DR   EnsemblGenomes-Gn; Swoo_R0012.
DR   EnsemblGenomes-Gn; Swoo_R0013.
DR   EnsemblGenomes-Gn; Swoo_R0014.
DR   EnsemblGenomes-Gn; Swoo_R0015.
DR   EnsemblGenomes-Gn; Swoo_R0016.
DR   EnsemblGenomes-Gn; Swoo_R0017.
DR   EnsemblGenomes-Gn; Swoo_R0018.
DR   EnsemblGenomes-Gn; Swoo_R0019.
DR   EnsemblGenomes-Gn; Swoo_R0020.
DR   EnsemblGenomes-Gn; Swoo_R0021.
DR   EnsemblGenomes-Gn; Swoo_R0022.
DR   EnsemblGenomes-Gn; Swoo_R0023.
DR   EnsemblGenomes-Gn; Swoo_R0024.
DR   EnsemblGenomes-Gn; Swoo_R0025.
DR   EnsemblGenomes-Gn; Swoo_R0026.
DR   EnsemblGenomes-Gn; Swoo_R0027.
DR   EnsemblGenomes-Gn; Swoo_R0028.
DR   EnsemblGenomes-Gn; Swoo_R0029.
DR   EnsemblGenomes-Gn; Swoo_R0030.
DR   EnsemblGenomes-Gn; Swoo_R0031.
DR   EnsemblGenomes-Gn; Swoo_R0032.
DR   EnsemblGenomes-Gn; Swoo_R0033.
DR   EnsemblGenomes-Gn; Swoo_R0034.
DR   EnsemblGenomes-Gn; Swoo_R0035.
DR   EnsemblGenomes-Gn; Swoo_R0036.
DR   EnsemblGenomes-Gn; Swoo_R0037.
DR   EnsemblGenomes-Gn; Swoo_R0038.
DR   EnsemblGenomes-Gn; Swoo_R0039.
DR   EnsemblGenomes-Gn; Swoo_R0040.
DR   EnsemblGenomes-Gn; Swoo_R0041.
DR   EnsemblGenomes-Gn; Swoo_R0042.
DR   EnsemblGenomes-Gn; Swoo_R0043.
DR   EnsemblGenomes-Gn; Swoo_R0044.
DR   EnsemblGenomes-Gn; Swoo_R0045.
DR   EnsemblGenomes-Gn; Swoo_R0046.
DR   EnsemblGenomes-Gn; Swoo_R0047.
DR   EnsemblGenomes-Gn; Swoo_R0048.
DR   EnsemblGenomes-Gn; Swoo_R0049.
DR   EnsemblGenomes-Gn; Swoo_R0050.
DR   EnsemblGenomes-Gn; Swoo_R0051.
DR   EnsemblGenomes-Gn; Swoo_R0052.
DR   EnsemblGenomes-Gn; Swoo_R0053.
DR   EnsemblGenomes-Gn; Swoo_R0054.
DR   EnsemblGenomes-Gn; Swoo_R0055.
DR   EnsemblGenomes-Gn; Swoo_R0056.
DR   EnsemblGenomes-Gn; Swoo_R0057.
DR   EnsemblGenomes-Gn; Swoo_R0058.
DR   EnsemblGenomes-Gn; Swoo_R0059.
DR   EnsemblGenomes-Gn; Swoo_R0060.
DR   EnsemblGenomes-Gn; Swoo_R0061.
DR   EnsemblGenomes-Gn; Swoo_R0062.
DR   EnsemblGenomes-Gn; Swoo_R0063.
DR   EnsemblGenomes-Gn; Swoo_R0064.
DR   EnsemblGenomes-Gn; Swoo_R0065.
DR   EnsemblGenomes-Gn; Swoo_R0066.
DR   EnsemblGenomes-Gn; Swoo_R0067.
DR   EnsemblGenomes-Gn; Swoo_R0068.
DR   EnsemblGenomes-Gn; Swoo_R0069.
DR   EnsemblGenomes-Gn; Swoo_R0070.
DR   EnsemblGenomes-Gn; Swoo_R0071.
DR   EnsemblGenomes-Gn; Swoo_R0072.
DR   EnsemblGenomes-Gn; Swoo_R0073.
DR   EnsemblGenomes-Gn; Swoo_R0074.
DR   EnsemblGenomes-Gn; Swoo_R0075.
DR   EnsemblGenomes-Gn; Swoo_R0076.
DR   EnsemblGenomes-Gn; Swoo_R0077.
DR   EnsemblGenomes-Gn; Swoo_R0078.
DR   EnsemblGenomes-Gn; Swoo_R0079.
DR   EnsemblGenomes-Gn; Swoo_R0080.
DR   EnsemblGenomes-Gn; Swoo_R0081.
DR   EnsemblGenomes-Gn; Swoo_R0082.
DR   EnsemblGenomes-Gn; Swoo_R0083.
DR   EnsemblGenomes-Gn; Swoo_R0084.
DR   EnsemblGenomes-Gn; Swoo_R0085.
DR   EnsemblGenomes-Gn; Swoo_R0086.
DR   EnsemblGenomes-Gn; Swoo_R0087.
DR   EnsemblGenomes-Gn; Swoo_R0088.
DR   EnsemblGenomes-Gn; Swoo_R0089.
DR   EnsemblGenomes-Gn; Swoo_R0090.
DR   EnsemblGenomes-Gn; Swoo_R0091.
DR   EnsemblGenomes-Gn; Swoo_R0092.
DR   EnsemblGenomes-Gn; Swoo_R0093.
DR   EnsemblGenomes-Gn; Swoo_R0094.
DR   EnsemblGenomes-Gn; Swoo_R0095.
DR   EnsemblGenomes-Gn; Swoo_R0096.
DR   EnsemblGenomes-Gn; Swoo_R0097.
DR   EnsemblGenomes-Gn; Swoo_R0098.
DR   EnsemblGenomes-Gn; Swoo_R0099.
DR   EnsemblGenomes-Gn; Swoo_R0100.
DR   EnsemblGenomes-Gn; Swoo_R0101.
DR   EnsemblGenomes-Gn; Swoo_R0102.
DR   EnsemblGenomes-Gn; Swoo_R0103.
DR   EnsemblGenomes-Gn; Swoo_R0106.
DR   EnsemblGenomes-Gn; Swoo_R0107.
DR   EnsemblGenomes-Gn; Swoo_R0108.
DR   EnsemblGenomes-Gn; Swoo_R0109.
DR   EnsemblGenomes-Gn; Swoo_R0110.
DR   EnsemblGenomes-Gn; Swoo_R0111.
DR   EnsemblGenomes-Gn; Swoo_R0112.
DR   EnsemblGenomes-Gn; Swoo_R0113.
DR   EnsemblGenomes-Gn; Swoo_R0114.
DR   EnsemblGenomes-Gn; Swoo_R0115.
DR   EnsemblGenomes-Gn; Swoo_R0116.
DR   EnsemblGenomes-Gn; Swoo_R0117.
DR   EnsemblGenomes-Gn; Swoo_R0118.
DR   EnsemblGenomes-Gn; Swoo_R0119.
DR   EnsemblGenomes-Gn; Swoo_R0120.
DR   EnsemblGenomes-Gn; Swoo_R0121.
DR   EnsemblGenomes-Gn; Swoo_R0122.
DR   EnsemblGenomes-Gn; Swoo_R0123.
DR   EnsemblGenomes-Gn; Swoo_R0124.
DR   EnsemblGenomes-Gn; Swoo_R0125.
DR   EnsemblGenomes-Gn; Swoo_R0126.
DR   EnsemblGenomes-Gn; Swoo_R0127.
DR   EnsemblGenomes-Gn; Swoo_R0128.
DR   EnsemblGenomes-Gn; Swoo_R0129.
DR   EnsemblGenomes-Gn; Swoo_R0130.
DR   EnsemblGenomes-Gn; Swoo_R0131.
DR   EnsemblGenomes-Gn; Swoo_R0132.
DR   EnsemblGenomes-Gn; Swoo_R0133.
DR   EnsemblGenomes-Gn; Swoo_R0134.
DR   EnsemblGenomes-Gn; Swoo_R0135.
DR   EnsemblGenomes-Gn; Swoo_R0136.
DR   EnsemblGenomes-Gn; Swoo_R0137.
DR   EnsemblGenomes-Gn; Swoo_R0138.
DR   EnsemblGenomes-Gn; Swoo_R0139.
DR   EnsemblGenomes-Gn; Swoo_R0140.
DR   EnsemblGenomes-Gn; Swoo_R0141.
DR   EnsemblGenomes-Gn; Swoo_R0142.
DR   EnsemblGenomes-Gn; Swoo_R0143.
DR   EnsemblGenomes-Gn; Swoo_R0144.
DR   EnsemblGenomes-Gn; Swoo_R0145.
DR   EnsemblGenomes-Gn; Swoo_R0146.
DR   EnsemblGenomes-Gn; Swoo_R0147.
DR   EnsemblGenomes-Gn; Swoo_R0148.
DR   EnsemblGenomes-Gn; Swoo_R0149.
DR   EnsemblGenomes-Gn; Swoo_R0150.
DR   EnsemblGenomes-Gn; Swoo_R0151.
DR   EnsemblGenomes-Gn; Swoo_R0152.
DR   EnsemblGenomes-Gn; Swoo_R0153.
DR   EnsemblGenomes-Gn; Swoo_R0154.
DR   EnsemblGenomes-Gn; Swoo_R0155.
DR   EnsemblGenomes-Gn; Swoo_R0156.
DR   EnsemblGenomes-Gn; Swoo_R0157.
DR   EnsemblGenomes-Gn; Swoo_R0158.
DR   EnsemblGenomes-Gn; Swoo_R0159.
DR   EnsemblGenomes-Gn; Swoo_R0160.
DR   EnsemblGenomes-Gn; Swoo_R0161.
DR   EnsemblGenomes-Gn; Swoo_R0162.
DR   EnsemblGenomes-Gn; Swoo_R0163.
DR   EnsemblGenomes-Gn; Swoo_R0164.
DR   EnsemblGenomes-Gn; Swoo_R0165.
DR   EnsemblGenomes-Tr; Swoo_R0001.
DR   EnsemblGenomes-Tr; Swoo_R0002.
DR   EnsemblGenomes-Tr; Swoo_R0003.
DR   EnsemblGenomes-Tr; Swoo_R0004.
DR   EnsemblGenomes-Tr; Swoo_R0007.
DR   EnsemblGenomes-Tr; Swoo_R0008.
DR   EnsemblGenomes-Tr; Swoo_R0009.
DR   EnsemblGenomes-Tr; Swoo_R0010.
DR   EnsemblGenomes-Tr; Swoo_R0011.
DR   EnsemblGenomes-Tr; Swoo_R0012.
DR   EnsemblGenomes-Tr; Swoo_R0013.
DR   EnsemblGenomes-Tr; Swoo_R0014.
DR   EnsemblGenomes-Tr; Swoo_R0015.
DR   EnsemblGenomes-Tr; Swoo_R0016.
DR   EnsemblGenomes-Tr; Swoo_R0017.
DR   EnsemblGenomes-Tr; Swoo_R0018.
DR   EnsemblGenomes-Tr; Swoo_R0019.
DR   EnsemblGenomes-Tr; Swoo_R0020.
DR   EnsemblGenomes-Tr; Swoo_R0021.
DR   EnsemblGenomes-Tr; Swoo_R0022.
DR   EnsemblGenomes-Tr; Swoo_R0023.
DR   EnsemblGenomes-Tr; Swoo_R0024.
DR   EnsemblGenomes-Tr; Swoo_R0025.
DR   EnsemblGenomes-Tr; Swoo_R0026.
DR   EnsemblGenomes-Tr; Swoo_R0027.
DR   EnsemblGenomes-Tr; Swoo_R0028.
DR   EnsemblGenomes-Tr; Swoo_R0029.
DR   EnsemblGenomes-Tr; Swoo_R0030.
DR   EnsemblGenomes-Tr; Swoo_R0031.
DR   EnsemblGenomes-Tr; Swoo_R0032.
DR   EnsemblGenomes-Tr; Swoo_R0033.
DR   EnsemblGenomes-Tr; Swoo_R0034.
DR   EnsemblGenomes-Tr; Swoo_R0035.
DR   EnsemblGenomes-Tr; Swoo_R0036.
DR   EnsemblGenomes-Tr; Swoo_R0037.
DR   EnsemblGenomes-Tr; Swoo_R0038.
DR   EnsemblGenomes-Tr; Swoo_R0039.
DR   EnsemblGenomes-Tr; Swoo_R0040.
DR   EnsemblGenomes-Tr; Swoo_R0041.
DR   EnsemblGenomes-Tr; Swoo_R0042.
DR   EnsemblGenomes-Tr; Swoo_R0043.
DR   EnsemblGenomes-Tr; Swoo_R0044.
DR   EnsemblGenomes-Tr; Swoo_R0045.
DR   EnsemblGenomes-Tr; Swoo_R0046.
DR   EnsemblGenomes-Tr; Swoo_R0047.
DR   EnsemblGenomes-Tr; Swoo_R0048.
DR   EnsemblGenomes-Tr; Swoo_R0049.
DR   EnsemblGenomes-Tr; Swoo_R0050.
DR   EnsemblGenomes-Tr; Swoo_R0051.
DR   EnsemblGenomes-Tr; Swoo_R0052.
DR   EnsemblGenomes-Tr; Swoo_R0053.
DR   EnsemblGenomes-Tr; Swoo_R0054.
DR   EnsemblGenomes-Tr; Swoo_R0055.
DR   EnsemblGenomes-Tr; Swoo_R0056.
DR   EnsemblGenomes-Tr; Swoo_R0057.
DR   EnsemblGenomes-Tr; Swoo_R0058.
DR   EnsemblGenomes-Tr; Swoo_R0059.
DR   EnsemblGenomes-Tr; Swoo_R0060.
DR   EnsemblGenomes-Tr; Swoo_R0061.
DR   EnsemblGenomes-Tr; Swoo_R0062.
DR   EnsemblGenomes-Tr; Swoo_R0063.
DR   EnsemblGenomes-Tr; Swoo_R0064.
DR   EnsemblGenomes-Tr; Swoo_R0065.
DR   EnsemblGenomes-Tr; Swoo_R0066.
DR   EnsemblGenomes-Tr; Swoo_R0067.
DR   EnsemblGenomes-Tr; Swoo_R0068.
DR   EnsemblGenomes-Tr; Swoo_R0069.
DR   EnsemblGenomes-Tr; Swoo_R0070.
DR   EnsemblGenomes-Tr; Swoo_R0071.
DR   EnsemblGenomes-Tr; Swoo_R0072.
DR   EnsemblGenomes-Tr; Swoo_R0073.
DR   EnsemblGenomes-Tr; Swoo_R0074.
DR   EnsemblGenomes-Tr; Swoo_R0075.
DR   EnsemblGenomes-Tr; Swoo_R0076.
DR   EnsemblGenomes-Tr; Swoo_R0077.
DR   EnsemblGenomes-Tr; Swoo_R0078.
DR   EnsemblGenomes-Tr; Swoo_R0079.
DR   EnsemblGenomes-Tr; Swoo_R0080.
DR   EnsemblGenomes-Tr; Swoo_R0081.
DR   EnsemblGenomes-Tr; Swoo_R0082.
DR   EnsemblGenomes-Tr; Swoo_R0083.
DR   EnsemblGenomes-Tr; Swoo_R0084.
DR   EnsemblGenomes-Tr; Swoo_R0085.
DR   EnsemblGenomes-Tr; Swoo_R0086.
DR   EnsemblGenomes-Tr; Swoo_R0087.
DR   EnsemblGenomes-Tr; Swoo_R0088.
DR   EnsemblGenomes-Tr; Swoo_R0089.
DR   EnsemblGenomes-Tr; Swoo_R0090.
DR   EnsemblGenomes-Tr; Swoo_R0091.
DR   EnsemblGenomes-Tr; Swoo_R0092.
DR   EnsemblGenomes-Tr; Swoo_R0093.
DR   EnsemblGenomes-Tr; Swoo_R0094.
DR   EnsemblGenomes-Tr; Swoo_R0095.
DR   EnsemblGenomes-Tr; Swoo_R0096.
DR   EnsemblGenomes-Tr; Swoo_R0097.
DR   EnsemblGenomes-Tr; Swoo_R0098.
DR   EnsemblGenomes-Tr; Swoo_R0099.
DR   EnsemblGenomes-Tr; Swoo_R0100.
DR   EnsemblGenomes-Tr; Swoo_R0101.
DR   EnsemblGenomes-Tr; Swoo_R0102.
DR   EnsemblGenomes-Tr; Swoo_R0103.
DR   EnsemblGenomes-Tr; Swoo_R0106.
DR   EnsemblGenomes-Tr; Swoo_R0107.
DR   EnsemblGenomes-Tr; Swoo_R0108.
DR   EnsemblGenomes-Tr; Swoo_R0109.
DR   EnsemblGenomes-Tr; Swoo_R0110.
DR   EnsemblGenomes-Tr; Swoo_R0111.
DR   EnsemblGenomes-Tr; Swoo_R0112.
DR   EnsemblGenomes-Tr; Swoo_R0113.
DR   EnsemblGenomes-Tr; Swoo_R0114.
DR   EnsemblGenomes-Tr; Swoo_R0115.
DR   EnsemblGenomes-Tr; Swoo_R0116.
DR   EnsemblGenomes-Tr; Swoo_R0117.
DR   EnsemblGenomes-Tr; Swoo_R0118.
DR   EnsemblGenomes-Tr; Swoo_R0119.
DR   EnsemblGenomes-Tr; Swoo_R0120.
DR   EnsemblGenomes-Tr; Swoo_R0121.
DR   EnsemblGenomes-Tr; Swoo_R0122.
DR   EnsemblGenomes-Tr; Swoo_R0123.
DR   EnsemblGenomes-Tr; Swoo_R0124.
DR   EnsemblGenomes-Tr; Swoo_R0125.
DR   EnsemblGenomes-Tr; Swoo_R0126.
DR   EnsemblGenomes-Tr; Swoo_R0127.
DR   EnsemblGenomes-Tr; Swoo_R0128.
DR   EnsemblGenomes-Tr; Swoo_R0129.
DR   EnsemblGenomes-Tr; Swoo_R0130.
DR   EnsemblGenomes-Tr; Swoo_R0131.
DR   EnsemblGenomes-Tr; Swoo_R0132.
DR   EnsemblGenomes-Tr; Swoo_R0133.
DR   EnsemblGenomes-Tr; Swoo_R0134.
DR   EnsemblGenomes-Tr; Swoo_R0135.
DR   EnsemblGenomes-Tr; Swoo_R0136.
DR   EnsemblGenomes-Tr; Swoo_R0137.
DR   EnsemblGenomes-Tr; Swoo_R0138.
DR   EnsemblGenomes-Tr; Swoo_R0139.
DR   EnsemblGenomes-Tr; Swoo_R0140.
DR   EnsemblGenomes-Tr; Swoo_R0141.
DR   EnsemblGenomes-Tr; Swoo_R0142.
DR   EnsemblGenomes-Tr; Swoo_R0143.
DR   EnsemblGenomes-Tr; Swoo_R0144.
DR   EnsemblGenomes-Tr; Swoo_R0145.
DR   EnsemblGenomes-Tr; Swoo_R0146.
DR   EnsemblGenomes-Tr; Swoo_R0147.
DR   EnsemblGenomes-Tr; Swoo_R0148.
DR   EnsemblGenomes-Tr; Swoo_R0149.
DR   EnsemblGenomes-Tr; Swoo_R0150.
DR   EnsemblGenomes-Tr; Swoo_R0151.
DR   EnsemblGenomes-Tr; Swoo_R0152.
DR   EnsemblGenomes-Tr; Swoo_R0153.
DR   EnsemblGenomes-Tr; Swoo_R0154.
DR   EnsemblGenomes-Tr; Swoo_R0155.
DR   EnsemblGenomes-Tr; Swoo_R0156.
DR   EnsemblGenomes-Tr; Swoo_R0157.
DR   EnsemblGenomes-Tr; Swoo_R0158.
DR   EnsemblGenomes-Tr; Swoo_R0159.
DR   EnsemblGenomes-Tr; Swoo_R0160.
DR   EnsemblGenomes-Tr; Swoo_R0161.
DR   EnsemblGenomes-Tr; Swoo_R0162.
DR   EnsemblGenomes-Tr; Swoo_R0163.
DR   EnsemblGenomes-Tr; Swoo_R0164.
DR   EnsemblGenomes-Tr; Swoo_R0165.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000961.
DR   SILVA-SSU; CP000961.
DR   StrainInfo; 116357; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002759
CC   Source DNA and bacteria available from Jian-Shen Zhao
CC   (Jian-Shen.Zhao@cnrc-nrc.gc.ca)
CC   Contacts: Jian-Shen Zhao (Jian-Shen.Zhao@cnrc-nrc.gc.ca)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5935403
FT                   /organism="Shewanella woodyi ATCC 51908"
FT                   /strain="ATCC 51908"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:392500"
FT   gene            397..1785
FT                   /locus_tag="Swoo_0001"
FT   CDS             397..1785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: sse:Ssed_0006 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84302"
FT                   /db_xref="GOA:B1KCX3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="ACA84302.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAEMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSRPSAPKPIQATAAVVKPKLESSPQ
FT                   KSQTSFNVNAPEPAATANHRSNINPTYQFENFVEGKSNQLGKAAALQVAENPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIIKNKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVA
FT                   RPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLIR
FT                   TLSS"
FT   gene            1805..2905
FT                   /locus_tag="Swoo_0002"
FT   CDS             1805..2905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sse:Ssed_0007 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84303"
FT                   /db_xref="GOA:B1KCX4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCX4"
FT                   /protein_id="ACA84303.1"
FT                   /translation="MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGQVQLEGEVQEGRTTIPAKKFLDIVKSLPDQVELKIEQQENRLLLRSGRS
FT                   RFTLATLPAEEYPNVEAFQAEIEFTINQGTLKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRQIQDTLPEKQVIVPRKGVVELQRLFEGEELDITIAIGDNA
FT                   IRATTASAVFTSKLVDGRFPDYRRVLPKGGDKVVIASRNHLKQALLRASILSNEKFRGV
FT                   RVQLEENLIKITANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIENHIEEDSMYVVMPMRL"
FT   gene            3127..4224
FT                   /locus_tag="Swoo_0003"
FT   CDS             3127..4224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sse:Ssed_0008 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84304"
FT                   /db_xref="GOA:B1KCX5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="ACA84304.1"
FT                   /translation="MSLTRLHIETFRNISSAQLHPSDGLNLIYGQNGSGKTSVLEAIYF
FT                   LGMGRSFRSHLSQRVIQHQDDKLTLFANLSLGEQESKIGLRRFRSGETEVKINGDKIKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHSDKSFHSAWANVKRILKQRNQ
FT                   LLKNQVSYSQIQFWDKELVRYSELVTLIRKEYVDSLNEQLKGIIVEFLPQVEVKVSFTR
FT                   GWDSKTDFGQLLETQYLRDVAAGNTGSGPHKADLRLRVGTLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQTDKNSIYLVDDLPSELDAKHRQLLLQQLMDTGAQIFVTAIDPAAIVDS
FT                   LTTPPSKMFHVEQGCVTVIDKPTRE"
FT   gene            4226..6643
FT                   /locus_tag="Swoo_0004"
FT   CDS             4226..6643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sse:Ssed_0009 DNA topoisomerase
FT                   (ATP-hydrolyzing); TIGRFAM: DNA gyrase, B subunit; PFAM:
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84305"
FT                   /db_xref="GOA:B1KCX6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCX6"
FT                   /protein_id="ACA84305.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCNDVIITIHADGSVSVKDDGRGIPVAIHPEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSSKLQLTIRRDGKLYEQFYNMGEPVEPIKAIGDATN
FT                   TGTEIRFWPSSETFSDTLFHFDILAKRVRELSFLNSGVGIRLVDERDNKDEFFKYEGGI
FT                   SAFVDYLNVNKTPVNKDVFHFIQEREDGITVEVAMQWNDGFQENIFCFTNNIPQRDGGT
FT                   HLAGFRGALTRNLNSYMEREGYNKKGKTGATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQTMGEQLGDYLMEHPNEAKLIVGKIIDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVVTLITALGCGIGRDEYDPDKTRYHNIVIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIERGYVYIAQPPLYKVKKGKQEQYLKDDPALTEYLTNLALDGGEIHPSADAPAM
FT                   SGAPLEKLVYQYREVEAIFERLEQRYPKLLTERMLYHPALSHELLSDEAKVKQWCDTYV
FT                   ADLEDRDTGGVHYSAEAFLDPERKVYLPKVTIRKHGIDTNFLFTYDFLNSHDYELMTKL
FT                   ANALEGLIEEGGYVKRGERMKEVTTFVEALNWLMNDSKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPESRRMLVVTIEDAIAADQLFTCLMGDHVEPRRDFIESNALNVANLDV"
FT   gene            complement(7093..8280)
FT                   /locus_tag="Swoo_0005"
FT   CDS             complement(7093..8280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0005"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   sdn:Sden_0005 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84306"
FT                   /db_xref="GOA:B1KCX7"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR023929"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCX7"
FT                   /protein_id="ACA84306.1"
FT                   /translation="MNKLIWLGLLVFSIPLIYLATTLSQPEPKSDYRWPLAQGFPKPQV
FT                   PESNPMSQAKVELGRYLFYDKALSANQTQSCASCHIQSLAFSEAKPVSVGSTGEFHRRN
FT                   SPGLINIAYNKTLTWAHDGLTDIEQQLLLPIFGENPIELGAIGHEDEILARLQRSPYPE
FT                   LFKQAFPNTKSEVDFVQVTQALSSFVRSLLSLNSPFDRYAYQGQDEALNTQELAGMDLF
FT                   FSERLECHHCHGGFNFTQSTSHEKQPLDKRPFHNTGLYYTERPSLASTSGTMTQNLGYP
FT                   EKDRGLAEITINPMDDGRFRAPSLRNIALTAPYMHDGSVVTLEEVLEIYAAGGRNITDG
FT                   DYQGDGRLNPLKSPFIKGFTLTDKEKEQLLAFLHSLTDEEFINNPAFSDPWLDTK"
FT   sig_peptide     complement(8218..8280)
FT                   /locus_tag="Swoo_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.503 at
FT                   residue 21"
FT   gene            complement(8277..9089)
FT                   /locus_tag="Swoo_0006"
FT   CDS             complement(8277..9089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84307"
FT                   /db_xref="InterPro:IPR023977"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCX8"
FT                   /protein_id="ACA84307.1"
FT                   /translation="MRVVSNSRVGSIFERIKKLSIVLIVVILSCGCSPKPMTLPIKLMW
FT                   GEQELNCNQALPELPQWRLENIQFYLSQFKNNGRPIYLVQDGHLTQQKNLALLGSDCRS
FT                   DGQWQIVFEHTLEPGEFSFNLGVPFKQNHQAPLKSQSPLNQSDMFWTWQMGHKFFRLDL
FT                   TKHESKKRETEPQTGWQFHLGSTGCKSASVMRAPTKECDHPNRPKFTLTYQGDNSLVLD
FT                   LAPLLSETLNNQKITQDSCMSDPHTLICRELLPRIGINSSSEIWRWQS"
FT   gene            9178..11913
FT                   /locus_tag="Swoo_0007"
FT   CDS             9178..11913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0007"
FT                   /product="Na-Ca exchanger/integrin-beta4"
FT                   /note="PFAM: Na-Ca exchanger/integrin-beta4; LVIVD repeat
FT                   protein; KEGG: sdn:Sden_0007 Na-Ca
FT                   exchanger/integrin-beta4"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84308"
FT                   /db_xref="GOA:B1KCX9"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR027589"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCX9"
FT                   /protein_id="ACA84308.1"
FT                   /translation="MSTRLQINRVITAIWIIFTSCLVCNSAIAHSEHDKARFVSNQGED
FT                   TGLCDKVLRPCKTIAYAVKHANKGDRVLVADGEYHLKDVEDIFLLTSGIVPVMGGYNRF
FT                   DHYQSQAPQLNKTLLVGVPTEFADELRLKGFRVINDGIGQYGIELDEMLSAHQSLQQSH
FT                   SSQTCEQGKSGNFSCENIDLVSHMALSAFSSSPAAANDIWGHVDLNTGTEYALIGLRNG
FT                   TAVVSLADPANPVEVGVIPGTRTSWRDIKVYQWFDSDTLRWKAHAYVVSEEDADQVHII
FT                   DLSQLPNSISKVATDRAVTSAHNVYISHVDYTTNTAMDGLSPALHIVGQDNQGGAFKTY
FT                   GLTDPKKLNTLFSHSGATRANYTHDAASMVVGDSRAQSSCQTALCTVLMDFNENSMSLW
FT                   NISNHSQSTQLADVTYDNVHYVHSGWWSEDKRYVFVHDELDEQRAGLNTTLRVFNLDNL
FT                   KSPSLVKVWTGPTKAIDHNGYVRGNRYYMSNYQRGVTILDISDPTDPQHVGYFDTFPAS
FT                   DGNAFNGVWGVYPYLPSGLILASDITSGLYVLRDNTQSATYGSSSFSTKESTLAAGESV
FT                   TVTVNRPAGTGVVSVGYETLGGSGVINRDFEPLVGRLTWAADDNASKSIVVNTIDSGQN
FT                   KELLVFVRLFDPQGGLTLVAPSYHTLRVGKNPAKPGVLGFAETTQSLNEGDSATNVSVV
FT                   RLTGSAGEVKLDYSLVSGSAVVGDDIADTSGQLVWADGDDEAKTITITPIEDNLVEGSE
FT                   TFQVVLKSVAGSELGESELAVTIIDNDRANTAPTVNAGENREVNAGETVTLLATATDAE
FT                   NDPITYLWEQSGGDSVSLSANNLAEISFVAPSQSTSLSFTVTATDSFGASSQASVTIEV
FT                   KAAVVVPPTEPSGSGGGGAITWFALFMLFLIAGYRRTKFD"
FT   sig_peptide     9178..9267
FT                   /locus_tag="Swoo_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.938 at
FT                   residue 30"
FT   gene            complement(11944..12684)
FT                   /locus_tag="Swoo_0008"
FT   CDS             complement(11944..12684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0008"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: sse:Ssed_0010
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84309"
FT                   /db_xref="GOA:B1KCY0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY0"
FT                   /protein_id="ACA84309.1"
FT                   /translation="MVRVNVKSYPIDLNADLGEGGLHDEALLQIVTSANIACGGHTGDQ
FT                   QTMTVAVKAAVENNVKIGAHPSYPDPINFGRAPMDISNQALRESISEQIRALKSVCERL
FT                   NAEMFHVKPHGAFYNKVAKDEAMGLILIEVIKQVDPSLKLMILAGSPLVKQAELAGLTV
FT                   IQEAFADRAYLNDGSLAPRDREGAVIHDRQTALTQVKQFIAQQPITSLDGQPLTVKADT
FT                   LCLHGDNEHALEFARSIYQIIQTQ"
FT   gene            complement(12710..13651)
FT                   /locus_tag="Swoo_0009"
FT   CDS             complement(12710..13651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0009"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: sse:Ssed_0011 UreA
FT                   amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84310"
FT                   /db_xref="GOA:B1KCY1"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY1"
FT                   /protein_id="ACA84310.1"
FT                   /translation="MINKLQKEVSLSSEDIEVLTPGLFSTVQGIGITGYRHLGIPIGGA
FT                   LDSHALLLGNRLLGNPDDTQGVELTSGKVELKFNRDSWFVVTGAQYQIFIGERNIWNGW
FT                   RNRIKAGETLTLKGPSSKMRAYLTIDGGIIQHSPLNKQGSTSQMLVRGDRLQLGKPLPI
FT                   AKPIGAVQRGYSDEIRALPGPEMSLFTAASRKAFWHNRWQLTNASNRMGARLNGEALSL
FT                   STANELNSHAVMPGVVQVPPSGQPIILLADAQTTGGYPKIATVIEADLWKLAQTRPGQT
FT                   IRFVHVSPSQADDANYEWQQYFYRLQRAIDGS"
FT   gene            complement(13648..14328)
FT                   /locus_tag="Swoo_0010"
FT   CDS             complement(13648..14328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0010"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   sse:Ssed_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84311"
FT                   /db_xref="GOA:B1KCY2"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY2"
FT                   /protein_id="ACA84311.1"
FT                   /translation="MSNTSPKVYRLGERAIVLDCSELFPALSKLTIQSRIWELAQKCRE
FT                   DNTFTDLVPGMNNLTLFIKDANQLTDWIARLPELWRDTTGIELDNPSIEIPVVYGGKYG
FT                   PDLDEVARVHQLDTNEVIRMHTAPEYTVLFLGFQPGFPYLDGLNNHLFTPRLNTPRLSI
FT                   PAGSVGIGGEQTGIYPQEAPGGWQLIGRTNLPLFTPDTPKNPTLLAPGYRVRFTQVSSL
FT                   EFTQ"
FT   gene            14533..15537
FT                   /locus_tag="Swoo_0011"
FT   CDS             14533..15537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0011"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   sse:Ssed_0013 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84312"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY3"
FT                   /protein_id="ACA84312.1"
FT                   /translation="MPKALSTDLGFQTLSSTPKKEPLKSKAPSSEPLKLERRVDVSALF
FT                   YGMLFPSQSGAETGIANNLEKSVISEVENALTSPADIAEKVLKLPSQLAVLDQKLKDDS
FT                   VDIETLLEVFKTKPVLSIEVLKLCNSPAFKRSDKEVTNLQQAFVQLGREQIRRLVTTSL
FT                   MGEIVEIKPIYYRRFGLQIWRHSQQVSYLSAEFGKCDPDTAFMLGLLHDVGKIAIFKML
FT                   LDAFQLAEPGEQPSSSLFKQVMTTKSLSLSALLAKHWQLPAIFETSLSQLASSHSKPSD
FT                   ELALAVWRANLISECSMLLQANQLDEDDLSRLLMDAGLTREQFDTYHERLKMF"
FT   gene            complement(15573..17642)
FT                   /locus_tag="Swoo_0012"
FT   CDS             complement(15573..17642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0012"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: spl:Spea_0006 glycyl-tRNA synthetase, beta
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84313"
FT                   /db_xref="GOA:B1KCY4"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /protein_id="ACA84313.1"
FT                   /translation="MNYENLLIEVGTEELPPKALRKLAESFVSNFTDELEKAELSFESA
FT                   QWHAAPRRLAFTVNQLVLAQADKVVEKRGPAIAQAFDADGNPTKAAMGWARGNGISVEQ
FT                   AERLKTDKGEWLLHQAKVVGVETKSLINDMAQRALDKLPIPKPMRWGTSKTQFIRPVHT
FT                   VTMLLGSELVEGELLGVKSARVIRGHRFMGKKSFELDHADNYLSALKEQGMVLADYEAR
FT                   KAIIKTDAEAAAAKIGGVADLEDDLLEEVTSLVEWPVVLTANFEEKFLDVPAEALVYTM
FT                   KGDQKYFPVFDKAGQLLPHFIFVTNIESKDPQVIISGNEKVVRPRLADAEFFFETDKKQ
FT                   TLESRLASLETVVFQKQLGTIKQRVERISQLAGYIAASIDADSDEASRAGLLSKSDLMT
FT                   NMVMEFTDLQGTMGMHYARLNGETEAVAVALAEQYKPKFSGDTVPTAPISVCVALAEKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGVLRICLENNLPLDLVDLIAKAQELHGDNLTN
FT                   DKAAEQVLEFFMGRFRAWYQDQGVSVDVILAVLARRPTAPADFDSRIKAVAHFRSLEQA
FT                   SALAAANKRVSNILAKVEGELATDISSELLVENAEKALAEKLNELQPQLAPLFAAANYQ
FT                   QALSLLADLRESVDTFFEDVMVMADDEALKNNRLALLSSLREQFLHAADISLLQ"
FT   gene            complement(17654..18517)
FT                   /locus_tag="Swoo_0013"
FT   CDS             complement(17654..18517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0013"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: spl:Spea_0007 glycyl-tRNA synthetase, alpha
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84314"
FT                   /db_xref="GOA:B1KCY5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY5"
FT                   /protein_id="ACA84314.1"
FT                   /translation="MTLQEYWAQQGCAIVQPLDMEVGAGTFHPQTFLRSLGPEPMSSAY
FT                   VQPCRRPTDGRYGENPNRLQHYYQYQVVLKPSPSNIQELYLGSLEALGVDMNVHDVRFV
FT                   EDNWESPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECSPVTGEITYGLERLAMYIQE
FT                   VDSVYDLVWTDGPMGKVMYGDIFHQNEVEQSTYNFEHANVDVLFKMFDDCEVACQRLLT
FT                   LEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAREAL
FT                   GFPMCK"
FT   gene            18724..19308
FT                   /locus_tag="Swoo_0014"
FT   CDS             18724..19308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0014"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: sse:Ssed_0016 DNA-3-methyladenine glycosylase
FT                   I; TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84315"
FT                   /db_xref="GOA:B1KCY9"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY9"
FT                   /protein_id="ACA84315.1"
FT                   /translation="MEKQRCSWVGADDLYQAYHDEVWGRPVFDSQELFAKLCLDGQQAG
FT                   LSWITILKKQHNYEAAFANFDPAIIAKFDDDKVEELLLNKGIVRNRLKVNSIIKNARAY
FT                   MTHFSDTQGDDFSRFIWSFVGGKPIVNKFNSMSEVPAQTPESEAMSKALKKLGFNFVGP
FT                   TICYAFMQAVGLVNDHTTDCFYYDLSEKRKS"
FT   gene            complement(19710..22919)
FT                   /locus_tag="Swoo_0015"
FT   CDS             complement(19710..22919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0015"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: sse:Ssed_0018 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84316"
FT                   /db_xref="GOA:B1KCZ0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ0"
FT                   /protein_id="ACA84316.1"
FT                   /translation="MLKHKLTPLCAAIALSFSSPSFAEEPSDKKEAKWQVNAPANAPLE
FT                   KVDINVTEGTWMNVSVSPDGKNIVFDMLGDIYQMPIEGGEAKVLAEGIAWQMQPVYSPD
FT                   GKYIAFTSDEDGGDNIWIMEADGSKPRAVTEETFRLLNSPAWSPDSQYLVARKHYTGSR
FT                   SLGAGEVWMYHVAGGEGVKLTERPNEQKDLGEPAYSPDGRYIYFSQDATPGKTFHYSKD
FT                   SVKGIYKIKRYDTQTGDIEVLIEGTGGAIRPTPSPDGTKLAYIKRDGFQSSLYLLDLKS
FT                   GKIDKLYGKLDRDMQETWAIHGVYPSMSWTSDNEEIVFWAGGKINKLDVESKSVKQIPF
FT                   SIKTKLDVQPAVRFTQNLDQDKFDVKMLRMAQVSPDGKKVVYEALGKLWVKSLSNGKRT
FT                   RLTKLDSELRELFPQWSRDGKSIVFSTWDDEEQGSIRIVNVRNKRVKTLTKEPGKYVEP
FT                   TFSPDGSFVVYRKAKGGYITPRTWSQETGLYRVDIKGKESIKITPDGYQPQFGADSDRV
FT                   YFMDHGETPELASINLNGFQKRVHYTSKHATEFRVSPDGKQLAFAERFKVFVTPFAKHG
FT                   ETINIGPKANNLPVTQLSVRAGESISWNNDSDQLYWTLGPELYQVAVDNSYGTDTTASN
FT                   SKADKATEPKITDLGFTQKADVPRGTVAFVGGNIITMEDDKVIENGVVIVKDNHIVSVG
FT                   DASIEIPSDAQVIDIKGKSLMPGLFDAHAHGSQGENEIIPQQNWELYANLALGVTTIHD
FT                   PSNDTTEIFAASEQQKAGNIAGPRIFSTGTILYGANAPGYTSHIDSLDDAKFHLERLKK
FT                   VGAFSVKSYNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMITDGHTGIEHSLPA
FT                   GAIYNDIKQFWSQTEVGYTPTLVVAYGGISGENYWYDKTDVWSHPRLSQYVPGDLLQAR
FT                   SMRRPTAPDEHYNHFNVARVANEMNDLGIKPNIGAHGQREGLAAHWEMWMFAQGGMSNL
FT                   EVLKTATINPAKHFAMDHQIGSIKQGKLADLIVIDGNPLEDIRVTDRVTHTMVNGKLYN
FT                   AETMDQLNGEEDKRKPFFFEL"
FT   sig_peptide     complement(22848..22919)
FT                   /locus_tag="Swoo_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(23231..23698)
FT                   /locus_tag="Swoo_0016"
FT   CDS             complement(23231..23698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84317"
FT                   /db_xref="GOA:B1KCY6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015808"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY6"
FT                   /protein_id="ACA84317.1"
FT                   /translation="MPTLTAIGFKPVRQGPMTLVETAQVTKSAGVEQDFFGRPGKRQVT
FT                   VMSQDQWNLVCLELDKPLPWVTRRANLLIQDYSFSSSDRGKLLKIGSLELLITGETDPC
FT                   KKMEIAQAGLEKALTPDWRGGVTCRVLNDAQISQGDLVTISEVPEQLSFIS"
FT   gene            complement(23748..23993)
FT                   /locus_tag="Swoo_0017"
FT   CDS             complement(23748..23993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0017"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: sse:Ssed_0020 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84318"
FT                   /db_xref="GOA:B1KCY7"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /protein_id="ACA84318.1"
FT                   /translation="MSNQFSEAQHQLDALGLRCPEPVMMVRKSVRKMAQGETLLIIADD
FT                   PATTRDIPSFCEFMDHKLLASQTETTPYQYLIQKGL"
FT   gene            complement(24134..24601)
FT                   /locus_tag="Swoo_0018"
FT   CDS             complement(24134..24601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0018"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region; KEGG: sse:Ssed_0021 YbaK/EbsC
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84319"
FT                   /db_xref="GOA:B1KCY8"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCY8"
FT                   /protein_id="ACA84319.1"
FT                   /translation="MTPAINSLKRAKLAYRILEYHHDANAGAYGIEAAAKLNLAPSLVF
FT                   KTLVAKLDNEKLVVAIIPVAEKLNMKLLAKAAGVKKAAMASAQEVERSTGYVLGGVSPL
FT                   GQKRPLATFIDISAESLKQIYVSGGKRGLDIELTPMSLQQLTKANFTPLTV"
FT   gene            complement(24615..25097)
FT                   /locus_tag="Swoo_0019"
FT   CDS             complement(24615..25097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0019"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spl:Spea_0014 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84320"
FT                   /db_xref="GOA:B1KCZ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ1"
FT                   /protein_id="ACA84320.1"
FT                   /translation="MEINLLKDKPDLIPKIAKWYSDEWGYIDDGSGKESRSTTALEIKL
FT                   AEYLNSDTIPLMLVATKNQSLIAAAQLRFQENSRYPSDSHWLGGVYVCESHRGNGAGQA
FT                   LIEAIVTKAKQLNVQQLYLQTEDLSGGLYKKMGWKAVEEVKYCGIDLLIMQRDLIT"
FT   gene            complement(25234..26397)
FT                   /locus_tag="Swoo_0020"
FT   CDS             complement(25234..26397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0020"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: sse:Ssed_0022 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84321"
FT                   /db_xref="GOA:B1KCZ2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ2"
FT                   /protein_id="ACA84321.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKALLARNPKL
FT                   DPKDIEDVIWGCVQQTLEQGFNIARNAALLAGIPKEAGAVTVNRLCGSSMDALHQAARA
FT                   IMTGQGDTFIIGGVEHMGHVPMNHGVDFHPGLANNVAKASGMMGLTAEMLGKMHGISRE
FT                   QQDEFAVRSHQRAHAATVEGRFANEIHPVEGHDANGVLIKVEHDEVIRPETSMESLSGL
FT                   RPAFDPANGTVTAGTSSALSDGASAMLVMEEEKAKALGLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATKKALERAGLTIDDLDVIELNEAFAAQSLPCVKDLGLMDVVDEKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEAKDAKYGLATMCIGLGQGIATVFERP"
FT   gene            complement(26419..28569)
FT                   /locus_tag="Swoo_0021"
FT   CDS             complement(26419..28569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0021"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   sse:Ssed_0023 fatty oxidation complex, alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84322"
FT                   /db_xref="GOA:B1KCZ3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /protein_id="ACA84322.1"
FT                   /translation="MIYQSPTIQVELLEDNIARLCFNAAGSVNKLDRETIDSLNAALDA
FT                   IKQDTNIQGLVLTSGKGAFIVGADITEFLGLFAQEESVLLPWIAEANVVFNKIEDLPFP
FT                   TISAINGFALGGGFETVLATDFRIADTTAKLGLPETKLGLIPGFGGTVRLPRLIGADNA
FT                   LEWITTGKDHKPEAALKVGAIDAVVAPENLEASAIAMLKEALSEKLDWQARRAKKQAPL
FT                   NLPKLEAMMSFATAKGMVFKVAGKHYPAPMTAISVIEQAARSERADALMVEHQAFIKLA
FT                   KTDVAQALIGIFLNDQLVKGKAKKAGKLAKNVDSAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALDLGLGEASKLLAAQIKRGRSTPEKMAKVLNNITATLDYAPVKDVDVVVEA
FT                   VVEHPKVKSMVLAEVEQNVSDDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGENSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADG
FT                   ADFAAIDKVMEKQFGWPMGPAYLLDVVGIDTGHHAQAVMAEGFPDRMGKDGKDAIDIMF
FT                   DSERFGQKNNKGFYAYSVDRRGKPKKDLDPTSYELLGAEFGDLKAFESDEIIARTMIPM
FT                   IIETVRCLEEGIIATPAEADMGLVFGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRELAANNGSYYQA"
FT   gene            28837..30156
FT                   /locus_tag="Swoo_0022"
FT   CDS             28837..30156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0022"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: sse:Ssed_0024 Xaa-Pro
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84323"
FT                   /db_xref="GOA:B1KCZ4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /protein_id="ACA84323.1"
FT                   /translation="MDQLANHFKSHIAELNHRVAEIISRENLSGLVIHSGQPHRQFLDD
FT                   MDYPFKVNPHFKAWLPILDNPHCWLLVNGRDKPQLIFYRPVDFWHKVADLPDAFWAEHV
FT                   EIKLLTKADKVAELLPSDISQWAYIGEHLDVAEVLGFKTRNPDAVMSYLHYHRASKTQY
FT                   ELCCLRNANEIAVKGHLAAKNAFFNGGSEFEIQQEYLTATNQGENEVPYGNIVALNENA
FT                   AILHYTKLESVRPESRHSFLIDAGANFFGYASDITRTYAFEKNIFSELIEAMDKMQQEI
FT                   ISMMRPGVKYVDLHIATHQKLAKILVDFDIASGEPQSLVDQGITNVFFPHGLGHMLGLQ
FT                   VHDMGGFLHDERGTHIAAPDAHPFLRCTRTLAANQVLTIEPGIYIIDSLLNELKQDSRK
FT                   KQVNWQTVDLLRPFGGIRIEDNVIVHADQNENMTRDCGLN"
FT   gene            30153..30788
FT                   /locus_tag="Swoo_0023"
FT   CDS             30153..30788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0023"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: sse:Ssed_0025 protein of
FT                   unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84324"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ5"
FT                   /protein_id="ACA84324.1"
FT                   /translation="MTDSYRIPSAELIIEEEIKHSRFISFLFHCQSYEELKCALTNIKA
FT                   DYPGANHYCYAFVAAEPGNTLAMGSSDDGEPSGSAGRPMLATLQGADVGEIGAVVVRYF
FT                   GGTKLGVGGLVRAYSSGIKQGLTQLETQLKQIRYPGLLVCDYNQLKDVEYLLAQYDGVI
FT                   EERDFMEKVTLNFAIPKRFQTELNRDLATMSQGLLAAKFDFHKSDSTH"
FT   gene            30877..32334
FT                   /locus_tag="Swoo_0024"
FT   CDS             30877..32334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0024"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: sse:Ssed_0026 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84325"
FT                   /db_xref="GOA:B1KCZ6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ6"
FT                   /protein_id="ACA84325.1"
FT                   /translation="MQYRTIIRITGFLMGLFSLSLLPPALVAVIYKDGGGTAFIQAFFL
FT                   SLFLGFLLWYPNRRHKKDLRTREGFLLVVLFWAVLGSIGAVPFIFTNQPDLSITDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPMLGIGGMQLYRA
FT                   EMPGPVKDSKMTPRIAETAKALWYIYFALTIACAVAYWLAGMDVFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSTAINMVCVVFLLIAALNFSLHFAAFTRRGINLKIYFKDAEFKALVI
FT                   VQLVLTGICFGVLYHSGIYDSPEQTLDFALFQAVSISTTAGFGTESFHMWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVIRMILLLKQGSRELKRLVHPRGMFSIRIGDKALPDRIIDAV
FT                   WGFFSAYALVFVLCMLLLMAMGMDNITAFSATAACLNNLGPGLGEVASNYASIGDGEKW
FT                   VLLMAMLFGRLEVFTLLVLFTPTFWKN"
FT   sig_peptide     30877..30963
FT                   /locus_tag="Swoo_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.705 at
FT                   residue 29"
FT   gene            32358..32885
FT                   /locus_tag="Swoo_0025"
FT   CDS             32358..32885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0025"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: sse:Ssed_0027 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84326"
FT                   /db_xref="GOA:B1KCZ7"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ7"
FT                   /protein_id="ACA84326.1"
FT                   /translation="MNKTLIIYSTVDGQTRAICELMKGVNQAAESEVTLASLEEAKALS
FT                   LADFDKVMIGASIRYGKHRPELYQYINNHHAVLSAKPNAFFTVNVVARKPEKNTPETNP
FT                   YMKKFLELSLWKPQQLGVFAGKIDYPKYRFFDKTMIRFIMWMTKGPTDTSGTYEFTNWQ
FT                   QVEEFGKAFADR"
FT   gene            complement(32961..33266)
FT                   /locus_tag="Swoo_0026"
FT   CDS             complement(32961..33266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0026"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: sse:Ssed_0028
FT                   regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84327"
FT                   /db_xref="GOA:B1KCZ8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ8"
FT                   /protein_id="ACA84327.1"
FT                   /translation="MQKEIDVDAMVSNAENAAKWLKAIANPYRLMILCLLLENEYSVTE
FT                   LNETVPLSQSALSQHLAVLRAQDLVSTRKSSQVVFYKLKNEQVTEVISILHKQYCA"
FT   gene            33463..34002
FT                   /locus_tag="Swoo_0027"
FT   CDS             33463..34002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0027"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: sse:Ssed_0029 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84328"
FT                   /db_xref="GOA:B1KCZ9"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCZ9"
FT                   /protein_id="ACA84328.1"
FT                   /translation="MKSILVLYYSRGGHTAKISRAIAEHIEHQGHKSRVMHISEAVKEG
FT                   LDWAKYDSVALGACVMYGSYDKSVFAFTTEHQAALSEKPNSFYSVNVVARNPEKRVPEN
FT                   NKYLQKFIELSPWKPNDVKVIAGKVDYPAWRWWDRLAIQLIMKMTNGPTDPKSVIDYTD
FT                   WDDVKLYAEHLIRLAD"
FT   gene            34092..34802
FT                   /locus_tag="Swoo_0028"
FT   CDS             34092..34802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_00711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84329"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD00"
FT                   /protein_id="ACA84329.1"
FT                   /translation="MKLVLLPGMDGTGELFSSLLFSLSEYECEVIALPQTGPQDYASIT
FT                   EYVKEKLPQNDFILVAESFSGPVAARLAKEGAEHLQGVIFVATFLSKPHWLLLSIARAL
FT                   PLKLLSALPFAKLFVKALFLGSAASNELVEQFQSIVDSLPPRVIKARLSSMLSLSFSAE
FT                   LIELPVGYIQATSDYLVSSNKVTEFSACFRELQVRSVEGPHFILQANPAKSAEVISELV
FT                   TLFGKQTGKGRVTF"
FT   gene            complement(34792..35238)
FT                   /locus_tag="Swoo_0029"
FT   CDS             complement(34792..35238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84330"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCV5"
FT                   /protein_id="ACA84330.1"
FT                   /translation="MRSLFQTASIIFPVIILPIKTHATVIELNTYLGGSEGKLANKPAL
FT                   IYKFSDGSQQNRCSIITTENYLVNAKNRLENINLSEPNFYFDCVWDGRYYFLSNRHRTY
FT                   AEVIIKQPDMNFPMSMHIEAKLINIIGEHAEVISGDISLRRSKK"
FT   gene            35575..35769
FT                   /locus_tag="Swoo_0030"
FT   CDS             35575..35769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84331"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCV6"
FT                   /protein_id="ACA84331.1"
FT                   /translation="MYGIKNQLRTSNSTGSLGIYMNLDELANSVSESELRERLIHSVGE
FT                   WKQDDQDIEELAYLMGKWQ"
FT   gene            35833..36261
FT                   /locus_tag="Swoo_0031"
FT   CDS             35833..36261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84332"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCV7"
FT                   /protein_id="ACA84332.1"
FT                   /translation="MALGIPLDIAEILNFVAIESGTKIEKVHLNSNISDELGIVGDDFH
FT                   ELIEAYSNKYHVNMDEYLWYFHSEDEGVNIWSFIFKPPWKKVEKIPITPQMLLNFAIKG
FT                   KWLVVYPEHKVPTNRNDITYSNCLWLVLIIGFLVACYT"
FT   gene            36366..36644
FT                   /locus_tag="Swoo_0032"
FT   CDS             36366..36644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_03721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84333"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCV8"
FT                   /protein_id="ACA84333.1"
FT                   /translation="MVVLDEEHMSWILFQNTNDMYLSVVCGTVGMFTVEIQLTNSEATS
FT                   YKLTGKSYIDQFASSICAKPDYFTPRKVANFKTKFNVTEALSEWRNS"
FT   gene            36811..37287
FT                   /locus_tag="Swoo_0033"
FT   CDS             36811..37287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VFA1145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84334"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCV9"
FT                   /protein_id="ACA84334.1"
FT                   /translation="MMNIVKVDDSNAHVYANLYQGYSAEFSKIIDDKPDENGVFEIYPR
FT                   LKGSVTGYLLYVEGIPAAITAIDETSPKAYEICDFYVLPCFRKNKVGKRFISSLFECLG
FT                   GSWEIKQVAGAEHAISFWRDVVSDYTSDDYVEDVYEDHKWGTVTRQRFAHAKNA"
FT   gene            complement(37445..38887)
FT                   /locus_tag="Swoo_0034"
FT   CDS             complement(37445..38887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0034"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: sse:Ssed_0031 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84335"
FT                   /db_xref="GOA:B1KCW0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW0"
FT                   /protein_id="ACA84335.1"
FT                   /translation="MLNLRPLLFILGIFLSTLTVFMFIPLIFALFYGEETVGAFMISSL
FT                   FTGTCASACIHQGRSRNLHLNIRDMFLLTSLTWLIVSFFAAMPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDSMDHSILIWRSLLQWMGGIGFIVMAVAVLPFLNVGGMRLFRTE
FT                   SSDWSDKAIPRTQDMAKHLFYIYILLTVLCGIAYHLSGMNWFQAINHAMTTLSTGGYST
FT                   SDSSMAAFSNQAHWVGVVFMAAGGLPLLMFVNSIQQRSLWVWNDAQVKGFILFISLVSM
FT                   SLAFWLWLGHEMSPLDALRLASFNVVSVVTTTGYGLTDYTAWGALANIAFLFLMFAGSC
FT                   SGSTSGGIKIFRFQIAGAIMREQLKQQFHPSGVFKERYNNRIISDDIVRSLVTFILLFA
FT                   FVIVLLSIILVLTGLDPMTSFTGAITAVTNVGPGLGDVIGPAGNFSTLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPSFWKY"
FT   sig_peptide     complement(38798..38887)
FT                   /locus_tag="Swoo_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.737 at
FT                   residue 30"
FT   gene            complement(38941..40350)
FT                   /locus_tag="Swoo_0035"
FT   CDS             complement(38941..40350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0035"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: sse:Ssed_0032 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84336"
FT                   /db_xref="GOA:B1KCW1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW1"
FT                   /protein_id="ACA84336.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDRRRLRSLQDKYDL
FT                   RVVFGHGAHPNTLKDAGAEDADMLIAVTNSDECNMAACQIAYSLFGTPTKIARIRSEQY
FT                   LALRDKLFINSETKKNDNSPRGGFIIDELIAPEQLVTSYIRRLVEYPGALQVLEFAEGR
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRSIMPRGTTIIEADDEVFF
FT                   VADSRHVRAVMSEMQKLDNTYRNIMIAGGGNIGLGLAKQLQRNHSVKLIEHKQERAEEL
FT                   SEKLENTTVFCGDASDQELLIEEHIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   AKTSKVVGKKIGEIKLPPSTTIGAIVRDDEVLMAHDNTIIEQGDHVILFLVNKKFVGEV
FT                   EKLFQPSAFFF"
FT   gene            complement(40360..41637)
FT                   /locus_tag="Swoo_0036"
FT   CDS             complement(40360..41637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0036"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: sse:Ssed_0033 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84337"
FT                   /db_xref="GOA:B1KCW2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW2"
FT                   /protein_id="ACA84337.1"
FT                   /translation="MNLRALAAKVVFQVLEKGISLSVALPEQQKHCESGKDKALLAELS
FT                   YGVMRQLPQLDKLISDCMAKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFDGLVKVINAVLRNIQRQEKPLPTDNDTLTYNTPAWIIKSLKQAYPDSWQTVIENS
FT                   HQRPPMWLRNNVRSQTRDEYLALLAEAEISASAGQSSDAILLESPKDVMQLPGFEQGAA
FT                   SVQDGAAQWAATLLAPADGELILDACAAPGGKTCHILERADTELVAVDFDANRLERVQQ
FT                   NLDRLSLNAKLVHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIE
FT                   ELAQLQSKILDHCWKWLKPGGTLLYATCSILPQENAQQISAFLERTHDATLIAISQQPN
FT                   PDDIGWQITPGTENMDGFYYARLVKG"
FT   gene            complement(41639..42601)
FT                   /locus_tag="Swoo_0037"
FT   CDS             complement(41639..42601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0037"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: sse:Ssed_0034
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84338"
FT                   /db_xref="GOA:B1KCW3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /protein_id="ACA84338.1"
FT                   /translation="MKPLNVIFAGTPDFAARHLQALINSEHNVIAVYSRADKPAGRGKK
FT                   LQASPVKMLALENEIPVYQPTSLRDEQAQAELASLNADIMVVVAYGLILPKVVLDTPKL
FT                   GCINVHGSILPRWRGAAPIQRALWSGDTETGVTIMQMDIGLDTGDMLLKTQLPIEDSDT
FT                   SASLYEKLAEQGPEALVEALTGLAKGELAAEKQDEALANYAEKLSKEEAELDWNKSAAQ
FT                   LWREIRAFNPWPISHFSHQDASIKVREAHVSQSKSQAPAGTIISAGKEGIEIATGDGVL
FT                   TLLNMQLPGKKPLSVADILNSRSEWFTPGTVLNSTKEAE"
FT   gene            complement(42609..43118)
FT                   /locus_tag="Swoo_0038"
FT   CDS             complement(42609..43118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0038"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: slo:Shew_3736 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84339"
FT                   /db_xref="GOA:B1KCW4"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW4"
FT                   /protein_id="ACA84339.1"
FT                   /translation="MSLLKVLRFPDEKLRTIAKPVTEFNADLQTQIDNMFETMYEEKGI
FT                   GLAATQVDYHHQLIVMDLQDEVERPKVFINLEIVASSGHFENEEGCLSVPGIFANVERA
FT                   EHVTIKALDREGNEFTLEADGLFGICLQHELDHLKGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RQEKKG"
FT   gene            43301..44410
FT                   /locus_tag="Swoo_0039"
FT   CDS             43301..44410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0039"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   sse:Ssed_0036 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84340"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW5"
FT                   /protein_id="ACA84340.1"
FT                   /translation="MENPMKRLILFALMTFSCSIFADTLTLKSGHPDSYVVVKGDTLWD
FT                   ISEHFLNDPWRWPKLWGVNPQIANPHLIYPGDRLTLVFIDGEPRLVVKPHKRKSPEGRI
FT                   HAKGDAIPAIDLSLIGPYLIQNRVVDGDWFDKQPMVLGGESESKHHIVGDIVYVQQVLT
FT                   LGDKFGVYSEGREFVSKENEVLGKEVVLTASGRVVESGPISKIKLLSNFRETKAGYRIL
FT                   PIESDSLLSAYFMPKAATVTEPGSILASEKHLREMGKLDVVYLDKGVEDGVEPGDVFSI
FT                   YRDGIDVVINGDGQPVLPAERSSYEDLLSGVSSDNAIKMPDIFRGRLMVFKVFDKTSLG
FT                   LIMANKKTVRVDDKLVQPDSINLLKSFAD"
FT   sig_peptide     43301..43369
FT                   /locus_tag="Swoo_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            44539..45534
FT                   /locus_tag="Swoo_0040"
FT   CDS             44539..45534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0040"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: sse:Ssed_0037 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84341"
FT                   /db_xref="GOA:B1KCW6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW6"
FT                   /protein_id="ACA84341.1"
FT                   /translation="MLAHEKSALPLPESLLERELAPNLNLVESALAWQESADNHAIICF
FT                   DDPHYPSFLKQISAPPPILFVKGELDAFFPPALAIVGSRAASKAGLQLAYRFGSELGEL
FT                   GFGVCSGMAVGVDGSAHQGCLDSGGKTLAVLGTGVDVIYPKRHRKIYEDIQAHGAIVSE
FT                   FWPGTKPFSGNFPKRNRIISGLSIGTLVVEACRKSGSLITARLALEQGREVFAIPGSVL
FT                   AENNQGCHDLIKDGAKLVENVADIIEEVSALCDFHLEELKSSHHIGEENASDLPFASLL
FT                   ASVGYETTPIDVVVEHSGKAIELVLEQMLELELQGWVAVVPGGYVRIKRS"
FT   gene            45537..46010
FT                   /locus_tag="Swoo_0041"
FT   CDS             45537..46010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0041"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   sse:Ssed_0038 protein of unknown function DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84342"
FT                   /db_xref="InterPro:IPR007456"
FT                   /protein_id="ACA84342.1"
FT                   /translation="MFDILMYLFENYVHSEVEFLVDEDELTQELTRAGFHQSEIIKALS
FT                   WLENLAELQEGDKPYLCNHAQHSFRIYTQDEMDKLDVECRGFILFLEQIEVLNVVTREM
FT                   VIDRIMELDESALILEDLKWVVLMVLFNAPGNESAYEQMEDLIFEQPDGRLHS"
FT   gene            complement(46211..47974)
FT                   /locus_tag="Swoo_0042"
FT   CDS             complement(46211..47974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0042"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="PFAM: Peptidase M9A collagenase domain protein;
FT                   KEGG: sse:Ssed_0039 microbial collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84343"
FT                   /db_xref="GOA:B1KCW8"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW8"
FT                   /protein_id="ACA84343.1"
FT                   /translation="MFRQSVIALALLSLSGCSSTAKISLDNTQINKIMEAQEQSLFKAD
FT                   SPLLTKDIFIQVSLALASVNDEQQADKLLYYLRAFSYFGPKELLDSSSIEALTLGLSEL
FT                   TNKPFFSRSPRLQEHFAVTIYRYYSDNDNAQQLAKLLPMLEAQLISLGESNTNLANDYG
FT                   LWETLRAYGMLFNSARKDVDGELNQQIVALDLAKPLLDFASSNTSIREGNDWPKANAYW
FT                   ALGLYRLALPTSDENKPTLAEDRIDKAVAEIAKVDISIRGDDAKDTYTLGFHVNAFAGK
FT                   DRCEQNSDICRIPELTDILPIHHPCSDSLFILAQDLNQEELASSCTKLTSQEANFHQIL
FT                   ETGHQATPNDFNTALRVVAFKNWSQYNAYGQLLFDINTDNGGMYIEGTPSKPGNQATFF
FT                   AYRQFWIQPEFAIWNLNHEYVHYLDGHFVKYGGFGHFPSKMVWWSEGLAEYIAKGDSNP
FT                   NTLKVIKRDIEKAPTLEEIFATEYDDGQDRTYKWSYMAVRFLAEHHHSDFVQLSQFLKT
FT                   DYFEGYEQLLQSLTQYQPEFSNWLNTQVNQFDDNQDKNKVKVKINKLNRYSYREYLKPT
FT                   HLVQDKKHLHY"
FT   sig_peptide     complement(47909..47974)
FT                   /locus_tag="Swoo_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.874 at
FT                   residue 22"
FT   gene            48086..48649
FT                   /locus_tag="Swoo_0043"
FT   CDS             48086..48649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0043"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: sse:Ssed_0040 DNA topoisomerase, type IA, Zn
FT                   finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84344"
FT                   /db_xref="GOA:B1KCW9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCW9"
FT                   /protein_id="ACA84344.1"
FT                   /translation="MSKIDQQLFSSHEHALEKEYELCPKCGSELSVKNSKHGGFIGCNN
FT                   YPNCDYTRPLVQHESIETQVIEGSSCPECGNELAVKSGRFGIFIGCTHYPECRHIEKHD
FT                   QEEAGNEIPCPLCKKGHVEHRTSRFGKTFYACSGYPKCKFLVNYHPVNEACPECGFGIL
FT                   VERKGAAGGRLECPQKQCKYKRPI"
FT   gene            48724..49281
FT                   /locus_tag="Swoo_0044"
FT   CDS             48724..49281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0044"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; KEGG: sse:Ssed_0041
FT                   SUA5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84345"
FT                   /db_xref="GOA:B1KCX0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /protein_id="ACA84345.1"
FT                   /translation="MLEQAPAEVKQVIESGGVVAYPTEAVYGLGCDPDNDAAITKLLAI
FT                   KKRPWEKGLILVASDYQQLLPYIDDSQLTEEQRERVFSKWPGPFTFIMPIKPGISNLLC
FT                   GSFNSLAVRVSDHPTIQAICQQLGKPLVSTSANHSGEEPAMSHEEILAKFEGEIDALVA
FT                   GSLGEQRKPSTIIDAISGKILR"
FT   gene            49310..50230
FT                   /locus_tag="Swoo_0045"
FT   CDS             49310..50230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0045"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   sse:Ssed_0042 coproporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84346"
FT                   /db_xref="GOA:B1KCX1"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /protein_id="ACA84346.1"
FT                   /translation="MSVPDVSVVKAFLLDLQQRICDGLEQLDGEAKFKADSWKREEGGG
FT                   GTSRVLTQGKVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYI
FT                   PTTHANVRFFIAKKEGADPVWWFGGGFDLTPYYPFKEDVIEWHQNAHDLCLPFGEEVYP
FT                   KYKKWCDDYFYLPHRDETRGVGGLFFDDLNAEGFDTSFAFMQAVGNGFLTAYAPIVQRR
FT                   KETQYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWEYMYT
FT                   PEENSPESLLYSDYLTPKDWLSLNK"
FT   gene            complement(50332..50781)
FT                   /locus_tag="Swoo_0046"
FT   CDS             complement(50332..50781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0046"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: spl:Spea_0039 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84347"
FT                   /db_xref="GOA:B1KCX2"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B1KCX2"
FT                   /protein_id="ACA84347.1"
FT                   /translation="MNWIKKIFQNSPKSPQSEDSVRDPQQSNAYDLIGGEPVIRALAHQ
FT                   FYLQMLQQGRASELLSIHKAPITESEQKLFEFLSGWLGGPGLFEQKYGHPALRARHMPF
FT                   QIDEEMRDQWLFCMKRAIEIEISHPEHQAAIYQAISTLADHMRNQ"
FT   gene            50928..51749
FT                   /locus_tag="Swoo_0047"
FT   CDS             50928..51749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0047"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: shw:Sputw3181_0032
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84348"
FT                   /db_xref="GOA:B1KD01"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022893"
FT                   /protein_id="ACA84348.1"
FT                   /translation="MTDRYAVFGNPISHSKSPLIHGIFANETQQVLDYEAILAPKDGFE
FT                   SCLKLFWSQNGKGANVTAPFKEQAFNLCDELSEEAKLAGAVNTLTLLTNGKVRGDNTDG
FT                   LGLVADLIRNISSLEGKRVLLLGAGGAARGSVLPLLKAGLKVYIHNRTQEKAEKLVEIF
FT                   TPFGDVKALSIAELIAPFDIIINSTSSSLSGDVPAIPSCVIGVESLCYDMMYSKEMTSF
FT                   NSWALELGAVKAIDGLGMLVGQAAKSFELWRGVTPEVDTTIKLLREKIKSE"
FT   gene            51746..52009
FT                   /locus_tag="Swoo_0048"
FT   CDS             51746..52009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0048"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   spl:Spea_0041 protein of unknown function DUF1488"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84349"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD02"
FT                   /protein_id="ACA84349.1"
FT                   /translation="MNQSILFPDLQEWNEELQEIHFPAQVQGANIECRISLARLVKLEG
FT                   KEVQSQQEALKVFDAYRFDIEDEVEMLIEQEEFDEQGRVVLI"
FT   gene            complement(52029..52571)
FT                   /locus_tag="Swoo_0049"
FT   CDS             complement(52029..52571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0049"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: spl:Spea_0042 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84350"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD03"
FT                   /protein_id="ACA84350.1"
FT                   /translation="MSSSLRSYKGVTPTLHQDVYIDEACVLVGDIDLDDDSSIWPLVAA
FT                   RGDVNHMKIGKRTNVQDGTILHVTRKSASNPNGHPLLIGDDVTVGHKAMLHGCTVGNRI
FT                   LIGMGAIILDGAIVEDDVILGAGSLVPPNKVLKSGFLYVGSPAKQIRPLTEAELKFLPE
FT                   SAENYVRLKNEYLQESV"
FT   gene            53358..54894
FT                   /locus_tag="Swoo_R0001"
FT   rRNA            53358..54894
FT                   /locus_tag="Swoo_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            55207..58101
FT                   /locus_tag="Swoo_R0002"
FT   rRNA            55207..58101
FT                   /locus_tag="Swoo_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            58220..58334
FT                   /locus_tag="Swoo_R0003"
FT   rRNA            58220..58334
FT                   /locus_tag="Swoo_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            58412..58488
FT                   /locus_tag="Swoo_R0004"
FT                   /note="tRNA-Asp1"
FT   tRNA            58412..58488
FT                   /locus_tag="Swoo_R0004"
FT                   /product="tRNA-Asp"
FT   gene            59053..61485
FT                   /locus_tag="Swoo_0050"
FT   CDS             59053..61485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0050"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: sse:Ssed_0046 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84351"
FT                   /db_xref="GOA:B1KD04"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD04"
FT                   /protein_id="ACA84351.1"
FT                   /translation="MTADYFYERSEKREEAISTEVAHIEQHLIRMQHIVESALSMQDSA
FT                   RIEQEISLAAADLSIMVYTVLNSKSVIRFANHLVWRDSLATQVIDGYDLELHRRTTKES
FT                   APTTFVNSERLSIQTYYPLHTNFQNDKADLHDLIYMEYDISPLINKVDNDVQSSFIRSV
FT                   AVSLIGILLFLLLMHIYLIRPLRTLGLKASSSAQLPNGLGSNDKPVTAIFSEVVAIQEH
FT                   LRDFSEKLSHSKKQLNDSQKRWLFAVEISKNGIWDWNLKSNEVFLSDRWKEMLGYEVDE
FT                   LKHELNTWQELLHPEDKIEALKLLNQYLNNEMEEFESVHRLRHKEGHYIWVLDRGMVVD
FT                   WDETGAPVRMIGTHTDVSDDVRNQQAIIHQTKHDILTGLANRSALLDELYALKVQQQGD
FT                   FAALFVIDLDNFKMINDALGHHRGDRILIKVAARLSSHFSTNVLIARLGSDEFVLLVKS
FT                   LGDDLTSVNRRTVALASQIRQMVGRSFHITNQTINISASVGICVLNDLANMEPEQMLQH
FT                   ADLAMHQAKEKGRDAHAIYNTEMEEIVQKSLWISSELKRAIVKEQLSLVFQPILDRDGE
FT                   IVCAEVLLRWTHPEKGPISPAEFIPVAEGSGLIQEIGYWVLKETCYFINRLKARGIVLS
FT                   SVAINVSARQFNQDLFVENLLTEIMEQGLAADTIELELTEYALLTNLDIIKQRMHVLKE
FT                   SGISIAIDDFGTGYSSLSYLQTLPLSRLKLDAAFVSKIGENDASNAIVKAIINMAHSLN
FT                   LKVVAEGVETQEQHQFLRDHDCDTFQGYLFSRPLDEEAFIQSLLKPNTIQDGKLTCL"
FT   gene            complement(61551..62552)
FT                   /locus_tag="Swoo_0051"
FT   CDS             complement(61551..62552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0051"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sse:Ssed_0088
FT                   lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84352"
FT                   /db_xref="GOA:B1KD05"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD05"
FT                   /protein_id="ACA84352.1"
FT                   /translation="MSLALDQQTHAQPQAADNTFSSEHALNTAEQQAFWQTVTQSVIKT
FT                   SDNINLAYAYVAHPGSTKAIVISNGRVESYLKYQELIFDLYQQGYSIYAIDHRGQGLSS
FT                   RTTANTHQGHIDRFDTYVEDFALFIDEIVTPNQHQELFLVGHSMGGAIGTLYLNKHPQT
FT                   FKAAVFSAPMYGIKLPISRRFIRWLAKQLDTSSPNKEPNYILGGKDYDPVAFAKNDLTH
FT                   SQLRYENYRTLYEIHPELKLGSPTNHWLFESIDAGEKTVEAAKNSDTPILILQADEDTI
FT                   VDNFAQYHAVSDRCMLINIPNARHELFMERDESRNLTLTELINFFDKYSAKP"
FT   gene            complement(62644..64419)
FT                   /locus_tag="Swoo_0052"
FT   CDS             complement(62644..64419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0052"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   sse:Ssed_0089 protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84353"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD06"
FT                   /protein_id="ACA84353.1"
FT                   /translation="MYRILVPSLLAISLTACQVNTAPEATSQTVQTQPNLSLQSMIDEA
FT                   WKITLDASPDFAYSQGDLAQAGKLTDLSPDSLAKLDNRRQVVLNKLKALDREALSKEES
FT                   INARILQDQLQNDVDLYRYKDHYLPISSESGFHAYIGSIAKDRFANEQDYTNYLKKLAA
FT                   LPQYFAQQTYWLEQGLAAGITPPKVTLNGFENSISAFLVPVEESGYFKPFTEFPKHFSE
FT                   AQRTALKKQGHKLIEKQVLPLYQQFYDFMTQSYIPNARTSIATASLPDGEAFYENRVRY
FT                   YTTLEMTSDQVHELGLEEVKRIRGEMEAIIAEVGFKGTFAEFLNFLRTDPQFYPKTKEE
FT                   LLKEAAYIAKKADAMLPKYFGKLPRTPYGIQEVPAEIAPKYTTGRYSGSSRDDEPGYYW
FT                   VNTYALDKRPLYEMEALTLHEAVPGHHLQIALNTELTSLPNFRRYSYISAFGEGWGLYS
FT                   EYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAKGWSRQQALDFMANNTALSLH
FT                   NVTTEIDRYISWPGQALSYKVGELTIKRLRAQAEQELGEKFDIRAFHDAILENGSVPMS
FT                   VLEQQIQDFILTQKG"
FT   sig_peptide     complement(64354..64419)
FT                   /locus_tag="Swoo_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.930 at
FT                   residue 22"
FT   gene            complement(64613..65953)
FT                   /locus_tag="Swoo_0053"
FT   CDS             complement(64613..65953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0053"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: sse:Ssed_0090 coproporphyrinogen
FT                   dehydrogenase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84354"
FT                   /db_xref="GOA:B1KD07"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD07"
FT                   /protein_id="ACA84354.1"
FT                   /translation="MIEKYNYSGPRYTSYPTALEFDDSFTEEKLLTSIANSKSDKLSLY
FT                   LHIPFCAKLCYYCGCNKVITRHQHKADQYIEYLAAEIVKRAPLFKNYLVTQIHWGGGTP
FT                   TFLSPDQILKLSSLIKEHFNVADKGEYSIEVDPREIELSMLDTLKEAGFNRISIGVQDF
FT                   NKKVQIAVNREQDEQFIFDLMARAKELGFVSTNIDLIYGLPHQTPETFAETMQRVLDLD
FT                   PDRLSVFNYAHLPARFAAQRKIKDEDLASPQQKLDMLHQTIETLTGAGYQYIGMDHFAK
FT                   PDDELSILQNEGRLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRPYYESVD
FT                   KLGHALWKGCSLNRDDEIRRVVIKQLICHFDLDMAQIDEKLGINFEEYFSEDLKLLQTF
FT                   IDDKLVDITDRKITISPTGRLLIRNICICFDVYYREKARQQQFSRVI"
FT   gene            complement(66211..66678)
FT                   /locus_tag="Swoo_0054"
FT   CDS             complement(66211..66678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84355"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD08"
FT                   /protein_id="ACA84355.1"
FT                   /translation="MTTVLLILGFIIVASLACYATILILKLRKQTADRLAKQAELDAAH
FT                   KAKLEEHLDSIRYIATAMLEDRCELSEGVMRIANLFNIISLSEQVANDYPAIFKHFAVI
FT                   ESHPIMAERKQLEKRARMKLDYARMRSEAELETEILQEAKQLTTFTPTPLH"
FT   sig_peptide     complement(66616..66678)
FT                   /locus_tag="Swoo_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.983 at
FT                   residue 21"
FT   gene            complement(66741..67277)
FT                   /locus_tag="Swoo_0055"
FT   CDS             complement(66741..67277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0055"
FT                   /product="protein of unknown function DUF414"
FT                   /note="PFAM: protein of unknown function DUF414; KEGG:
FT                   sse:Ssed_0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84356"
FT                   /db_xref="GOA:B1KD09"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD09"
FT                   /protein_id="ACA84356.1"
FT                   /translation="MAHSKKSRKANENSPKLAPRTKKNERVLSGKKKDTGNKAGSRHNK
FT                   KVVGSVNGTATQKKDPRHGSKVAVKLDLPSKVVAPKKEKGPKLTDEQKLLKLEDDPRLN
FT                   QLLDMLEEGRELPQDDQKWLEKQLNQIEALMERLGITEEDDLEHVMKSVTNSDDDLFDK
FT                   FESGADLLKDFQNKE"
FT   gene            complement(67341..68003)
FT                   /locus_tag="Swoo_0056"
FT   CDS             complement(67341..68003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84357"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD10"
FT                   /protein_id="ACA84357.1"
FT                   /translation="MHRCPLCHNTDTSLFHRNKKRDMYTCSHCQLIFSDATSHLPPQVE
FT                   KNRYLESNRKKQAALTQFLISLIAQCEQGSSAPLSGLNFGRVLDSSSLSSTGLHQHHIE
FT                   QYDPFFAPDHHLLKQHYDYICCYKVFEHFRFPFKEWSLLGTMLKPGGWLAISTKLLTDI
FT                   HSFDKWHHKNNLTHVSFYQRSTFEYLAEQAGFKLLFAANDLILVQKPSGSDITRGQS"
FT   gene            complement(68736..69356)
FT                   /locus_tag="Swoo_0057"
FT   CDS             complement(68736..69356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0057"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: sse:Ssed_0094
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84358"
FT                   /db_xref="GOA:B1KD11"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD11"
FT                   /protein_id="ACA84358.1"
FT                   /translation="MKKLALALSVLASISSPAMAEGNAEAGKTKAVVCSACHGVDGNSM
FT                   IDMYPKLAGQQATYLEKQMRDFRSAAQTGGKEGRNDPIMGGMAMMLSDQDIKDVAAFYA
FT                   SQTQTQVEVADIPELGEQLYKSGDVARGITACIACHGPSGAGSELAGFPAIGGQHANYL
FT                   TIQINKFRDTSRNNDLNGMMQDIASKLTTEDAEALSKYISSLK"
FT   sig_peptide     complement(69294..69356)
FT                   /locus_tag="Swoo_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            69541..70200
FT                   /locus_tag="Swoo_0058"
FT   CDS             69541..70200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0058"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   sse:Ssed_0095 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84359"
FT                   /db_xref="GOA:B1KD12"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD12"
FT                   /protein_id="ACA84359.1"
FT                   /translation="MDFRKAKFLISAPDIAHLNQYLPGDAGVEIAFAGRSNAGKSSALN
FT                   MLTDQKGLARTSKTPGRTQLINVFELDEHRRLVDLPGYGFAQVPLALKKKWQYALGEYL
FT                   QERQCLTGVVVLMDIRHPLKDLDMQMIEWAVESEIPVLALLTKADKMKQSERMKMINEV
FT                   RKHLGDYDDRVKVEAFSSLKGLGKPKVLSILNEWCHPEWLMEAIAEAEAADESEND"
FT   gene            complement(70532..70654)
FT                   /locus_tag="Swoo_R0005"
FT   misc_RNA        complement(70532..70654)
FT                   /locus_tag="Swoo_R0005"
FT                   /product="Spot 42 RNA"
FT                   /note="Spot 42 RNA as predicted by Rfam (RF00021), score
FT                   56.19"
FT   mobile_element  complement(71527..72834)
FT                   /mobile_element_type="insertion sequence:ISDde2-like IS
FT                   element"
FT   gene            complement(71559..72793)
FT                   /locus_tag="Swoo_0059"
FT   CDS             complement(join(71559..72437,72437..72793))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Swoo_0059"
FT                   /product="transposase"
FT                   /note="programmed frameshift; KEGG: spl:Spea_3706
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84360"
FT                   /db_xref="GOA:B1KD13"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD13"
FT                   /protein_id="ACA84360.1"
FT                   /translation="MTTQIPTHVKRTQRDYSLGFKLQVVAAVEKGDMTYKQAQSIYGIQ
FT                   GRSTVLTWLRKHGKMDWTQPVRITMPKTTKAKETPAQKIKRLEKELEDEHLRNLLLNEA
FT                   VDIIDAEYGAGLRKKVLSQGARSLQKQKVTSLNRACELLGITRQAIYQRETRELCRAIE
FT                   LAPVKAMVLDIRRFMPRVGGRKLYFLLKPKFIEKGIKLGRDNFFSYLKREGLLVKPKHN
FT                   YTKTTHSKHWMKKHPNLLKEFTPLSPEEVFVSDITYVQSEQGVHYLSLVTDAFSRKIMG
FT                   YELSDEMKATDVVKALKMTVNNRQYQGHAVHHSDRGLQYCSAVYQSALQKNGIRASMTD
FT                   GYDCYQNALAERVNGILKQEFLLYPCSNLDELKRLVEESVFIYNEMRPHLSLGMRTPNQ
FT                   VHKKDQQQEQLV"
FT   gene            complement(72902..75739)
FT                   /locus_tag="Swoo_0060"
FT   CDS             complement(72902..75739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0060"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sse:Ssed_0096 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 5'-3' exonuclease; 3'-5' exonuclease; SMART:
FT                   Helix-hairpin-helix domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84361"
FT                   /db_xref="GOA:B1KD14"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B1KD14"
FT                   /protein_id="ACA84361.1"
FT                   /translation="MAENSLLWHASATIENRSRNQSRILIMPKIAENPLVLVDGSSYLY
FT                   RAYYAPPHLTNSKGEATGAVYGVINMLRSLLNQYKPSQMAVVFDAKGKTFRNDMYEEYK
FT                   AQRPPMPDDLRTQIEPLHNIIRALGLPLVCIPGVEADDVIGTIATQASKEGRAVLISTG
FT                   DKDMAQLVDDNVTLINTMTNTIMGPEEVTEKFGVGPELIIDLLALQGDKADNIPGLPGV
FT                   GEKTAVAMLTGAGSVEQILAAPEKIPALGFRGSKTMPAKLAEHGEMLKLSYELATIKLD
FT                   VEMEQDWKELVIAPANKDDLVKYYGEMEFKRWLAEVLDNKGSSAQSSDNSADEEEVVPQ
FT                   AIDAEYETILTHEALDKWIEQLTKADLIAIDTETTSLDYMTAKLVGISFAVEVGKAAYL
FT                   PLAHDYLDAPEQLDFDEAIAKLKPLLEDPKLKKVGQNLKYDISIFANVGIKLQGVAFDT
FT                   MLESYVFNSVASKHNMDDLALKYLGHKNISFEEIAGKGAKQLTFNQIDLETAAPYAAED
FT                   ADITLRLHQHLWARLEKEPKLASVFTDIELPLVQVLSKIERQGVLIDSMMLGQQSQEIA
FT                   ISIDKLEQDAFEIAGETFNLSSPKQLQALFFEKLGYPVIKKTPKGAPSTAEEVLVELAL
FT                   DYPLPKIILQHRSLAKLKSTYTDKLPLMVNAQSGRVHTSYHQANAATGRLSSSEPNLQN
FT                   IPIRTEEGRRIRHAFIAQEGKKVLAADYSQIELRIMAHLSQDKGLLTAFAEGKDIHKAT
FT                   AAEVFGVDFSEVTTEQRRRAKAVNFGLIYGMSAFGLARQLDIPRGEAQKYIDTYFDRYP
FT                   GVLKYMEDTRAEAADLGYVSTLYGRRLYLPAIKDRNAMRRQAAERAAINAPMQGTAADI
FT                   IKKAMINIASWIESETHGEITMIMQVHDELVFEVDSDKAEALKEQICKMMADAVSLDVE
FT                   LLAEGGIGDNWEQAH"
FT   gene            76061..76714
FT                   /locus_tag="Swoo_0061"
FT   CDS             76061..76714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0061"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sse:Ssed_0097
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84362"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL21"
FT                   /protein_id="ACA84362.1"
FT                   /translation="MKKIAVLLSGAGVFDGSEIHESVLAMLALDKLGAEYQCFAPNINQ
FT                   MHVVNHLTGEVEAGEQRNVLIESARIARGEVKATDELDIAIFDGLIIPGGFGAAKNLCN
FT                   FATNGSDCEVSPEVSVFIREFVEASKPVGFICIAPIMIPRLYGEGVNGTIGSDLETAQA
FT                   FNLMGGIHQAAEVQEIIVDEERKVVSTPAYMLAGSISEANIGIEKLVKKVLELV"
FT   gene            complement(76751..77587)
FT                   /locus_tag="Swoo_0062"
FT   CDS             complement(76751..77587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0062"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: sse:Ssed_0098
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84363"
FT                   /db_xref="GOA:B1KL22"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL22"
FT                   /protein_id="ACA84363.1"
FT                   /translation="MIEIGRLPNERAAQALVDYLKGENVDCKVIPSEQGVIIAVVHDHD
FT                   SLKATMEFQQFVLNPHDDKYLQASWDNGDTRLKMDYGAPSLQLLTQFISGAGPLTLAVF
FT                   FICILVFAGFNLGFANPIYEYLSFFGAAPGPDLSQFWRIFTPILLHFSALHIIFNLLWW
FT                   WYLGGKIENKLGVAPLFILLLVAGTVPNLVQYYVSGPNFGGLSGVVYAVVGYTWIMGVK
FT                   RPELGIGLPPAYIGFMLLWLVFGFTDLFGLSIANCANVGGLVVGLLQGFIDSKRRV"
FT   gene            complement(77716..78024)
FT                   /locus_tag="Swoo_0063"
FT   CDS             complement(77716..78024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0063"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: sse:Ssed_0099
FT                   rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84364"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL23"
FT                   /protein_id="ACA84364.1"
FT                   /translation="MSTFQHLSVSQLIQLSETNPETQIVDIRDAASFESAHIKDSINLN
FT                   NDNLANYIAEADMDQPLIVVCYHGISSQGAAQYMVEQGFDEVYSLDGGYQAWRESED"
FT   gene            complement(78097..79122)
FT                   /locus_tag="Swoo_0064"
FT   CDS             complement(78097..79122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0064"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /note="TIGRFAM: L-threonine 3-dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: spl:Spea_0106
FT                   L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84365"
FT                   /db_xref="GOA:B1KL24"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /protein_id="ACA84365.1"
FT                   /translation="MKALSKLKPEEGIWMVDAPKPEMGHNDLLIKIRKTAICGTDVHIY
FT                   NWDEWSQNTIPVPMVVGHEYVGEVVDIGQEVRGFSIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELAQKMGATRAVNVAKEDLKD
FT                   VMSELGMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKVAMLGIPGGDMAIDWSKVIFKGL
FT                   IIKGIYGREMFETWYKMASLIQSGLDISPIITHHYKVDEFQQGFDAMRSGQSGKVILNW
FT                   D"
FT   gene            complement(79134..80327)
FT                   /locus_tag="Swoo_0065"
FT   CDS             complement(79134..80327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0065"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: sse:Ssed_0101 glycine C-acetyltransferase;
FT                   TIGRFAM: 2-amino-3-ketobutyrate coenzyme A ligase; PFAM:
FT                   glycine hydroxymethyltransferase; aminotransferase class I
FT                   and II; aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84366"
FT                   /db_xref="GOA:B1KL25"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL25"
FT                   /protein_id="ACA84366.1"
FT                   /translation="MAKTSFYDQINQQLTQVKAEGLYKSERIIVSPQQTEIQVNGAEVM
FT                   NFCANNYLGLANHPELVKAAQGGLNDHGFGMASVRFICGTQDIHKQLEASLSEFLGMEN
FT                   TILYSSCFDANAGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRFRYANNDMAELEA
FT                   QLKAAKEAGARNIMIATDGVFSMDGVIANLNGVCDLADQYGALVMVDDSHAVGFVGQNG
FT                   RGTHEHCQVMDRVDIITGTLGKALGGASGGFTSAKKEVVDWLRQRSRPYLFSNSLAPSI
FT                   VTASIHVLEMLKSGQALREAVWENSRYFREKMTEAGFTLGGADHAIIPVMIGDAKLAGD
FT                   FASRLLEENIYVIGFSFPVVPKGQARIRTQMSAAHTKAQLDKAIEAFTRIAKEMGII"
FT   gene            complement(80590..81237)
FT                   /locus_tag="Swoo_0066"
FT   CDS             complement(80590..81237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0066"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sse:Ssed_0102
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84367"
FT                   /db_xref="GOA:B1KL26"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL26"
FT                   /protein_id="ACA84367.1"
FT                   /translation="MKTRDKIIYASLELFNEKGERNITTNHIAAHLGISPGNLYYHFRN
FT                   KEDIIRSIFSLYQAHLETSFQPYEGEPATIDLLIGYFDAMFYAMWEFRFMYANLTDILN
FT                   RDEELKSLYLVTQQQVLTRCSHVLSKLNQDGVIAIDEEEIPHLAETIRMIVCFWIGYKQ
FT                   THSSQMEITKSSLYEGLLRILMISKAYSTSESRTTFVRLEQHYRELAAAPIE"
FT   gene            81515..82780
FT                   /locus_tag="Swoo_0067"
FT   CDS             81515..82780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0067"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: sse:Ssed_0104
FT                   three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84368"
FT                   /db_xref="GOA:B1KL27"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL27"
FT                   /protein_id="ACA84368.1"
FT                   /translation="MNRFLYSVLLYLLLPLLVLYLAFRAIKSPDYRGRWGERFGLSKLK
FT                   QSDLLIHSVSMGETLAAIPLIKAVQQQYPQMSITVTTTSPTGSAEVIKALGSSVQHCYL
FT                   PFDISVCVKRFLNQVSPKQIIIMETELWPNLVHQASKLGVKIMLANARLSQKSADQYQK
FT                   RITLSLPMLQSLDMIAAQSQQAAERFVALGVSPDKVKVCGSLKFDLTIPAEKLVQARAL
FT                   RELWRDNNAPIWVAGSVHPGEFDAMLKAHKRLLLENPDALLIMVPRHPEQFNTAAEQIT
FT                   ASGLSLARRSQQDEVSATTQVLLGDTMGELLTFYGAADQAFVGGTLIDNGGHNPLEPAA
FT                   LGLPVYVGPNHWDFAEIAGLLNDAGALKVIASGEELATELLAKFHDKPTYQAASEAGLR
FT                   VVDANKGALKQQFELACTLIDA"
FT   gene            complement(83377..84135)
FT                   /locus_tag="Swoo_0068"
FT   CDS             complement(83377..84135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0068"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: protein of unknown function RIO1;
FT                   lipopolysaccharide kinase; KEGG: sse:Ssed_0105
FT                   lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84369"
FT                   /db_xref="GOA:B1KL28"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL28"
FT                   /protein_id="ACA84369.1"
FT                   /translation="MPIASPVTTPTEMQIISSPQGAIAVCHPTPDTISSNWFTMEYWQQ
FT                   KSAITGSSKGRYTTWFVKPDLSEGDDSQWVLRHYYRGGLMEKLSKDSYLYTGLHKTRAV
FT                   AELALLVQLYNEGFPVPKPVAANVERHGLHYRADIIIERVEGAQDLVAKLSKSPMSDSQ
FT                   WQQLGSGIAQFHQRGVYHADLNAKNILITDDKFYLIDFDRGEIRQPSTKWQTANLERLQ
FT                   RSFNKEKGILSSLHFTQENWQALMVGYSKG"
FT   gene            complement(84272..86230)
FT                   /locus_tag="Swoo_0069"
FT   CDS             complement(84272..86230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0069"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: psp:PSPPH_5170
FT                   acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84370"
FT                   /db_xref="GOA:B1KL29"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL29"
FT                   /protein_id="ACA84370.1"
FT                   /translation="MLFRKDINGLRAMAIIAVLLFHFDANLLPGGFTGVDVFFVISGYL
FT                   MTTIIFNGIEQNRFTLSGFYSSRAKRILPPLAILCISLLIFGWINFSASDYRDLAKHAA
FT                   SSIAFVSNFIYANETGYFTASATEKWLLHTWSLSLEWQFYMLYPLLILGLKKRFSVDAI
FT                   KLWLVSLTLASFMFGLYMSSHLPEKAFFHLPFRAWELLFGGLLFLYPLKLSPQLSKPVE
FT                   VSGMVMILLSYLFISSNNAWPSYLTLLPVFGASMIIIANRQESLFTNNLIMQKLGNSSY
FT                   SIYLWHWPVCIYLYQMGYMQNSGVVLMGVLASLILGWLSYKLIEQGKITRYLPTQLLTP
FT                   KWLFTITLVAGITIYQLHGITSEIRPYSTTAQAKFLEEYEHFPLQGAYLDQCNAYHSLK
FT                   STGEAKIAASCNHSDGGTGGVMLWGDSHAQALSLGLRETLPDTINFYQVASSGCKPSLK
FT                   QSDDQSSLAQACNTSNQIALETISRIKPDIVIIAQANHHEDTNWEQIEAKLAQLGAKET
FT                   VLIGPVPQWRPSLPYVIAERHWQEKGQYITDQALDNSILISDDKLDIQTQDEDITFISL
FT                   VDSLCIDKEMTCLAKTDKQQLLVFDYGHLTQAGSRLIAKQVIVPQLIKRLSAKPGYTFE
FT                   ELAKAAPQQTHIERYSK"
FT   gene            86534..87577
FT                   /locus_tag="Swoo_0070"
FT   CDS             86534..87577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0070"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   slo:Shew_3702 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84371"
FT                   /db_xref="GOA:B1KL30"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL30"
FT                   /protein_id="ACA84371.1"
FT                   /translation="MSLNLNSITSLCLLRLSAIGDVCHAVAMVQAIQKQYPNLKITWVI
FT                   GKVEYQLLKHLPGVEFVIFDKSQGWRSYFNLRKALAGQRFDVLLHMQVALRATIASLAI
FT                   SAKTRIGFDRARAKEGQWLVTNHRVDAIASPHVLEGFMGFAKTLGVTELTPQWNIPVPE
FT                   ADTEFAKLLLPDGERSLVICAAASKAERNWLPERYAAVAEHAIAKGYRVILCGGPTELE
FT                   QTLAQQIVSHSSRPLENQVGKTTLTQLLAVLKQASIVLAPDTGPAHMAVTQGTPVIGLY
FT                   AHSNPGRTGPYMSLEHVVSVYDKAIASQHSQPVVWGTRAKGEHLMEMIEVAPVLSVFDD
FT                   LAREFDK"
FT   gene            87624..88520
FT                   /locus_tag="Swoo_0071"
FT   CDS             87624..88520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0071"
FT                   /product="exopolysaccharide biosynthesis protein-like
FT                   protein"
FT                   /note="KEGG: pna:Pnap_3188 exopolysaccharide biosynthesis
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84372"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL31"
FT                   /protein_id="ACA84372.1"
FT                   /translation="MQELKRVLFELSAQEFVFIPNPGNAGDSLINAASFQFLDDMKLNY
FT                   KVISPREIKQTLKKGRSIVDKFNLKDKVIVLGGGGGFTEHYPYSNALVSALDKQVKQLI
FT                   LLPCTIEGYQETLSGLSDRVTVFCREKVSFEYLNRVCNGPTIYLSHDMVFAADFTRIMA
FT                   VTSSLSSIRNRIKAAKSRAQVADYIKRNGIVKLNALRLDEERSDIEVPTENMDMSALFS
FT                   LGTKTKATNFYAAQEFLSHLDKFEQVVTNRLHVCIASTLLGKQVTFLDNSYFKNRAVFD
FT                   RSMGKFNNVKLVSELPS"
FT   gene            complement(88492..89340)
FT                   /locus_tag="Swoo_0072"
FT   CDS             complement(88492..89340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0072"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   slo:Shew_3699 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84373"
FT                   /db_xref="GOA:B1KL32"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL32"
FT                   /protein_id="ACA84373.1"
FT                   /translation="MTSSLIITTYNWPEALARVLESVMSQSVTPDEIIIADDGSTEETK
FT                   EVIRQYQGRSSIPIIHSWQEDNGFRLSRSRNKAISVAKMDYIIMIDGDMILHHKFIADH
FT                   LKHAEKGFFITGKRVKLSAELSQKQFKSPKPLTLFSRGLSRGRENAFRLAWQPKLMSKT
FT                   QTTSVEGIHGCNLAFWKADVLTVNGFNTQFEGWGPEDKEFALRMINSGIKRKRLKYAGI
FT                   AFHIYHDESPKTLLEANRAIFEDIQINRARWCPLGINEFIAVELPQVDEFDASLVTHSL
FT                   A"
FT   gene            89663..90418
FT                   /locus_tag="Swoo_0073"
FT   CDS             89663..90418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0073"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sdn:Sden_0205 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84374"
FT                   /db_xref="GOA:B1KL33"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL33"
FT                   /protein_id="ACA84374.1"
FT                   /translation="MDHPNVSFVLTSCNRFDLLEETLISFFKFNTYPIAQYVIIEDSHN
FT                   RDKLDRVLAKFPDIDFTVLNNEPQLGQMKSIDRAYSVVTSEYIFHCEDDWEFYREGFIE
FT                   ESFKVLNADEKVVTIWLREQDDTNEHPVEPEIFYCGEDNSTPYQIMMRNHRRREHSSLW
FT                   HGFTFNPGLRRLKDYQLFAPIGELGGELNMSELYHEKGFKAAIFPKGSVRHIGDHRGIR
FT                   YKVGQSQLAKDFSVGFKRVKAKVCHILGI"
FT   gene            complement(90750..91508)
FT                   /locus_tag="Swoo_0074"
FT   CDS             complement(90750..91508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0074"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sdn:Sden_0206 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84375"
FT                   /db_xref="GOA:B1KL34"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL34"
FT                   /protein_id="ACA84375.1"
FT                   /translation="MKLPISVFIITKNEEKHIEKTLQSVALLDEVILVDSGSTDGTLAI
FT                   AERYGAKIYSHPWQGYAKQKQYAMSLCSHEWVLNLDGDEAINTSLIEAFKTIMEQDKAD
FT                   SVRFWRNDIFIDKPLSSWSKKPNNHRFYKRSKSFFDDSRLAHESATVDGKEIFINETFD
FT                   HFGYCSIEAITSKNNSYSGLKADEKFAKGKKFSNLKLITVFPLIFIKEYFIQRKIFSGR
FT                   RGFILAVMDAYYAFIKEAKLYEHHQLKDNK"
FT   gene            91689..92378
FT                   /locus_tag="Swoo_0075"
FT   CDS             91689..92378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0075"
FT                   /product="glycosyl transferase family 25"
FT                   /note="PFAM: glycosyl transferase family 25; KEGG:
FT                   sdn:Sden_0207 glycosyl transferase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84376"
FT                   /db_xref="GOA:B1KL35"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL35"
FT                   /protein_id="ACA84376.1"
FT                   /translation="MTKQCEPLGITPERVSAVRGSLLSEKEKSDVYQLSANLSKYDKIL
FT                   NDGEIGCYMSHIRCWEQIVEQELDFALVLEDDAILTDNIIKYVEKLAPSSADWDYIKLS
FT                   HGSKVKSAVDSMDLGDGLTLRKELKLPSTTTGQLISLSGAKKLLAHAYPITRPIDMDIQ
FT                   YWFEKSLRCFVVAPFPILNGDFGSEINKTDDRRFVKKRPIRRVLQKLRYEILLLCSRHK
FT                   LPDFPKL"
FT   gene            92528..93004
FT                   /locus_tag="Swoo_0076"
FT   CDS             92528..93004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0076"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: shn:Shewana3_4091 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84377"
FT                   /db_xref="GOA:B1KL36"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /protein_id="ACA84377.1"
FT                   /translation="MHKRAIYPGTFDPVTNGHADLIERAAKLFQHVVIGIAANPSKQPR
FT                   FTLDERVQLLKLVTAHLDNVEVVGFSGLLVDFAKDQQASVLVRGLRAVSDFEYEFQLAN
FT                   MNRRLDPDLESVFLTPSEENSFISSTLVKEVALHGGDVSQFVHPEVSKALLSKG"
FT   gene            93017..94522
FT                   /locus_tag="Swoo_0077"
FT   CDS             93017..94522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84378"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL37"
FT                   /protein_id="ACA84378.1"
FT                   /translation="MLKSYSTKLIAVFLFCTSLLSASFAALSAPWVDVSDIYLRADIQA
FT                   LADEGVITVPVNTYPLMWSGIAVDLDKVEPSTLTPALAKAFARVNFYYRNAVGNKGNTR
FT                   IKAAAATDPARFQHFGSDYREKGELQVSHEYLGERFAYKIAASANYDATDDKEFRLDDS
FT                   YIAMALGNWMFTAGAIEQWWGPGFDSAMHRSNNARPLPSVMVTRNNAAAFETPWLSWLG
FT                   PWTLTAGVSRLEEERAIANPLLWNFRSSLRPFRQLEIGFSWATQFCGEGEECSFKSALK
FT                   SITGQRDCRAENVGEVGCSSYGNQMAGYDVRFSDTWFNVPFGIYYEKTCEDANGSAPWD
FT                   IVDCGHAAGLDTRFSSDSAQYRLFFEYTDTMVACGADDNVFNCMYEHSEYKSGSRYYGK
FT                   TYGSTYESDAIVYALGLIGQFENSKGLTSIVRYAQLNKDGSSRNNGWAPQSPKEDLLML
FT                   ELSYRMPIWQGMMSVGGTVSQSEFEVEDKKTDATLFGTYEYRF"
FT   sig_peptide     93017..93103
FT                   /locus_tag="Swoo_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 29"
FT   gene            complement(94604..95419)
FT                   /locus_tag="Swoo_0078"
FT   CDS             complement(94604..95419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0078"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: sse:Ssed_0117 DNA-formamidopyrimidine
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: zinc finger Fpg domain protein;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; Formamidopyrimidine-DNA glycolase, H2TH DNA
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84379"
FT                   /db_xref="GOA:B1KL38"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /protein_id="ACA84379.1"
FT                   /translation="MPELPEVEVTRQGVSPYLIDQEVTGLTVRNASLRWPVPDLAQQIV
FT                   GQTIRSVHRRAKYLLIDTDAGTTIVHLGMSGSLRVVTELTPVEKHDHIDLSLASGKILR
FT                   FNDPRRFGAWLWYELPIDAHPLLSKLGPEPLTDAFNPSYLFESLKGKKKAIKLCLMDNH
FT                   IVVGVGNIYANEALFAAGIHPQMEAGKVDQERLIILVSEVKQILANAIKQGGTTLKDFT
FT                   NAEGKPGYFAQKLHVYGRGGESCTQCGNLLSEIKLGQRATVFCGLCQTR"
FT   gene            complement(95488..95976)
FT                   /locus_tag="Swoo_0079"
FT   CDS             complement(95488..95976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84380"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL39"
FT                   /protein_id="ACA84380.1"
FT                   /translation="MALSRKKWNNILIFATASMIAILTLLDDRTAELPSDAAPLFDDKA
FT                   PLAQLQLDELWLSKGSQWQCHEDVLNCKTWATAWSEIQLSPVADQQGLMEQESLDAPIN
FT                   VTILVANNSQGQAWLWYPAHGLLVSPAKNWYQIPPSLREALTPITKISAAPLNDTTSN"
FT   sig_peptide     complement(95896..95976)
FT                   /locus_tag="Swoo_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.562 at
FT                   residue 27"
FT   gene            96780..98267
FT                   /locus_tag="Swoo_0080"
FT   CDS             96780..98267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84381"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL40"
FT                   /protein_id="ACA84381.1"
FT                   /translation="MRYEASELELAFVSLNKNERPLWALAAVFISYVCMLFLMFFAEKY
FT                   VGGTILHFIVQPFVVGFCTRYVGRLYSIKARAPSVILFAFLYICIGVLASLQALYFIAL
FT                   PIPMLIVFFTSRIKLTRVQEFALLEYQTTSLDIDLHPRSRKTLYAFLGVLFITALTVYW
FT                   WTSNANSCMNALEGSNNSFVVESCSYNQFSSLEEMATIEDELSIDLFGTFSLPSPEALL
FT                   IKEKAESGDVFYQRFYFVILAIFYQKSVLWEGNFIVERHREEVAYWSAITAADGFTPAM
FT                   IKILNGLLDLPLVSEEQKLEAMDLAEELVINGSEEAYLLTLVGKLVTIEDVRQLFHQQS
FT                   NTLDLLTEEQLENLMYAYKQGDYFYNLSDFDPSIEVEEPYTKSIRVPRQKDKVIDVLKV
FT                   MSKKFNDTDASYQVAQMLLRESSLESIDFFTLAAEQGHAYAATKLGSLYFCSGRKVESL
FT                   SWLKRAIKLGSKEAVAIQRKIIKGESLSVCQRGDRKL"
FT   gene            99563..100954
FT                   /locus_tag="Swoo_0081"
FT   CDS             99563..100954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_0885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84382"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL41"
FT                   /protein_id="ACA84382.1"
FT                   /translation="MVAIDMNILIAGVVLCFIGISALFFTLKKRKSILLTATKEAETLL
FT                   SQSQAKASNIVNSAEKTKKNLLDEAENRKRFLLEEAEQGVIPFHERVERLKLADKEITS
FT                   RLKQSRSIIDDITDKSCSHAADIELLTEEDLLSSQSYQDDRKDVKARLKKLAVNAIDGV
FT                   RGSGSNVNIGKFVSISAKADMAGALLLTTVEMLCTKTNANNGHQALEKLSESIIATEAL
FT                   IKCIDSRATINQEFKALLIKRLEIEIHFKKAKQLAKEEQRELREQEKEERNARQEAERI
FT                   QKEAEKEERIKSDAIAELEKKMAEKSDAEKAIYQEELNRLKLELEEAHQKFERAKSRAQ
FT                   ETKQGHVYVISNIGSFGEDILKIGMTRRMDPMDRVKELSDASVPFTFDVHALIESDDAP
FT                   NLESTLHKVFDDKRVNKVNRRKEYFNVNLSEIEQELQRLDINALINKVASADEYYQSIR
FT                   LEKCL"
FT   gene            complement(101573..102559)
FT                   /locus_tag="Swoo_0082"
FT   CDS             complement(101573..102559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0082"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sse:Ssed_0119 molybdenum cofactor biosynthesis
FT                   protein A; TIGRFAM: molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84383"
FT                   /db_xref="GOA:B1KL42"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL42"
FT                   /protein_id="ACA84383.1"
FT                   /translation="MSLIVDTFGRTVEYLRLSVTDRCDFRCVYCMSEDPCFLERDQVLS
FT                   LEELAWVGQAFTELGVKKIRLTGGEPLVRTDCDRLVKLLGELPGLTELSMTTNGSRLTK
FT                   FAQKMRGSGLARLNISLDTLKPELFTDLTRNGKLERVIQGIDAAKAAGFKRIKINAVIL
FT                   RGQNDDEVLDLIEFCRGRELDIAFIEEMPLGIIDERKKSRHCSSEEVKAIISQRYPLTV
FT                   SDKRTGGPARYYTMPGSSIHVGFISPHSNNFCHECNRVRVTVEGRLLLCLGNEHSVDLK
FT                   AIVREFPGDIERLKTTILEAIKRKPKEHVFGDEGDVQILRFMNATGG"
FT   gene            complement(102581..104386)
FT                   /locus_tag="Swoo_0083"
FT   CDS             complement(102581..104386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0083"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B; PFAM: molybdopterin binding domain;
FT                   molybdopterin-guanine dinucleotide biosynthesis MobB
FT                   region; MoeA domain protein domain I and II; MoeA domain
FT                   protein domain IV; KEGG: sse:Ssed_0120
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84384"
FT                   /db_xref="GOA:B1KL43"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012182"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029007"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL43"
FT                   /protein_id="ACA84384.1"
FT                   /translation="MSTPFTNPLSIPVLGFCAYSGTGKTTLLKKLIPELNNRGIKLAVI
FT                   KHAHHNFDVDIPGKDSYEMRKAGARQMLVASHIRWALMTEDEVDEAPELPHLLQQIEQD
FT                   AVDIVLVEGFKKLELPKIELHRAAHGKPFIHTHDSNIQAIACCDDTQVPSELRRLDIND
FT                   VGQIADFVIEYAQNWQPTSKLPLTPQTPECGCELDSSKTLSVCQGIEKILSYVTPVTEH
FT                   KLVELDELNGRVLAQDAISPVDVPQQTNSAMDGYAFNYSEPMLESYTLVADVMAGHQYA
FT                   GTLQAGEAVRIMTGAPVPAGADTVQMKELATESGNNVSFQGDITLGQHVRLAGEDIAKG
FT                   KTALAAHNRLQAPEQGMLASLGFGKLPVFRRPKVAVFSTGDEVCEPGEPLKASCIYDSN
FT                   RFTIKSMARKLGCEVIDLGIIHDSEEALADALSQAAVKADVVISSGGVSVGDADFIKLA
FT                   LEKVGQINFWRINMRPGRPLAFGQIGDSLFFGLPGNPVAVMVSFMQFVQPALRKLAGEK
FT                   NWSQTMVPAVADCKMRSRVGRTEFTRGVFHLAADGKLHVTTTGAQGSGMLSSMVKGNCF
FT                   VVIGEQDEQLNPGDTVYIQPFADLL"
FT   gene            complement(104401..104991)
FT                   /locus_tag="Swoo_0084"
FT   CDS             complement(104401..104991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0084"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: slo:Shew_3686
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84385"
FT                   /db_xref="GOA:B1KL44"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /protein_id="ACA84385.1"
FT                   /translation="MSLRIDAVILAGGMARRMGGNDKGLVELLDKPMIEHSIDRIKPQV
FT                   KEIMINANRNQSRYADLGYPVFSDEDSGYLGPLAGMITAMGQTQADYLLVVPCDCPLLP
FT                   LDLVERMLTKIQSEGAELAVASDGKREQPVVLLLKPSLRDSMKAFLDGGERKIDFWYAK
FT                   HHCVVTEFSDQPNAFINVNTPEQKQQLAEAIAK"
FT   gene            complement(104975..105694)
FT                   /locus_tag="Swoo_0085"
FT   CDS             complement(104975..105694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0085"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sse:Ssed_0122 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84386"
FT                   /db_xref="GOA:B1KL45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL45"
FT                   /protein_id="ACA84386.1"
FT                   /translation="MVKVIAQNIEMRFGERRLFAVERIQLSQGQTVHLQGDNGSGKTTL
FT                   MKMLAGLIAPTKGQITTQGFAPLPWWRSNSLLGKAVYLHQHPYLFDGSVEYNLRYPHPF
FT                   CTISKQLIEQRTQDAIEKAGLTHLTKQAASSLSGGERQRLAIARAWIMQPKLLMLDEPT
FT                   SNMDTYSQELVLAMVKDLQQLGTGMLVSSHQSCALTSLCDQNWRIENQGISSSINDASC
FT                   ATSPQTTLQEPRYVIAN"
FT   gene            complement(105698..106405)
FT                   /locus_tag="Swoo_0086"
FT   CDS             complement(105698..106405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0086"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sse:Ssed_0123
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84387"
FT                   /db_xref="GOA:B1KL46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL46"
FT                   /protein_id="ACA84387.1"
FT                   /translation="MNEGWLALIQQALGLLFSLDPDVWSIVSVSFSVSFAALAITLLPS
FT                   MILGFILAFGRFRGRWFITNMIQTLQSIPTVVIGLLVYLMLTRMGPLGDLRWLFTQKGM
FT                   ILGQMLICAPVLVSMSQAAFTSVDRRAWETSRTLGASWFRSIWTLCRELKVPLLLAIVA
FT                   GFSRILTEIGCSMMVGGNIADVTRNIPTAIALETSKGDFAQAIALGLVLLILSLVLNFT
FT                   LGTLRGKAEPRSH"
FT   gene            complement(106500..107312)
FT                   /locus_tag="Swoo_0087"
FT   CDS             complement(106500..107312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0087"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: sse:Ssed_0124 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84388"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL47"
FT                   /protein_id="ACA84388.1"
FT                   /translation="MLNLKSIFSLALAATLVTAMPATAEEIIKLATTTSTENSGLLKNL
FT                   LPKFEAETGYKVQVIATGTGKALKLARQGDVDLVMTHAPAAEAKFVNEGFGILPRGIME
FT                   NDFVILGPKNDPAKIRGSKTAEEAFAKIAKSGATFISRGDNSGTNMKELIIWKNADIAL
FT                   TFNGYKAVGQGMGKTLLMASELQGYTLSDRGTFVAYKAKLDLAIDYDGGKALANPYQIV
FT                   LINPEKYPELNHKGARAFSDWLIGAEAQGMINSYKVQGEQLFKATYSE"
FT   sig_peptide     complement(107238..107312)
FT                   /locus_tag="Swoo_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            107595..108974
FT                   /locus_tag="Swoo_0088"
FT   CDS             107595..108974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0088"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: sse:Ssed_0125
FT                   two component, sigma54 specific, transcriptional regulator,
FT                   fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84389"
FT                   /db_xref="GOA:B1KL48"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL48"
FT                   /protein_id="ACA84389.1"
FT                   /translation="MSQSNKELKPLPSAVSVLIVDDEPGMRSFLKKALSKKFALVETAS
FT                   SVEDAEQLRSRCHFDLLIVDIRLPGRSGIEWHEALNDQERRSDIIFMTGYADMDVAIKA
FT                   LRAGASDFIMKPFHLEQMMKAVDRCIERRLLKRENLMLRREVSIGQSSTIIGSSDAMQE
FT                   VKHIIERVAPTNAVILIEGESGTGKELVARQLHLLSGRQGPFVPVNCGAIAPELLESEL
FT                   FGHCAGAFTGAKGNREGLFSFASGGTIFLDEIGEMPLKMQTALLRVLEQRTIRPVGSEK
FT                   ETNIDVRVLAATNRKLAEEVEAGHFRRDLYYRLNVLDILIPPLRERPEDVVELTHHFTR
FT                   QLASELGVKEVVWSHEDMLKLQQHEWPGNIRELRNMIERCILLGKPPAEYWKQQPKAEV
FT                   VGESGYPLNWCLKEVEKHHVTQVVDAHNGNKSAAARDLGVSRKTLDRKYKEWFDSESAG
FT                   E"
FT   gene            108979..111096
FT                   /locus_tag="Swoo_0089"
FT   CDS             108979..111096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0089"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: sse:Ssed_0126 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84390"
FT                   /db_xref="GOA:B1KL49"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL49"
FT                   /protein_id="ACA84390.1"
FT                   /translation="MSFFPRIFGINWQQMQAKVRYRILILTLLPILLTLVSLVFITIYW
FT                   NISYTGKQLFMKVKADLTVANNTLISVQRSQEKQLEMVMESWPFQNDFRLFSGTKQKYR
FT                   DEIDSLLEERKEQLNLDFLRLVSVSEAAADPDLRQMLQRVNGVTPFSGLMVLSPERLAR
FT                   IDPELVKLASIPLVETPRSQKPSKSVEERGMLSRSLLPVPDAHGNVSWYLDGGILFNRD
FT                   IRIVDHIRDLVYDKGTLPERSIGTVTIFLDNTRISTNVPLHFFPQGDQSVGRALGSLVS
FT                   EEVKSKVLTQGMLWVDRAFVFNDWFISAYAPLEDVQGKRVGMIYTGFSESPFIHNYLLN
FT                   IIELGTILMLVLLVSGLLVYRGAYSLLQPIERIHHVVKAVQSGRNLRIGSLGLERDNEL
FT                   SNLAEQFDRMLDLLQKRNTQIQAAAEQLEVKVEERTRSLQEKTVELQNNVELLNETRQQ
FT                   LVTNEKLTALGELTAGIAHEINNPTAVILGNMELLKFELGQNADCVEEEIELVIQQVGR
FT                   ISTIIRSLLQYSRPGEFNAPLEMHQLTPIIEEMLVLVRHSIKEQKVVLTQELNASYPIE
FT                   VNRPQLLQVLINLVVNAAHAMNEDGRIWIRTYDWVVKDEPIGVKIEVEDEGKGIPKEQL
FT                   NRIFDPFYTTRADGTGLGLSLSYGIIKRIGGTIEVSSTVGKGTLFTIGLYHKAKEDQND
FT                   TPYKGLHFNES"
FT   gene            complement(111433..111532)
FT                   /locus_tag="Swoo_R0006"
FT   misc_RNA        complement(111433..111532)
FT                   /locus_tag="Swoo_R0006"
FT                   /product="ryhB"
FT   gene            complement(111663..112127)
FT                   /locus_tag="Swoo_0090"
FT   CDS             complement(111663..112127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0090"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sse:Ssed_0127 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84391"
FT                   /db_xref="GOA:B1KL50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL50"
FT                   /protein_id="ACA84391.1"
FT                   /translation="MYQVEIVQATIVTPELLQSLMELNQAIPEFDNAYPMTEYQTRLSD
FT                   KPMLALFIKVEGEVAGFKLGYERDNGQFYSWLGGILPEFRGLGLAKQLLQTQERWAKEQ
FT                   GYHQIEVKTLNRFTSMLKMLISNQYQITNLKQDTDKLELNKISLQKSLVA"
FT   gene            complement(112335..113006)
FT                   /locus_tag="Swoo_0091"
FT   CDS             complement(112335..113006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0091"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   sse:Ssed_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84392"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL51"
FT                   /protein_id="ACA84392.1"
FT                   /translation="MLTLTTTQVRRALLLLVGFHISIICASNYLVQLPFQIFGFHTTWG
FT                   AFSFPFVYLATDLTVRIFGQSPARRIILKAMLPALLISYLMGVLFHQGSFQGLSSLSEF
FT                   NTFVFRIAFASFAAYLVGQLMDITVFAKLRDTRSWWVAPAASTLIGNLVDTIVFFALAF
FT                   YASTDAFMAQHWPEIATVDYGFKLIVSLGLFLPAYGVLLKILEQKIVNPSQATGDQQNL
FT                   A"
FT   gene            113367..114047
FT                   /locus_tag="Swoo_0092"
FT   CDS             113367..114047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84393"
FT                   /db_xref="GOA:B1KL52"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL52"
FT                   /protein_id="ACA84393.1"
FT                   /translation="MATPQTIQVATESWLGYTNEDGTGFYFDILKHVFPQKDWTLEIDI
FT                   APFSRVRYLLNHERADIALGFYVGDKTKALYSEHAVEVDSVDVALTPEMAQIWEGVNSL
FT                   SFKKVQALLAYRYDEFIDVPMYYEESSNLLDMLNRVNRGRIDAVLDYKPAMLAKAAKLA
FT                   QPRQFVIIENIFQAEIYFVFAQNSKGALLKAHFDIELQKMIDSGELDRLFQQYMGQEAS
FT                   RLLR"
FT   gene            complement(114092..115450)
FT                   /locus_tag="Swoo_0093"
FT   CDS             complement(114092..115450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0093"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: sse:Ssed_0130 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84394"
FT                   /db_xref="GOA:B1KL53"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL53"
FT                   /protein_id="ACA84394.1"
FT                   /translation="MAVYSLSQAIASLTDTLKQLKFQTQSDPIIQLSVSIKPVPAIAWL
FT                   AAQPCYPRIYWKGRDTEEEVAAIGCCKDFFYADNIDDNQLSIEYQKQRALSNNQDIRYY
FT                   GGVAFDRTTECWPEFGRAHFVLPRVELRRHGNDYKLLVNLNCETGNAESERDQAMTSLA
FT                   QLASPKPLPPPNKINILSRSDRPDRYRWTELVNQVTHQKFIQETPKVVLSRLTQLEINQ
FT                   PVDPWMLLACWQGRNKNSFQFGFQFSPDSTFISCTPERLYRRRQRELFTEALAGTTTRG
FT                   LNLEEDKVLAQTLMEDNKNSHENRLVKDHIVDALTPLSNYVGAESIPKVFKLSHIQHLH
FT                   RSIRAELKPGVDDFQLLQALHPTPAVGGLPKEPAMSFIRQSEGYARGWYAGACGYFNKY
FT                   ESEFAVAIRSALIEPGRINLFAGAGIVSGSEADSEWIELENKLTTILSILTEL"
FT   gene            115863..117812
FT                   /locus_tag="Swoo_0094"
FT   CDS             115863..117812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0094"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: spl:Spea_4088 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84395"
FT                   /db_xref="GOA:B1KL54"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL54"
FT                   /protein_id="ACA84395.1"
FT                   /translation="MKKQQKVLRVSSLALAMSLAYQVQADEIERDPILDVTDVIVVHGE
FT                   RASVTEAATTHWSVDAEEIKASGAQSLDQVLENVPGVYVRVGGDSTPRVDIRGLKTRHI
FT                   TFLINGVPASSTEDGQFDPSVIPTNLIARVDVSVGPTSVLYGPGGSAGVINIITKQGDE
FT                   SSSLSGKVESAADNTLNADISAAGSGDNWQGIMSVTHQETDGTPMPDDFEDTRNQIGDL
FT                   RFNSDRKLTNYYAQGSYFINDSTKLMANYTQRDGEWGKAPTVDRKKAPSRIEDFNEQSM
FT                   QLGAAHEINEKYVVRGFVYYNQTDMVENFYNHRMNNLNSIVESTSKVSGTNLQFISEFD
FT                   YGAVLTTSVIVEKQDWFSHTDKIRSEKGTGSGGGSGGGQGSSGDIDESLMVYTGAAEYQ
FT                   YQDDGIYGYSLGVAVHNYDLDVNSETDFSAQASAFYQVTDSSRIHTGLARKVRYPSISD
FT                   LYAPNSGNVNLKAEVANQFELGLQQSLPFDTQLDISSYITDANDYIAKDDNNHEQNIGD
FT                   YRFMGVDLQMTNQYFDSLGLTFAYSYIDTEDRATNERLQYRPTHNLRLQASYDFSFGLT
FT                   TRLNAERVIDQVNGKGVQLDNYTLVDLSLSQNIWHDNLELYVRATNLFDELYYQSDFMP
FT                   QAGRQVFVGINWQL"
FT   sig_peptide     115863..115940
FT                   /locus_tag="Swoo_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 26"
FT   gene            117816..119171
FT                   /locus_tag="Swoo_0095"
FT   CDS             117816..119171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0095"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sse:Ssed_0132 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84396"
FT                   /db_xref="GOA:B1KL55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL55"
FT                   /protein_id="ACA84396.1"
FT                   /translation="MSLLELDGVSFRYDCGEPFILEDLNLQIKPGECHCISGPTGSGKS
FT                   TLLKLIMGVLSRPFDGEMIRTGDLTLGLVMQDPNVQFIRQSVGAEVAFALENLCVPLEL
FT                   MRAKVISALRKVGLFVRLDMPIEQLSLGQKYRVMIAAQLVFEPEILLLDEPWAQLDNSG
FT                   VEELILVLSQLKRDGVAVLLVDHNPRAFSELVDAFYHMKDGSLVAGCLPPVTVEHLVGA
FT                   PVLLDTCVVQAEPFEFSFIDQAPLFKSVEPLAIYSGEIIALIGDNGTGKSSFLKTLAGI
FT                   QADIGKLPLTVLGKQPKLGIFGAEMGLLLQAPNRQLFEETVLGELQFSLKRFGLPLHRA
FT                   EQLLDELELSHLAEHSPHKLSYGQQHMVALASLVCLRPKVLLLDDPFAGLDAEYLNRVW
FT                   SLLVNLSHRGSAILLTSHRQMVNLPVTRYWQVEAGFLRCEYDPSVTQTLQFG"
FT   gene            119185..119850
FT                   /locus_tag="Swoo_0096"
FT   CDS             119185..119850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0096"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: sse:Ssed_0133
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84397"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL56"
FT                   /protein_id="ACA84397.1"
FT                   /translation="MKTRRGVRHSTLERNADRGSKSIGWTAGALSLALILSSSAFFIPQ
FT                   DYLLALIVCDIVLVIHGVFRRGDFWVLGRVFLVQLAITLTLYYLIHGQEQLVQGALAVV
FT                   RVLLAFIPGWWLSVSCKPEQIGEVLAWILPVKWAFVIAASLSLLPTMTTEIREIYQTQC
FT                   LRGAKISPKALRDPRNWAELIHCVVFPLLIQLLKLSKQTAMAAQLRYFGKHKRTTHWR"
FT   sig_peptide     119185..119307
FT                   /locus_tag="Swoo_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.657 at
FT                   residue 41"
FT   gene            119878..120423
FT                   /locus_tag="Swoo_0097"
FT   CDS             119878..120423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84398"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL57"
FT                   /protein_id="ACA84398.1"
FT                   /translation="MGKVLNFSLQDALFIGFCATLLVALKSMLRLKLGITGHSMFLMTF
FT                   FYLICYGVVGRVGCITACGLLSGLVAMMLSIGKGGPLILIKFGLPALAMDLSMLLFSGL
FT                   LTLKLRCIVVGLVGCFAWAAKSWVENLLVGMTIQVALVQFMLSMLKGGVFTILAALMVP
FT                   SVLSRLKAHDLLFNEDVK"
FT   gene            120489..121241
FT                   /locus_tag="Swoo_0098"
FT   CDS             120489..121241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84399"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL58"
FT                   /protein_id="ACA84399.1"
FT                   /translation="MNLPPLKSWLICIDDTDDIGTKGTGEIAEEIANLLCDSTSLQPWV
FT                   TRHQLFVHPDIPYTSHNSAMCFRLETQAQLEQIKQVAVKHLVEQSAPASDPGLAILELD
FT                   TEFDSNALVEFGLLAKKEVITKPQAYELAEKLGVSLSEHGGTGQGVIGALAGLGLRLYG
FT                   QDGRVKGQVDLGQEESEEGVKLTVAEVLKRTGLGRVISIEGEILDACEILHLTKKVKAI
FT                   YYQHEFSLLVYRHEGRWCNALKKHLKAY"
FT   gene            121244..121468
FT                   /locus_tag="Swoo_0099"
FT   CDS             121244..121468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84400"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL59"
FT                   /protein_id="ACA84400.1"
FT                   /translation="MEKVIASFEFDGQVFRFRFGNENELESRKTANECYQFTPDDEDEQ
FT                   IDDFPTSCYNCMNRRWLIDGMACSKIERI"
FT   gene            121694..122872
FT                   /locus_tag="Swoo_0100"
FT   CDS             121694..122872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0100"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: sse:Ssed_0137 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84401"
FT                   /db_xref="GOA:B1KL60"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL60"
FT                   /protein_id="ACA84401.1"
FT                   /translation="MVESVESKAHVKFPVSKLSVGMFVTSIDNDGQVAITNAGQIKDRE
FT                   AINKLIKNGIKYVWVDKERSADSCGFKNTVQPPPTVKKKAPSREASQQKAKKLVTEAKD
FT                   LLAKVLSETFEGKAIEVAPFEEFADNLIDSALLDSDALKCVSALRTKDAYLLEHSVNVA
FT                   FLLITFGQHLNLDKQKLKEMAVGGILHDVGKIQVDDKVLHKPGKLSQEEFEHMKKHQNF
FT                   AMNIMSKTDGISQISKDVCLMHHEKLDGNGYPNGLKGEELPLHGRMSCIVDIYDALTAK
FT                   RCYKDAMSPAAAFKVLLSLTPFHLDEALVYQFIRSVGVYPVGSLVELSDGRIGIVWHAK
FT                   GRDALHPILKCFYSIKHKRYLDVTFVDLLKSDANIERGISPCSLDVDPAPFY"
FT   gene            122990..123649
FT                   /locus_tag="Swoo_0101"
FT   CDS             122990..123649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0101"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   sse:Ssed_0138 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84402"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL61"
FT                   /protein_id="ACA84402.1"
FT                   /translation="MSKNRIFTTAILLISLALLIPGVTQPILSISGSIEKSELTKAGID
FT                   QLATSLGDNSASGNTRGMLSMFSGMLGLNDLEGEVEVFQKTRSIWGTVDELFRSGNAAV
FT                   AALVMLFSVIIPVLKLSLMLLQQLPITPSFRQAITGFTTKISKWSMADVFVVALIVTYM
FT                   AGNASAGMGEMLKTTANFEVGFYYFSAYCLFSIASTYLVNTDVTESDTSLPETERT"
FT   sig_peptide     122990..123064
FT                   /locus_tag="Swoo_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.449 at
FT                   residue 25"
FT   gene            123798..124481
FT                   /locus_tag="Swoo_0102"
FT   CDS             123798..124481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0102"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sse:Ssed_0140
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84403"
FT                   /db_xref="InterPro:IPR025628"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL62"
FT                   /protein_id="ACA84403.1"
FT                   /translation="MKRRDFITAGGIAVASALFAPHLFATPKGKPLKILALVFDDYETL
FT                   DLHGPVEMLGHMSHVQILLVGAKSIIRSYQGPKVVTDISMEQVTPCDLLIVPGGIGTRT
FT                   LVEDSELLSWLQAQEKVSKKVFSICTGSALLAKAGILDGVNATTNKMAYQWVTSLSQRV
FT                   HWQPSARWVDEGKFLTSSGVSAGTDAALFYVRQLRGEEEARRIERLTEYHWNDDSTNDP
FT                   YAVEV"
FT   sig_peptide     123798..123875
FT                   /locus_tag="Swoo_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            124667..124828
FT                   /locus_tag="Swoo_0103"
FT   CDS             124667..124828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84404"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL63"
FT                   /protein_id="ACA84404.1"
FT                   /translation="MKKWLIVLSCTVFVAASLLTSGLTRALIDLVAFASLLWIVLVMRS
FT                   DPSSKQDI"
FT   gene            complement(124811..125743)
FT                   /locus_tag="Swoo_0104"
FT   CDS             complement(124811..125743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sse:Ssed_0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84405"
FT                   /db_xref="GOA:B1KL64"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL64"
FT                   /protein_id="ACA84405.1"
FT                   /translation="MNTKTQNKIHVAIFVITGFLCLLPQISSPIALVLGFTLASLGLVP
FT                   AHLDLATLTKKLLSYSIIGLGFGIHLQTAISVSLANLPLILGSIVFTLILGAVLTKALK
FT                   FDTKTGHLISAGTAICGGSAIAAVSPAINAKSDQTAIALATIFILNSIALFLFPTLGHL
FT                   LSMSQYDFGVWSAIAIHDTSSVVGAASAYGEEALVTATTIKLARALWIIPIALISAIIF
FT                   GGDKKRITIPYFIGFYCLAIAIAHFFPQGEAAFEVIFALSKRVLVLCLFLIGAGITVKK
FT                   MRAAGVKPLALGVILWLAIGVSSLLYILL"
FT   sig_peptide     complement(125642..125743)
FT                   /locus_tag="Swoo_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.327 at
FT                   residue 34"
FT   gene            complement(126298..127479)
FT                   /locus_tag="Swoo_0105"
FT   CDS             complement(126298..127479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0105"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /note="TIGRFAM: diaminopropionate ammonia-lyase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: spl:Spea_4080 diaminopropionate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84406"
FT                   /db_xref="GOA:B1KL65"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL65"
FT                   /protein_id="ACA84406.1"
FT                   /translation="MMLKLTQNDFFNGETSELFTAQVAEQTRQFHQQIEAYQPTPLISL
FT                   EQLAARLGVKAILVKDESYRFGLNAFKVLGGSYALGKQLAEHLNVDISEIDMKTVAAKL
FT                   SEPLVFATATAGNHGTGVAWAAREMGQKAVVYMPKGSSQASVTRIQNLGAECIVTDCNY
FT                   DDTVRIANQTATENGWMLVQDTAWEGYDKIPTWISQGYMTMAVEAQEQVDAMGLKPTHL
FT                   MLQAGVGAMAGGILGYFADKVGATNFKTIIAEPAKADCIYNSGIKGEMVAVTGELNSIM
FT                   AGLACGEPNPVTWPILKQCSSFFASVEDEVTATGMRILGNPLAGDTKIVSGESGALNLG
FT                   LLYMLASREEYTEYRTQLGLDQDAIIMLFSTEGDTNPDRYRQIVWEGALSTAK"
FT   gene            complement(127566..127949)
FT                   /locus_tag="Swoo_0106"
FT   CDS             complement(127566..127949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0106"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: spl:Spea_4079 putative
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84407"
FT                   /db_xref="GOA:B1KL66"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL66"
FT                   /protein_id="ACA84407.1"
FT                   /translation="MKTVIHTENAPAAIGPYSQALAFDKLVFTSGQLPLDPATMAFVEG
FT                   GIKEQAYQSLKNLKAVLEQAGAGTDTVLKTTCFLADMEDFVAFNEVYTEVFGTEAAPAR
FT                   SCVQAARLPKDALVEVEAIAFTK"
FT   gene            complement(127970..128650)
FT                   /locus_tag="Swoo_0107"
FT   CDS             complement(127970..128650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0107"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: spl:Spea_4078 YheO
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84408"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL67"
FT                   /protein_id="ACA84408.1"
FT                   /translation="MIKTTEHTYKTEFTSRDRELLEGYFRLADSMADLIGPHCEVVIHS
FT                   LENFEQSVVKIVNGHHTGRKEGSPITDLGLKMLRLYEQTGEVTPKSYFSNNKGGEMLKS
FT                   STCILAGEDGKPIGMFCVNMNLSHPFPEIIKTLMPDTSQHQSFDMTENFSASAGDVVEQ
FT                   ALTHAISEVDADTSVNLKGRNKAITKVLFDNGIFELKEATNIVANHLSITKHAVYKYIR
FT                   EFKS"
FT   gene            128991..130157
FT                   /locus_tag="Swoo_0108"
FT   CDS             128991..130157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0108"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24; KEGG: spl:Spea_4077
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84409"
FT                   /db_xref="GOA:B1KL68"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL68"
FT                   /protein_id="ACA84409.1"
FT                   /translation="MKSILQRGFTTAEFEMRATKAQQKMRELEVDAILLTTEPNVRYFS
FT                   GFHTQFWHSPTRPWFLILPAEGKPIAVIPEIGASGMAGTWVEDIHTWASPRPDDDGISI
FT                   VASVLNSLPARFGRVGATLGIESHLRMPVANYLQLTTLVSKEFVDVSLAIHELRQVKSV
FT                   AEIDKVREICRITNVGFDKIPGYAKAGMTEREICKQFGIDMLMEGADECPYIIAGSGQD
FT                   GYDSIIMGPTDRVIEDGDVLIIDTGAVRDGYFSDFDRNWAFGHASEQTKAAYRATYEAT
FT                   TMGFEAARPGNTTSDIYNAMWKVLEANGALGNDVGRLGHGLGIELTERPSNTATDNTVL
FT                   VPGMVMTLEPGMVYAPGKSMVHEENIVITETGAEWLSKRAEPELLIIK"
FT   gene            130221..131000
FT                   /locus_tag="Swoo_0109"
FT   CDS             130221..131000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0109"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG:
FT                   spl:Spea_4076 Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84410"
FT                   /db_xref="GOA:B1KL69"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL69"
FT                   /protein_id="ACA84410.1"
FT                   /translation="MMSFEAFTSFEQPLEHQQAPRINRVHIGLVQLSTDHSLEMDWAKL
FT                   LGTQAGVFSSRVYYSSEMTPEALDQIANGIVEASDLIATGLPMDVMAFGCTSASIIIGE
FT                   EKVAGLLTQNRGDIPATNPWTAAKASFKHLNAKKIAVFSPYPTSVNYPLYQQLTDADFD
FT                   VVTLGSLGIERDTDITLVSKESMFAALELMLKDSDAELVFMSCTNLRVLDYIEEIEAKF
FT                   GIPVVCSNSAMFWHAMHLTGKAAICPGYGKLLNNQSA"
FT   gene            131040..132020
FT                   /locus_tag="Swoo_0110"
FT   CDS             131040..132020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0110"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: spl:Spea_4075 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84411"
FT                   /db_xref="GOA:B1KL70"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL70"
FT                   /protein_id="ACA84411.1"
FT                   /translation="MSNTQKGWLAAIFVGLLWGIPWIVGTPILEVMDPQVLVWLRYTVA
FT                   FITLGLIFNIGLASGKMTKKADFKLNWQNRNDIFWAACCGIIGQGSFSFLSFLSLDYIT
FT                   ASENGVIQGLIPILILSVGFLRHNERFTVMQMMCALGAFLGVAILVMDPQSETQGFNIG
FT                   HLICFGSAASFACMAYARAKLAEKYGSVATMFHQFVFASLGFGLYLFVVGADFSSALNV
FT                   FSSPLRIMCIVILGVCISGMSYLVYIYGMERVGVDGTGMALNLMPLSSFILAVFALGEQ
FT                   VTPMRLVAIAVVITSMIAFMKLGNQKKDKPVEQAALNTTKPCRSQ"
FT   gene            132103..133074
FT                   /locus_tag="Swoo_0111"
FT   CDS             132103..133074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0111"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: spl:Spea_0499 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84412"
FT                   /db_xref="GOA:B1KL71"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL71"
FT                   /protein_id="ACA84412.1"
FT                   /translation="MTVTNKDNLLGWTAAIAVAGIWGVTGVVSKPLSMAVDPMTLVFFR
FT                   YVTAVIGLSVIFMITSRFTSLSKDLGSSLKIDKGDIAKIALCGIIGQGVFSLFNFLSLS
FT                   HIGATENGVIQGMQPFATVFFGMMFMNFKMSKIQWGAFIASAVCIYAMSVGPTNQVENG
FT                   SSVMGYVYVTCSMLSLAWTAHLRASLAEKYGSVVSMLYQYISVAVMGIIVVVAMDLDLS
FT                   QINIILANPLLLGLLIFLGMGISGGSYLIQLYSFKKIGVEKATMALNLMPLVGYIVAVL
FT                   TLGEQLHLSKTIIVSLIVVALYVFTKFEAKPEINKSLKPQEA"
FT   gene            133105..134259
FT                   /locus_tag="Swoo_0112"
FT   CDS             133105..134259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0112"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: spl:Spea_4074 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84413"
FT                   /db_xref="GOA:B1KL72"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL72"
FT                   /protein_id="ACA84413.1"
FT                   /translation="MNIEQKVIEWRHHIHQHPEFGTQEHETAAFVASKLEEFGIEVHTG
FT                   IGGTGVVGILKCGDSERSIGLRADMDALHIHEENTFDYASVNEGAMHACGHDGHTAMLL
FT                   AAAHELAQTKNFDGTVYFIFQPDEERGTGAKAMIADGLFTRWKIDGVYAMHNLPGIEAG
FT                   HFVTRPHSVMASESSFEIEVLATGGHAAMPHMGTDPIVVGAQIVTAIQTIVSRNLSAID
FT                   ETAVISVTEFATNGTVNVIPTKVTITGDTRSFTDGALNKIEKALERVVAGQCMSAGVDY
FT                   TYKFNNSFLSTINTPAETAFAVRAAQTVVGEDKVNGSCQPFTISEDFSFMLREAPGCYI
FT                   LVGNGAGCGCGSVALHKPTYDFNDNILVSGLRYWQTLVEQCLAK"
FT   gene            134614..135708
FT                   /locus_tag="Swoo_0113"
FT   CDS             134614..135708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0113"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   spl:Spea_4072 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84414"
FT                   /db_xref="GOA:B1KL73"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL73"
FT                   /protein_id="ACA84414.1"
FT                   /translation="MSTLFSPGRIGNMTLKNRFVRSATWENMATETGHMTDKLYSVYEE
FT                   LAQGEVGLIVTGYANIVAEEKPNAGMMGMYDDSFIVEYQKLTELVHGYDSKIVMQLAYG
FT                   GTKTTFNVGERVIFAPSAIAERGTQTLGKAMTKEEIDYIVKAFAQASLRAQKSGFDGVE
FT                   IHAAHTYLINQFLSPYYNQRQDEYGGSLENRMRFLLEIYAEIRKLVGEDYPVLVKLTAS
FT                   EFFEGGLTFDETRTICKKLESIGVDAIIISGNIHGNANTVVGESFDGYTIQNEGYFREF
FT                   GAVVSEEVNLPIITVGGLADICAIEELAETTNIQFFALSRPLLAEPQLIKRWLAGSKVE
FT                   VDCERCSKCRTKRGNFCVVYRKRR"
FT   gene            135856..136716
FT                   /locus_tag="Swoo_0114"
FT   CDS             135856..136716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_1527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84415"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL74"
FT                   /protein_id="ACA84415.1"
FT                   /translation="MLNEKVPVVIHNTLEKVFESARLSNSKTDIESFYTELIQSPLYLL
FT                   SDASDPADNEDAEELAGQGAQSISIMQWYIDLEDGDAFPFTPVFTSQQALDAAKTQMEK
FT                   EGTEYHGQLELEASTVLQMLVNADSDIMLNPNTSLSKAIDENEIRYMLFPSVGLIEHRG
FT                   QLQIVGEVLNAGLPLLDVLRQMLSSYSKVNAAYLIDSCRLDFQKSCSDHQFYLGLTFDD
FT                   TDYADELSRIRSEIFNIHRKIELNGWDISIHLVETGDEMSEYLLAQTSPFYNRSLMSRI
FT                   KSWFS"
FT   gene            137584..140055
FT                   /locus_tag="Swoo_0115"
FT   CDS             137584..140055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0115"
FT                   /product="Lysyl endopeptidase"
FT                   /EC_number="3.4.21.50"
FT                   /note="PFAM: PKD domain containing protein; peptidase
FT                   domain protein; KEGG: hau:Haur_0489 lysyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84416"
FT                   /db_xref="GOA:B1KL75"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL75"
FT                   /protein_id="ACA84416.1"
FT                   /translation="MDIKNIKYYIGAAGIFLSLGAQAAPPLSLSQPELAKNTEIKEMPA
FT                   QDNMKLRQRDEVERALNTDSYLLKFAEPIQVAITPDKWQSQLVTQDGKSSEMSIWRTKI
FT                   VSSDALSLNFGFSEFFMPEGGSLHIYTPDGSQKIRPFTAKDNDDHGQLWTPMLRGDSAV
FT                   IEVNIPTKQLKQLKLKLSAVNHGYLGANIKDIYDTLSGSCNVDVVCGAGDEWRDQIRSA
FT                   AAISLGGSGFCSGGALNNTANDGRGFFLTAFHCGINAGNAASLVTYWNFESSYCRDPGS
FT                   GDSGGPGDGTLDQFNTGAIFRAGYSPSDMTLVELDDPFDPGHNVFLAGWNAADETSTSA
FT                   VAIHHPSVDEKRISFENDATTITSYGSNPTPGDGTHIRVIDWDLGTTEGGSSGSHLFDQ
FT                   NKRVIGQLHGGGAACGNDLSDWYGRIHTSWDGGGTASTRLSTWLDPENTGQIAIDGMNA
FT                   TDPGDNQLPVANMNGPYLGFVDTTVDFSSAGSEDPDGTIVSFLWDFGDGSDTSELENPS
FT                   HVYTARGNFEVSLKVTDDEGASRTAYTQAAIFDQGEDELVNEVPRTDLAAGTGEAIYFY
FT                   MQVPAGATDLEFITEGSNGDADLYAKQGTLPTLSDYDCRSYSSSSNETCSFPTPTSGVW
FT                   YVMVNAYSTYDGLTLTGSYSADQTNLPPVASFDASFTDGEGTFTSTSTDADGSIVTWAW
FT                   DFGDGSTGSGESTTHNYNSSGNYTVSLTVTDDDGAQHAVSQSYDVTIPVSDIEASVIRA
FT                   LKSRRGSVMVDLRWDGAIGNTVSIYRDGEMVAETSNDGRFRDRFRTTTADSAEYKICDS
FT                   SGCSNTFTASF"
FT   sig_peptide     137584..137655
FT                   /locus_tag="Swoo_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            complement(140128..141183)
FT                   /locus_tag="Swoo_0116"
FT   CDS             complement(140128..141183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_2460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84417"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL76"
FT                   /protein_id="ACA84417.1"
FT                   /translation="MSFNKPVKLSSNPIALIVTLLFFSGCEQVPTHPINEEELEQIECS
FT                   ETEEQGLTINQDCLTGYRGKPFTGIGVSTSMYGNHFNAAQYKDGLKHGFSFSANEVHLK
FT                   FQGWFNQGLKDGEHLVYHYKSDKLRSRTIYQEGEKLTEDFYTEEGIINSFKRFDGEDIV
FT                   ESISYEKGREWIHTYFAQNGEKRQRWKRYYANGQLSSNGEFRDEDLKKLNEITYFFSGK
FT                   IRTQFNYDRQSNRSQLDTYWPNGYRQSEKHYIYPSITLDGKVLRFCQENGQLQAIEHYR
FT                   KNIEHGLFEQFYCNGQLQKREHYADGIIIDKQVKVFHENGQLMILRKLDGKGKEVSSKY
FT                   YDETGKLTYQE"
FT   gene            complement(141184..143493)
FT                   /locus_tag="Swoo_0117"
FT   CDS             complement(141184..143493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0117"
FT                   /product="MORN variant repeat protein"
FT                   /note="PFAM: MORN variant repeat protein; KEGG:
FT                   slo:Shew_2461 MORN variant repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84418"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL77"
FT                   /protein_id="ACA84418.1"
FT                   /translation="MHFYQSIIASLIMVSVTLISLPASATQNISSAMIEVRQQDGVGFY
FT                   YNIANGMALNGDISIVRDNQGYTLGQFSQGLPNGQWQVFLPNNQKLVDGLYLNGYQDGK
FT                   WQLFDMSGGINEIQHYIKGVPTGRWEQYNRQGSIYQTTDYKEGQKSLVKRFFNSGKLQA
FT                   KESYLDNLRHGLWESYHENGTLALSQQYANNQVSGPYLEQNNQGQTLVKGQYNADGQRQ
FT                   GKWLRSYDDGTPESETHYEADSRNGNALEYHPNGQVSIQSHYQNDLRQGELLRYSDNGT
FT                   LLEKEQYKNGLLDGAQSYYNLSGVLIIEQNYKEGKQAGTQKTYFDNGELKKVTNYHTSN
FT                   LTDNDQYPLQGIQETYDSEGRLISKGYYEMGLKQGKFERYRQGVIHKREQWHAGERHGD
FT                   QIVYYDKDTVRSLNQYKQGKQTGTAESYFEDGTLKERGTRIDGKWAGKYESFYDTGSPR
FT                   ELIHYATEKSDSNYRFPYHGNYARWYANGDPNDEGKYLNGEKEGLWLHYQQGLVSRKQT
FT                   FKEGKLNGDYAEYYNGRRRVTGQYLDNQRDGLWTDYRYQESDPTFGTIPEGNIYRTSQY
FT                   QQNKLNGLREYFSFKKIRYRSETYKNGEQTGPYAEYYVDNGQVKRQGEMLEGKQIGHWE
FT                   LWFEDGMQSLSVEFLDGKQHGKQLEYYSNGQLKQQAHYAKGKLDGELIHYFQTGKKKYQ
FT                   EQWLKGQKEGEASYFHPNGKLSEKGTYLRERKEGLWQSYWPNGEKRSEGSYISNRQSGD
FT                   WVYYDQFGKLIKTEHH"
FT   sig_peptide     complement(143416..143493)
FT                   /locus_tag="Swoo_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(143764..144570)
FT                   /locus_tag="Swoo_0118"
FT   CDS             complement(143764..144570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0118"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pin:Ping_2106 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84419"
FT                   /db_xref="GOA:B1KL78"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL78"
FT                   /protein_id="ACA84419.1"
FT                   /translation="MKKVILITGSTDGIGLETAKALVSNGHHVLIHGRNPTKLADVSEI
FT                   LSGLAGAGVVESYCSDLSNLSDVEALADTIMDKHQKIDVLINNAGVYKTVKIDTEDGLD
FT                   VRFVVNTIAPFLLTQRLVDLFDTSGRIINLSSAAQSHVDLDSLTRPNNDIEDSNIYAQS
FT                   KLGLIMWSIYMAEQYKEKGPAIISLNPASLLGSKMVKEAYGIKGGDLNIGVDILCRAAL
FT                   SDEFANASGRYFDNDVGRFTSPHPDALNTSKNKALVAKIKSVLANK"
FT   gene            complement(144732..145577)
FT                   /locus_tag="Swoo_0119"
FT   CDS             complement(144732..145577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0119"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cps:CPS_2528 enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84420"
FT                   /db_xref="GOA:B1KL79"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL79"
FT                   /protein_id="ACA84420.1"
FT                   /translation="MTYEGYKTFNAKLEDSILTITFNFGSVNLQGLEMISDLNSLAMRL
FT                   ERDHEVKVVIFQSANPEIWVCHYDTNLLKDLSTKAVSRSEVELLDLQKVLDRISKLPQA
FT                   TIAKLEGFARGGGHEFALACDMRFAARGKYKFMQMEVAMGILPCGGGASRMARQTGLGR
FT                   ALEIILSARDFGADEAEAYGTINKALEPDEIDDYVKNLAQRIARFPAESINACKRAVYE
FT                   SIDQPIEEALKAEAYWLYQSTSKTAAIKRFTIADEQGLQHDIDNQRNWDDLVMKVQDIN
FT                   "
FT   gene            145803..146696
FT                   /locus_tag="Swoo_0120"
FT   CDS             145803..146696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0120"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cps:CPS_2531 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84421"
FT                   /db_xref="GOA:B1KL80"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL80"
FT                   /protein_id="ACA84421.1"
FT                   /translation="MNIEDLRLFVRLAVTNNISKAGQDLGLSPPLASIHINRLEKTLGA
FT                   RLVHRTTRKVSLTEEGITFLPHAEEIILRVDEAMESVGKGLTRPQGVLKISAPSSFGRM
FT                   HLMPALKGFLTQHPAISVDIQLTDTMVDLVAGGFDVGIRNSELKSSSLVARKLAVDRRI
FT                   ICASPEYIRENGQPSSPEELRDHQCINLKGLEGWTFETLNGNVNINTKGNVRVDQGEAV
FT                   RDACINGMGVAMCATWIAYEHLKRGDLIQILKDYPLIDDASIWAIYPSSKLLAPKIRAF
FT                   IDYFSVYYGTPAYWDT"
FT   gene            complement(146806..148161)
FT                   /locus_tag="Swoo_0121"
FT   CDS             complement(146806..148161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0121"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: sse:Ssed_0142
FT                   glutathione-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84422"
FT                   /db_xref="GOA:B1KL81"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL81"
FT                   /protein_id="ACA84422.1"
FT                   /translation="MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGTCVNV
FT                   GCVPKKVMWYGAQVAEALHLYAKDYGFDVTVNKFDWNTLVASREAYIERIHGSYDRGLE
FT                   SNKVTLVRGYGRFVNERTIEVDGQEYTADHILIATGGSPSIPNIPGAEHGIDSDGFFAL
FT                   REQPKRVAVIGAGYIAVELAGVLHSLGSETQLFVRKHAPLRSFDPMLSEALMESMATDG
FT                   PTLHTNSTPESVSKNADGSLTLKLENGESFEVDSLIWAIGRKPSTNNIGLENTQVKLND
FT                   RGYVVVDEQQNTTNPGIYCVGDIIEGGVELTPVAVKAGRLLSERLFNGMADAKMDYTLI
FT                   PTVVFSHPAIGTMGLSEPEAVAQYGAENVKCYTSGFTSMYTAVTAHRQACKMKLVCAGP
FT                   EETVVGIHGIGFAMDEILQGFGVAMKMGATKAQFDAVVAIHPTGAEEFVTMR"
FT   gene            complement(148303..148812)
FT                   /locus_tag="Swoo_0122"
FT   CDS             complement(148303..148812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84423"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL82"
FT                   /protein_id="ACA84423.1"
FT                   /translation="MSLSHTPRLNAATHLPLLLTILFLSLIPPSHASNSKPLPLGSVLD
FT                   SQGNPIQLPSKQESALEIPSIKPTKEYQSTPAKSRKRSQSRSKKSKLSRKQQLASRTSV
FT                   ANDPGCRWLDARMDHLERKLNDKGNSNANSYHKKELSIREQEWKCLKCGAEGPKQTDHD
FT                   HCQYRR"
FT   sig_peptide     complement(148714..148812)
FT                   /locus_tag="Swoo_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.966 at
FT                   residue 33"
FT   gene            complement(148931..149707)
FT                   /locus_tag="Swoo_0123"
FT   CDS             complement(148931..149707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84424"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL83"
FT                   /protein_id="ACA84424.1"
FT                   /translation="MKNTLTLTLLTCLISMAAPAAADTNSAIDDSHSTNKFTPNQDNET
FT                   QYLIDLGWDSDYISEGRNNLDKGGIFWSSAAVQHGNLNVYATMGRADSQHYTEWNLGLE
FT                   YSIALTENLETTLGYQRIESYGDERCSDNELFGSLSYSGVEWLTPSINYTYATEASGYF
FT                   VEASLHSSWELLDGFTFTPYVTQAFDFQYATEDHNGPNHFQFGVEAEYQLAQNVIISGH
FT                   VSHTIAQEDIKLEAKMDEVESSLDQTFAGVHLTWVF"
FT   sig_peptide     complement(149639..149707)
FT                   /locus_tag="Swoo_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            150011..152050
FT                   /locus_tag="Swoo_0124"
FT   CDS             150011..152050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0124"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: sse:Ssed_0145 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84425"
FT                   /db_xref="GOA:B1KL84"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR024080"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL84"
FT                   /protein_id="ACA84425.1"
FT                   /translation="MSNPLLTSTVLPPFSKIKPEHIQAAVEQGIADCRSKIDEVLAQTV
FT                   PFTWDNLVAPLEETDDALGKIWSPVSHMNSVVSTEEWRAAHDACLPLLSEYGTFVGQHQ
FT                   PLYQAYKSLRASAEFEQMTQAQQTVIEHSLRDFELSGIGLNDTDKQRYGELVKRMSELT
FT                   SSFSNQLLDATQAWTKLVTDEAELAGLPESAVAAAKAMAAAKEQDGWLFTLDFPSYLPV
FT                   MTYSENRQLREECYRAFVTRASDQGPNAGEFDNGPLMDEILSLRHELAQLLGFDSFAHK
FT                   SLATKMAESPEQVLEFLNELALRSKEQGKTELAELTEFAKQEYGVTELASWDLSFYAEK
FT                   LKHHRYEISQELLRPYFPEDKVLSGLFYTVNRLFGLNITEQKEFDSWHKDVRFFTIEDS
FT                   EGEHRGSFYFDLYAREGKRGGAWMDDCRARRQTPNGLQNPVAYLTCNFNAPVDGKPALF
FT                   THDEVTTLFHEFGHGIHHMLTKIDVAGVSGINGVPWDAVELPSQFMENWCYEEEALAEI
FT                   SGHHETGEPLPKAMLDKMLAAKNFQSGMGMLRQLEFSLFDFRMHLEYDPQQGADIQGKL
FT                   DEVRSQVAVIKAADFNRFQHSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGIFNA
FT                   ETGRSFLENVLQMGGSEEPMELFKRFRGREPQIDALLRHSGINA"
FT   gene            complement(152127..153251)
FT                   /locus_tag="Swoo_0125"
FT   CDS             complement(152127..153251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0125"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bme:BMEI1017
FT                   salicylate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84426"
FT                   /db_xref="GOA:B1KL85"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL85"
FT                   /protein_id="ACA84426.1"
FT                   /translation="MKILIVGAGIAGLALARRLDQLQQKYTLIERSPGWSQDGAGICLP
FT                   ANAVAGLEKLGLKDELLQLSYAVQKIKYVKPNGHLLSSASLLTPPFNDQPFLALPRAKL
FT                   LALLRKDMESKVTFNTSPRNIEQLDKGVRVTFSDSRIEEFDCVIGADGINSQVRELTFN
FT                   QPELEDLQVTNWRFLIDQPTAGLQPTYYLGSDSFFMRYPMPDNKVYCYAHVLDKGHQWT
FT                   KLQDKQWLLKRFKGFEDKVVEAIQAVACDEDIIPGRLQSVVSREVYSGSVLLIGDALHG
FT                   CPPALQQGVGMGLEDVHCLADLLDKHQDLDTIFNLFKQQRLERISWVIDESNRIIKLAS
FT                   KGRTFLGRVIRNFVVRKGGPANVNGWRKLLLWES"
FT   gene            153464..153994
FT                   /locus_tag="Swoo_0126"
FT   CDS             153464..153994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84427"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL86"
FT                   /protein_id="ACA84427.1"
FT                   /translation="MNLYFRLFWLFVWRVRHCNSIGFLGTSRIAYRALPCDCDINFHVT
FT                   NSRYPAFLDLARTYMLAEMGFLNRFIKLKWMPIVNAAEFTYIRDIKPFTKFEIETRLVG
FT                   WDEKYFYIEQRFVSDNTLHCIVHVRGVFVCKGKQVPIDTMVKEVNFEGPAPELPAEVVK
FT                   WKEFLQLKKEQNM"
FT   gene            complement(154184..154837)
FT                   /locus_tag="Swoo_0127"
FT   CDS             complement(154184..154837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0127"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   sse:Ssed_0148 glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84428"
FT                   /db_xref="GOA:B1KL87"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL87"
FT                   /protein_id="ACA84428.1"
FT                   /translation="MELFYHPLSRYSQKVLLALYEKQANFYPRVVELSDPLSRQDFCQF
FT                   YPPGKVPLLKSKKGVLLPESSIIIEYIDNEFSKKGTRLLPISPSLALDTRLQDRLIDLE
FT                   LSNVLFEYEQQKLNPEDTNHIKLKQLEKSIKRFLQYLDDILETSHWVCGDSLTLADCAL
FT                   IPCLLYAKDHFQIFKYDNLSRYWAQAQLRGAYLQVKEEIELAETEVLIGRRPIP"
FT   gene            complement(154959..155867)
FT                   /locus_tag="Swoo_0128"
FT   CDS             complement(154959..155867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0128"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_0149 transcriptional
FT                   regulator, LyrR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84429"
FT                   /db_xref="GOA:B1KL88"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL88"
FT                   /protein_id="ACA84429.1"
FT                   /translation="MDSAQLYRMLVFANVVEQGSLTGAADELGISRSMVSQHLKKLELR
FT                   CETQLIERTTRKMALTEDGQQLYHHCAELLLLAKQAEETTQPKSTELRGRVSLLTPICF
FT                   GEQFITPHIGEFRRQFPKLEINLQLDDRRINRLENSVDIAIQNETQQPTDTSFIKLGQF
FT                   DEYIVATPEYVQQHGSPLHPDMLLNHQWILQTSTHLPQSFLLENSYGDKFTIKVSPFIC
FT                   CNSRHGISQMVKQGAGIAILPSYLVEDEIAQGELIHILPDYHLDEGGVYAIHPFDKVIP
FT                   PRVKAFLDFIQIKMKPENMKD"
FT   gene            156336..157049
FT                   /locus_tag="Swoo_0129"
FT   CDS             156336..157049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0129"
FT                   /product="conserved hypothetical 3-methyladenine DNA
FT                   glycosylase"
FT                   /note="KEGG: sse:Ssed_0150 conserved hypothetical
FT                   3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84430"
FT                   /db_xref="GOA:B1KL89"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL89"
FT                   /protein_id="ACA84430.1"
FT                   /translation="MFECQYKNMSQLESFSTIYQRASERKGGDESLESLLTSSLTPDEI
FT                   GQYKDAELLSEMSKKVFQSGFIWRIVENKWSAYEEAFFGFEPHKVLMLSPEQLQERASD
FT                   PNLIRHMKKTMAIYDNALMTHDIAREHGSLAEYIANWPSEEITQLWAVLKRRGTRLGGN
FT                   TGPYFLRAIGKDTFLLTGDVQGYLTSHKLVDFGFSSKSGLKQVQGVFNTWQQQSGRSLA
FT                   DISRVLACSVGDNRI"
FT   gene            complement(157157..157912)
FT                   /locus_tag="Swoo_0130"
FT   CDS             complement(157157..157912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sse:Ssed_0151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84431"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL90"
FT                   /protein_id="ACA84431.1"
FT                   /translation="MTIKMTLQHKLLLSGLLLSAASVTQVQAEENNQVLGGTINGNLTF
FT                   ASDYVFRGESETLDGDVPVVQGTLGWGNDDGWYGGVFASNIKFADPNLEIVTAPFIGKA
FT                   GEFGDSGITYDVMVFSYLYPGASYSNYTELWLKVGKQFGQANIQLEVTPTIDDWFGVDG
FT                   WQGVNYAIHPSYEFSNGVNLSGSVGYQDLDGEGAEGWGHWNLGISKTYAGLKFDLRYHG
FT                   STVDETHKVYGTQTEIFDDRFVIGVSKSF"
FT   sig_peptide     complement(157826..157912)
FT                   /locus_tag="Swoo_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            158355..159506
FT                   /locus_tag="Swoo_0131"
FT   CDS             158355..159506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0131"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   slo:Shew_0031 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84432"
FT                   /db_xref="GOA:B1KL91"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL91"
FT                   /protein_id="ACA84432.1"
FT                   /translation="MRQIVKIASVISVALWITGCDQKPEGSGTAAGPQSVPVNVIKVAT
FT                   QPQEITLELPGRSRAYLEAEVRPQVSGIVLARSFNEGGEVKKGQSLYQIDASQYEAALV
FT                   SAKAELERAQAAEKSTKATAKRFSSLIKSKSISQQDFDTAEANYLEAKASVAVAKAAIN
FT                   TAEINLAYTKVESPISGRIGKSNVTAGALVGAGQAQALANISQLDPINVDIVQSSTQML
FT                   RLKQRIASGQLLNDNTAPVALFLEDGSRYSHKGKLQFAEVTVNENTGAVVLRAEFPNPD
FT                   GLLLPGMFVRTVLTVGTDPEAILVPQKAVTRNPKGQGVAMVVNAENKVEPRIVETAEVI
FT                   NHQWLITKGLEAGDQLIVEGLQKIRPGAPVTPQLISEAKAQAE"
FT   gene            159519..162656
FT                   /locus_tag="Swoo_0132"
FT   CDS             159519..162656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0132"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   son:SO_4692 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84433"
FT                   /db_xref="GOA:B1KL92"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL92"
FT                   /protein_id="ACA84433.1"
FT                   /translation="MARYFIDRPIFAWVIAIIIMLAGLMAIKGLPVSQYPSIAPPTVAI
FT                   TANYPGASAKTVEDTVTQVIEQRMTGLDHLRYIKSTSDSFGNAEITLTFNAEADGDIAQ
FT                   VQVQNKLQLAMPLLPQEVQAQGVGVAKTSAGFLMVLGFVSDDGSMDKADISDYVAANIQ
FT                   DPMSRVAGVGDIQLFGAQYAMRIWLDPMKLKQYSLTSADVVMAIREQNAQVSAGQLGGS
FT                   PAVMGQELNATISAQSRLQTAEEFEQIVLKSDVSGAKVFLGDVSTVEVGAESYMVNSFY
FT                   NGKPASGMAIQLAAGANALDTAAAVMAQIDEMKPFFPQGLNVVLPFDTTPFVSKSIEGV
FT                   VHTLLEAVILVFFIMYLFLQNFRATLIPMIAVPVVLLGTFGILAVTGFSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGCSPLEATRKSMDQITGALVGIGLTLSAVFVPMAF
FT                   MSGSTGVIYRQFSITIVSAMALSVLVAVILTPALCATMLKPVEKGHGYTNKGFFGWFNR
FT                   TFDRWTSRYEASVAVIIKRTGRVFVIYLALVVATAWVFMRLPTAFLPDEDQGVIFSQVM
FT                   LPANATQESTMKVMDKVSDYLLESEKENVQSVFAVSGFSFAGMGQNMGIAFIGLKPWDE
FT                   RSNPGQDVQSIANRAMGYFMTIKEAFVFAFVPPAVLELGTAGGFDLFLQDKNGQGHDAL
FT                   IAARNQLLGMAGQDPNLVGVRPNGQEDAPQYKLNVDHAKLRALGLSINDVNSVLATAWG
FT                   GSYVNDYIDRGRVKKVFVQGEAESRMQPEDLDKWFVRNDQGEMVPFSAFATGSWEFGAP
FT                   RLERFGGLPAVNIQGATIPGFSTGAAMDSIETMAGKLPAGFGIAWNGLSYEERLSGNQA
FT                   PMLYALSILVVFLVLAALYESWSVPISVILVVPLGIIGALLATYGRGLNNDVFFQVGLL
FT                   TTVGLATKNAILIVEFAKEYYEKGASLTDATLHAVRVRLRPILMTSLAFGLGVVPLAIS
FT                   TGVGSGAQNAIGTGVVGGMLSSTFLGIFFVPLFFVIVERIFSKREQKKKTSTEVAE"
FT   gene            163036..163566
FT                   /locus_tag="Swoo_0133"
FT   CDS             163036..163566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84434"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL93"
FT                   /protein_id="ACA84434.1"
FT                   /translation="MVSRRNLKQEHELAVLNSFADHLKLEGKSLEILEQPDPPEAIVNI
FT                   DKTKTWIEITDAFLDEEHARSLMNSIADDVPHIVDETRDEAEIEPDFQSVVHGVIAKKY
FT                   DKKTMLQAHRTFGRGILLVGIFTPFNSASGIADEERENIRELVDNKAKAIFDKIYVYDG
FT                   TLKHKFYLLFEQL"
FT   gene            complement(163636..165252)
FT                   /locus_tag="Swoo_0134"
FT   CDS             complement(163636..165252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0134"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; KEGG: sse:Ssed_0156
FT                   AbgT putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84435"
FT                   /db_xref="GOA:B1KL94"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL94"
FT                   /protein_id="ACA84435.1"
FT                   /translation="MGLNKDESLPQDLNSSGSPEKQSGAFVRFLNIVERLGNLLPHPIT
FT                   LFAIFCMAVIVISGIAGYFELTVTDPRPVGASGRSEDGLIHVVSLMNAEGLRMIVSNLV
FT                   TNFTGFTPLGTVLVALLGVGIAERSGMLSAAMRLLVMGASKRLVTLTLVFAGIVSNTAS
FT                   ELGYVVLIPMAALIFHSLGRHPLAGLAAAFAGVSGGYSANLLLGTVDPLLSGITEAAAQ
FT                   MIDPDYIVGPEVNWYFMFVSTFLITGLGALVTEKIVEPKLGKYDPSEANIDLSNQSMDS
FT                   VTTLEKKGLKAAGIATLILSVLVALTVVPESGPLRDPETGLVAGSPFLKGIVAFIFICF
FT                   AIPGLVYGKVVGTMKRDKDVIDAMSNSMSSMGMYIVLVFFASQFVAFFKWTNLGAVLAV
FT                   SGADALNAIGLTGPLVFVLFIMMCGFINLMLGSASAQWAVTAPIFVPMLMLVGYAPETI
FT                   QAAYRIGDSVTNLITPMMSYFGLILAVASQYKKNLGIGTLIATMLPYSIVFFIGWTCFF
FT                   FLWVFVLGFPVGPGAATYYTP"
FT   gene            complement(165419..166594)
FT                   /locus_tag="Swoo_0135"
FT   CDS             complement(165419..166594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0135"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: fjo:Fjoh_2491 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84436"
FT                   /db_xref="GOA:B1KL95"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL95"
FT                   /protein_id="ACA84436.1"
FT                   /translation="MQLMTILLLISVGMSFFMMGYAATTPHQNAKARLCFSLMLVGLIS
FT                   LMIELAIFEEGGSFLYIISISGPLSVSVPIFFYLYFKASVGLSDEFQWRNARHLVIPFI
FT                   YLAIMMPYNLLDEVGKSHFFSQVYAKEVISWPLSMTPIRFSRLLIISSLGLFYLYLSWR
FT                   ELHIELNNKKQDVLREMNKLKGAFLGISLSFIVIFLFFLFRLPHQFTWMISSILLVITA
FT                   ISCMIFYYLPVLGKKLISDADLHQLLPPKAQELQQEVGQTSPEADTPDRQYRSSVTNDL
FT                   AKEVIHHLNILMEGGIYKDSTLSLGKLASQLKLSTHHLSQIINQQTQGNYFDLINQYRI
FT                   KDAQHLLINTNMSIIDIAYEVGYNSKSSFYTEFKRRTQMTPNQFKKSNKEP"
FT   sig_peptide     complement(166526..166594)
FT                   /locus_tag="Swoo_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 23"
FT   gene            166858..169239
FT                   /locus_tag="Swoo_0136"
FT   CDS             166858..169239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0136"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /note="PFAM: peptidase S45 penicillin amidase; KEGG:
FT                   mxa:MXAN_2906 penicillin acylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84437"
FT                   /db_xref="GOA:B1KL96"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL96"
FT                   /protein_id="ACA84437.1"
FT                   /translation="MKYNNKQRHLTPIALALTFALAGCNSSDSEPEEEVVLPSTAKIEY
FT                   TSFGVPHITASDFKALGYGQAYAHAQENMCTLAEQIVEVRGERAVTFGAGNGNSNLITD
FT                   FGTQALNIYSDAENSIEGMTEEQFDLLTGYADGFNQAVIDKAGSQNYPSPCRGVDWVPE
FT                   ITVTDLQAYHLKLALFASGGALSAQIATASPTTSEKALGQTFNEIAAQNEGLGSNGWAL
FT                   GRDKTESGSGMLLSNPHFPWSGNLRFVENHLKIPGEMNVTGVSFVGVPGVLIGFNEHVA
FT                   WTHTVSQSKRLTTYRLTLDPADPTRYLYDGEYKQMTSQDYSVSVQNEDGSHSEVKKTLY
FT                   SSHYGPMIGWYPDGSAVTYRDANLNNGNMVSQWFAMGRATSIEEFEAAFSTYQGIPWVN
FT                   TMATDNKGNAFYIDGSRAPNLNAFALTLLKDFVNNDPVGKALWQGGRGQLVLDGSMSLF
FT                   EWIDTGTTPIPGVVPFERAPKVMRSDYVFNANSSHWLTHGTEPLEGYSLVYGPEQTIRS
FT                   PRTRMNATMLEEHSPQGISGADGKFNIDELKGVATSERAQVSELLKDQLVERCTGVTNI
FT                   ILESQEVVDISAACTTLANWDGLYRNDSQGAHVFREFLKVFDVGGEQALSDSLFSKGFN
FT                   VKRPIATPYQLMKHEGSSNSDPILQALAGTVQHLASVNIPLSAPLGSIQYHMKNDEKLA
FT                   IPGGGTIDGVFNINTGSSAKVAAYGYPVFHGASWLMALEFTESGPQAEAFLTYGQSHDP
FT                   ESEHFVDQTRLFSKGEWRPVVFTEAQIEADLVDTIELTLD"
FT   sig_peptide     166858..166947
FT                   /locus_tag="Swoo_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.759 at
FT                   residue 30"
FT   gene            170138..170707
FT                   /locus_tag="Swoo_0137"
FT   CDS             170138..170707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0137"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: sse:Ssed_0157 LemA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84438"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL97"
FT                   /protein_id="ACA84438.1"
FT                   /translation="MDGVLLGLGLVVIIAYLWYVSLVKKRNAGREALSGIDVQLKKRAN
FT                   VVPNILTIAKKFMDHEKSLLTEITELRTQVTNSYDNSDATEIKQHLAAAERLNSKMGQL
FT                   MVTVEDYPELKSDNTMLQAMQTYNEVEAHISAARRFYNASVTELNNAVEIFPGSIIASM
FT                   ANIKVMPFYEADEAAKAPVNAADFLN"
FT   gene            170750..171760
FT                   /locus_tag="Swoo_0138"
FT   CDS             170750..171760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84439"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL98"
FT                   /protein_id="ACA84439.1"
FT                   /translation="MNIVSFIFGAPIKPKRQSKPLVAVGDELTSLQAHYDEHIEPLTRK
FT                   FENRRVASLKALRQRLYMSLAIFAGVLIISVLIDNQQRLGLPWPFFLLPLIPLIWWSSR
FT                   PVSRYKSDVKQRVFPKIFRYFGDDFIFSSTHQMSLSALKRSKLLPSYDNASFEDYVQGT
FT                   YKGVEIAINELELTKEVKRDKRRETQTVFNGVMVQLSCHKPFTGHTVVVKTRGGLINFL
FT                   SDSFKSLSRVKLEDVRFEKQFDVFSSDQIEARYLLTVTFMERLQELASCFSGKIQCAFY
FT                   DDKLLIMLASSEDRFELGSIFHGATFEYEFSQINKEMRQLFAMIEVLKLDEYTGL"
FT   gene            171761..172660
FT                   /locus_tag="Swoo_0139"
FT   CDS             171761..172660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0139"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   slo:Shew_3650 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84440"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1KL99"
FT                   /protein_id="ACA84440.1"
FT                   /translation="MILASREVSLFRGMQILFVFLVTPHALSTQAADKPHYKASRSESG
FT                   LVVTGQVNELASEPVGVKMLDNSSAQTINSSSTSLNRSTVPPKPVKRAQAASSRHVLDN
FT                   SSAGKQYRLETTLDDRVKVYQYQDENGVAVFTDHAPGASEYQVILYDCYACRPDSDLDW
FT                   KKMPLYSKRFDDLIQLAARNHQLEPALIRAVIHAESAFNVYAISKTGAMGLMQLMPETA
FT                   KELGVKNAFKPAQNIDGGARYLAKMLKRFGGDIELACAAYNAGPTRVTEHKGIPPYPET
FT                   IAYVERVKILLKRYQSLG"
FT   sig_peptide     171761..171856
FT                   /locus_tag="Swoo_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.898 at
FT                   residue 32"
FT   gene            complement(172705..174099)
FT                   /locus_tag="Swoo_0140"
FT   CDS             complement(172705..174099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0140"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: sse:Ssed_0160 putative Na+-driven multidrug efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84441"
FT                   /db_xref="GOA:B1KLA0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA0"
FT                   /protein_id="ACA84441.1"
FT                   /translation="MHSYQSPSDQTSSSISRTFWRYAIPSVAAMLVNGLYQIVDGIFIG
FT                   QYVGYQGLAGINMAWPIIYIFAGIGLMIGMGSGSLLSINRGENSLTGDDKKLVSTKVNN
FT                   TLASALLLVIGFGLIGSIVLNLSVDTLLLMQGGSGQTLLMAQQYTTPFTWSLVFTILAA
FT                   AIPILVRNDESPNIATGLMVMGACLNIVLDYLLIVQFNMALQGAAIATISAQISVSILG
FT                   IGYFISSKTDFKFNASAFIFSPKLAGKIMILGASSFVMYLYTSFVFALHNRLFMEYGSS
FT                   LTVGAFAIVGYLMVLYYFVAEGLGEGMQPPVSFFFGAREPKNIKRMFQLAAKVSISAGL
FT                   LWVLILNLFPEAIIGLFNSEDRALMTETIVGIQLHLFAMFLDGFVVLAIMYFMAVNQGG
FT                   RSLWISVGNMVVQLPFLFILPKVFGINGVWLAMPVSNLVIFAVVAPMVWRHLNSAIESG
FT                   RELSTA"
FT   gene            174227..175144
FT                   /locus_tag="Swoo_0141"
FT   CDS             174227..175144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_0161 conserved
FT                   hypothetical transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84442"
FT                   /db_xref="GOA:B1KLA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA1"
FT                   /protein_id="ACA84442.1"
FT                   /translation="MNWSLYQLEAFVLSVKYGSFSAAARKLGRAQSRISTAIGHLEDDL
FT                   GFELFDRSARLPVLTPCGEDMFIEAQAVLQQCQRLESRAMTLSTGQEISLTVAMDEAVP
FT                   INAFESLFEQVSIKFPLLKLTIINGSQDDIGLWVDEGKADMGILFHSRNELPESLEFMS
FT                   IGQFKQSLIVSVNHPLAQFSAPKIKELNQHRQLVIRDRMGDKQAKALAANHWYIDSYYY
FT                   MTALVIRGVGWALVPEHIANSEWYSDDIVTLSTEHIPSPLLVEIGVVNRRDQAYGPVME
FT                   WIFLEIESMFKNKVNNYSNKSESP"
FT   gene            175197..175568
FT                   /locus_tag="Swoo_0142"
FT   CDS             175197..175568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84443"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA2"
FT                   /protein_id="ACA84443.1"
FT                   /translation="MQTGLEQQLIELELYLLKSEVRSSVEELASLIHDDFLEFGGSGIR
FT                   FGKEEVLMRLPKERCPEFCATDFELRVLTPDLAQLLYRASMIKPDEFITRYSLRSSLWK
FT                   RSGDNWQMIFHQGTPCEAF"
FT   gene            complement(175689..176531)
FT                   /locus_tag="Swoo_0143"
FT   CDS             complement(175689..176531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0143"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   sse:Ssed_0163 protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84444"
FT                   /db_xref="GOA:B1KLA3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA3"
FT                   /protein_id="ACA84444.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHSVLLQVLKLMHKKPTPFAYIDTHAGA
FT                   GGYALTDQFSQKTGEYLEGVAKLWGKEDLPEPLAEYIADVAHFNQGKSELSFYPGSPAF
FT                   VDMNRHEKERMVLHELHGADHALLEEQFTGDRYIRVVKDDGLKGLIAAVPPRERRGVIL
FT                   VDPSYEIKTDYQDVPNAIIKAHKKFATGVYMLWYPVVNRAQTEGMLKILAQSGIKNQLR
FT                   IEQAIRADSDEFGMTAAGLWIINPPWQLDTKASEILEYLSPVLNQGGGKITIKQEVPE"
FT   gene            176728..177516
FT                   /locus_tag="Swoo_0144"
FT   CDS             176728..177516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0144"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   spl:Spea_4047 protein of unknown function DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84445"
FT                   /db_xref="GOA:B1KLA4"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /protein_id="ACA84445.1"
FT                   /translation="MTQVNQTKTSYGIFFNRHYPTIESACERWGLVYDANAEFELVFED
FT                   NILTLIKRDEPKLKGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQGVNPSVVDGTAG
FT                   LGRDAFVLASLGCNVTMVERHPVVAALLEDGLRRAYEDAEIGDWMRERMKLFHGSSIDS
FT                   LADAAHSSNTEVDVVYLDPMYPHREKSALVKKEMRVFQSLVGADLDADGLLAPAMALAS
FT                   KRVVVKRPDYAEDLDGVKPSMVIATKKNRFDVYVRAAMTA"
FT   gene            complement(177513..177920)
FT                   /locus_tag="Swoo_0145"
FT   CDS             complement(177513..177920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84446"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA5"
FT                   /protein_id="ACA84446.1"
FT                   /translation="MFYKLTVSIALGFFAFILWAIYQANTGSSNLFFDLIQPLPYGDKL
FT                   GHFGLFGLLTLLANLASRCRTLSIGRFKLYWGSTAVSLFVLIEELSQGLIPTRTLDMMD
FT                   LAADGLGITLFSLLTYLIATNTRSQTAHEKT"
FT   sig_peptide     complement(177858..177920)
FT                   /locus_tag="Swoo_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.555 at
FT                   residue 21"
FT   gene            complement(178001..179176)
FT                   /locus_tag="Swoo_0146"
FT   CDS             complement(178001..179176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0146"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: sse:Ssed_1680 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84447"
FT                   /db_xref="GOA:B1KLA6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA6"
FT                   /protein_id="ACA84447.1"
FT                   /translation="MIVEQDISSVQVGMYVLDITRPKNRFHLTKASWLISESMIDELRR
FT                   KGVERLLIDTSKTRKQSQIRSVSKERASLIPGFNQDIYEASKVFNESKNIQKNLFHDAK
FT                   NGCPLDLAPVKAITQKSLYLIFDNPDALACVINIRHKDEYLLEHSVAVSILLTIFAFYL
FT                   KIDVEIAHEIAIGAFLHDVGKIMVPDYILNKPDKLTDDEFEIMKTHASHSISIIEKTPG
FT                   ISALSLEVAKLHHEKLNGEGYPNQISAEQITQYGRMISICDIYDALTSSRCYKEGYPQV
FT                   KAFTILRALAKDNQLDDFLVDSFIQCMGVYPVGALVQLSSNRLAIVESHNHKDPIRPIV
FT                   KPFYSLKPKHFEAAQDIDLAVFESEEIVKCVRADDFDLNMEQIIEFLAHEG"
FT   gene            179362..179838
FT                   /locus_tag="Swoo_0147"
FT   CDS             179362..179838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0147"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   shn:Shewana3_4020 redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84448"
FT                   /db_xref="GOA:B1KLA7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA7"
FT                   /protein_id="ACA84448.1"
FT                   /translation="MIKQGERVPDGTMLGELTNEGMLTHCVTDLFAGKKVVLFAVPGAF
FT                   TPTCSQSHLPGFVVLADQFKAKGVDLIACVSVNDAFVMKAWGDSQNASEVMMLADGDAS
FT                   FTKAIGLQVDTAGFGGIRSQRYAMVLEDGVVTDLNVEAPKMFEVSKAEVILDLL"
FT   gene            complement(179886..181841)
FT                   /locus_tag="Swoo_0148"
FT   CDS             complement(179886..181841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0148"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: sbn:Sbal195_4340
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84449"
FT                   /db_xref="GOA:B1KLA8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B1KLA8"
FT                   /protein_id="ACA84449.1"
FT                   /translation="MKISTLSLSASACLLLLAGLLASVVIWSNQERQQIENRATQLQEL
FT                   QQGFLVEVRGELDVYLTTGAANKLEQAKILLQQIESQLTLFMDSDKDNLASLINQFIQR
FT                   LDTDYRAAGKLAGNPRQLLAHAESEMMDNNRHLTKYAIQAQAEHPKLAAQYLAITRQLP
FT                   PLVYQLSQLTQDYLIGKDRKLKTYLETNIRELLLWHDTLEALPLIGIFETQEADEFELG
FT                   GSESEVIEVGEDFYLELLSLTERYNKEVANTHSLLQENQATQSQLKLEIVEIEQAFLTL
FT                   SQAQSIQNQQIKNQLQYTLYIVVSILALFAITYLILQQRRVVAPLKQLNQAFHTLSASN
FT                   NRQRLTIQRRCETGQIAGHFNQLLQRFEDEDESQRQQISQVSLSLSKLVSRITQITRST
FT                   EETQTIVTDAQSQTDEIKLLAQEVNNTSKLVEQSAEQTMQQMQLSHTESEAVLLATQET
FT                   QNAVEQCHLSLSGLTTSVVDVSKIIDVIGNIAEQTNLLALNAAIEAARAGEQGRGFAVV
FT                   ADEVRNLSYRTQESLKEIQGILAQLTNANQSLETSMSGISQAAISQKTRAQSLSNLAQE
FT                   VQSQARDMAVTAKQGSVNALQQVNYLDNFSASMETLRNQAFAASQQTSIIATEVELGVE
FT                   NIELSLGIEKKELKVA"
FT   sig_peptide     complement(181773..181841)
FT                   /locus_tag="Swoo_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.436 at
FT                   residue 23"
FT   gene            complement(181954..183264)
FT                   /locus_tag="Swoo_0149"
FT   CDS             complement(181954..183264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0149"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: sse:Ssed_0167 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84450"
FT                   /db_xref="GOA:B1KM37"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM37"
FT                   /protein_id="ACA84450.1"
FT                   /translation="MKWLKKILPRSSFSQTVMLIGSLLLINQLVSYLSVATYFIQPTYQ
FT                   QINQLIARQVKLLFVDGVDVGREHLTMVDALNAKVRGDGMKIYNQKQARAAGIEQTTYY
FT                   GFLSSQMSEHLGGKAEVRIAQGDDFEIWIRPPQAPSIWIKVPLTGFNEYDLSPLTLYLM
FT                   VIGALSVAGGWWFARQQNRPLKRLQKAAILVSMGDYPKPLPLNGSTEIVEVTNAFNQMS
FT                   HSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVEEDEYLKDGIVHDIEDMDAIINQ
FT                   FIAYIRQDQESTREQEQINYLIQDVVQAESNREGKIEVELATCPDIPMQGIAIKRILSN
FT                   LVENAFRYGQGWVKLSSHFDGKRVGFSVEDNGPGIPEDQIPELFQPFTQGDIARGSVGS
FT                   GLGLAIIKRIVDRHQGEVILTNRAEGGLHAQVWLPLS"
FT   sig_peptide     complement(183169..183264)
FT                   /locus_tag="Swoo_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.344 at
FT                   residue 32"
FT   gene            complement(183315..184040)
FT                   /locus_tag="Swoo_0150"
FT   CDS             complement(183315..184040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0150"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sse:Ssed_0168 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84451"
FT                   /db_xref="GOA:B1KM38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM38"
FT                   /protein_id="ACA84451.1"
FT                   /translation="MGQETSKILVVDDDMRLRALLERYLMEQGYQVRSAANAEQMDRLL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQNGSPIPIVMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVMRRQTPDVPGAPTQQEEEITFGEFALNLATREMYHGEEAISLT
FT                   SGEFAVLKVLVSHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRLIERDPANPRY
FT                   IQTVWGLGYVFVPDGAARR"
FT   gene            184505..184990
FT                   /locus_tag="Swoo_0151"
FT   CDS             184505..184990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0151"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: sse:Ssed_0170 transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84452"
FT                   /db_xref="GOA:B1KM39"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM39"
FT                   /protein_id="ACA84452.1"
FT                   /translation="MTAMLITRKGWQALDKELKYLWKEYRPEITKKVQEAAAQGDRSEN
FT                   ADYTYNKRLLRQIDSRVRYLVKRVEDLTIVDYSPQQEGKVFFGAWVELENESGDVVQYR
FT                   IVGKDELDTKLGYITIDSPMARALIGKQVDDEVVVKTPSGAKEWYVNKIQYKAFKDE"
FT   gene            184983..185873
FT                   /locus_tag="Swoo_0152"
FT   CDS             184983..185873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0152"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: amr:AM1_2010 methyltransferase, UbiE/COQ5
FT                   family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84453"
FT                   /db_xref="GOA:B1KM40"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM40"
FT                   /protein_id="ACA84453.1"
FT                   /translation="MSEPAVADSGEIQDPLVPDWDRIELPNTWADEINFKTWTNVGRLF
FT                   RSLFKKGNGRIELPVEFPDSLMDKGELPKYLQQEFHGIPNGNFSNNITRGYISAFDGTM
FT                   LGKMKPVRKEIASWFSSATRVLDIGCAGGQMAAVVKKQGIEDVWGVDPSPYLLKHGAKA
FT                   NPDVKFVQGLAEDLKFADKRFDGITASFLFHEIPPKYIDRALSECHRVLDEGGLLAICE
FT                   PSSIQFKGGWWQMFKGYGFTGLYFKWLANHVYEPFVPAWHKQDIATLLQRHGFEVLINR
FT                   RGMPEHTVLAKKLTS"
FT   gene            185932..188340
FT                   /locus_tag="Swoo_0153"
FT   CDS             185932..188340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0153"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: sse:Ssed_0173
FT                   RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84454"
FT                   /db_xref="GOA:B1KM41"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR028231"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM41"
FT                   /protein_id="ACA84454.1"
FT                   /translation="MTCGILGATTFFTLGSTLLPMQMTQNIAQIIAQELNVREQQVSAT
FT                   IALLDDGSTVPFVARYRKEATGGLDDTQLRTLNSRLSYLRDLNDRREVILSSIDAQGKL
FT                   TPELRKSLFDADSKTLLEDLYLPYKPKRRTKGQIAIEAGIEPLADLLLGNRGADIEAEA
FT                   GKYIQAEAGFSDTKLVLDGARFILMERFAEDAILLQKVRRHLTENSVLESRVTKGKEQE
FT                   GAKFRDYFEHTEKLTKIPSHRALAMLRGRNEGVLSLSMNADPSNESKRGSYCEVIIADH
FT                   FKLNLGAGDVDAWLKTVVTATWRIKIALQMENEFIAKMRELAESEAINVFARNLGDLLM
FT                   APPAGAKATLGLDPGLRTGVKVAIVNNTGKLVAHTTIFPHAPQNQWDKSVRTLANLAKM
FT                   HKVELIAVGNGTASRETDKLAGELIAAVRDELPKITKIMVSEAGASVYSASELAADEFP
FT                   DLDVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSLSLESVVEDCVNS
FT                   VGVDLNMASAPLLAQVAGLNKTLARNIVTYRDDNGEFTERKQLLKVARLGPKAYEQAAG
FT                   FLRILNGKNPLDGSSVHPEAYSLVTAIATAKGQALDSLVGNSELLKSLNAADYITDKFG
FT                   LPTVTDILAELDKPGRDPRGEFKTAAFKEGVEKVSDLKPEMILEGVVTNVTNFGAFVDV
FT                   GVHQDGLVHISSLTDKFVSDPHTIVKAGDVVKVKVMEVDAERKRIALSMRLDEKPSEKS
FT                   TNRTTSKTTGGKPNHNGGGKPQNRAKQKPQPANAAMGNAFADAFAKLKK"
FT   gene            188521..190491
FT                   /locus_tag="Swoo_0154"
FT   CDS             188521..190491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0154"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: sse:Ssed_0174 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84455"
FT                   /db_xref="GOA:B1KM42"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM42"
FT                   /protein_id="ACA84455.1"
FT                   /translation="MRTSLSYLGPFRSILTFCFISLLFLTLSRIGLGIWQAERVAAVDG
FT                   WSHLLIQGLRVDFASLCWLWGVAALGTAIFSGDHILGRTWKSILRIWLTLGLWLIVFLE
FT                   ISTPSFIEEYGFRPNRLYVEYLIYPKEVFSMLWSGRKFELILGMLVSGLTLWGGWRLSG
FT                   TLLKNISYPRLLMRPVITLAVILVTLLGARSTLGHRPLNPAMVAFDDDPLVNSLVINSA
FT                   YSLVFAIDQMRNEANASQIYGHLDDQVVIDTVRRDSGRLSEAFTSTEFPSMSFNQATYQ
FT                   GKPKNLVIILQESLGAQFVGSLGGLPLTPNIDSLSQEGWSFENLYATGTRSVRGIEAVV
FT                   TGFTPTPARSVVKLGKSQNDFFSIASLLKKHGYETQFVYGGESHFDNMKSFFLGNGFSD
FT                   IVDENDYENPNFVGSWGVSDEDLMRRANSEFEQFHKEGKPFFSLVFSSSNHDPFEFPDE
FT                   RIELYEQPKQTRNNAAKYADYAIGEFFKLAKESSYWKDTIFLVVADHDSRVGGASLVPI
FT                   PRFRIPGIILGEGVDVKHDKRIVSQIDLAPTLISLMGISCNYPMLGRDLTQTSEDWPGR
FT                   ALMQYDKNMAYLRGDDVVILQPDRDPAGFKYYSKTGLLSKSPQSDEMKLAAKSWALWGS
FT                   MAYQKGLYRVATDDVELVTIR"
FT   gene            complement(190484..190993)
FT                   /locus_tag="Swoo_0155"
FT   CDS             complement(190484..190993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84456"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM43"
FT                   /protein_id="ACA84456.1"
FT                   /translation="MLVVTNYPNVPIATTNAATDAARTDNLQRPPVIPPQEMTKGHEER
FT                   PFTPQHERTAQHADVLARLNEKSQGKQQGTGQQQEDTKQQQQQAQPQQALMVKDLLKGK
FT                   PALQRRDIRNNQYEMSANRNEGGKETRAPVLNQPSEVYQMFGQHIEAFYQGQTEPVTQS
FT                   AISAFI"
FT   gene            complement(191059..191829)
FT                   /locus_tag="Swoo_0156"
FT   CDS             complement(191059..191829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0156"
FT                   /product="bioH protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: sse:Ssed_0176 carboxylesterase; TIGRFAM: bioH
FT                   protein; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84457"
FT                   /db_xref="GOA:B1KM44"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /protein_id="ACA84457.1"
FT                   /translation="MSSSLHIESIGQGQELVILHGWGVNSSVFTPLHASLSEYRVHYVD
FT                   LPGFGHSDPIDGDLDDWVDAIINQLPNTAIWIGWSLGGLVATKAALRYPEQVRGLVTIA
FT                   SSPCFMAREDESWPGIPPQVLSQFSTQLQQNIGKTIERFLAIQVMGSATAKEDIKQLKE
FT                   LVLSRPLPKNSALAQGLKMLENIDLRAQLPQIEQPWLRVWGRLDGLVPRRVPPLMPNHQ
FT                   AHFTDLLLPKASHAPFLSHRDEFLTGLTDWLNKF"
FT   gene            191896..192720
FT                   /locus_tag="Swoo_0157"
FT   CDS             191896..192720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0157"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: sse:Ssed_0177 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84458"
FT                   /db_xref="GOA:B1KM45"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM45"
FT                   /protein_id="ACA84458.1"
FT                   /translation="MKQKMSAELESLWGQLVFRVSSMKSVLIRDWPLSSVFIKSIQWVS
FT                   ASLPNRCLMCHQSVLLPSRGLCSACLDSGLYHQPICQGCGCSMQVQTKFCGQCTKSQPL
FT                   SVIAPCSYHQGLGRWIGAMKYQSQFAALPILSQALVCRVREMERLSLLQLPQVLIPVPL
FT                   HAKRLRKRGFNQAWLIANEIYKQLNIPIVTNAVERVVDTRSQAGLTGKQRRHNLLSAFR
FT                   LADDLPYQRVALIDDVVTTGTTAKEIASLLEKRHIHVQVWCLARAEAPGLLD"
FT   gene            complement(192726..195272)
FT                   /locus_tag="Swoo_0158"
FT   CDS             complement(192726..195272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0158"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   sse:Ssed_0178 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84459"
FT                   /db_xref="GOA:B1KM46"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM46"
FT                   /protein_id="ACA84459.1"
FT                   /translation="MLRALLYFFAASYLFVTLPSAFAATTQNLSSVSNLTSSSGLTSPE
FT                   AFLGYPLGKWHLRHDQINYYLKQLANESERLSIEHSGESFEQRQQLTAVITSKSNQAHL
FT                   DEILTQRKEAKSGKKQNGPLIIWLAYSIHGDEASGAHTALALSYLLASSNDSWVKQLLD
FT                   EAVVLITPTQNPDGFDRFSNWTNNYRGQVDVSDPRHKEHKQNWPTGRTNHYFADLNRDW
FT                   LFLRHPESRGRVALFHKWQPHYVGDFHEMNSDSSYFFQPGVPERTHPLTPEKNQQLTEK
FT                   LAQFHRQALDKEGQEYFSRQVFDDYFYGKGSTYPDINGSIGVLFEQSSPKGQVQATDNS
FT                   ELTLNDAINNHLATSISSLKGALALKEPLLDYQSQFYQGRDKAKLKGRQAGYLIGANEN
FT                   RARVKDLEDLLKQHQITFYYLTKPVTQKNREFAVNGSLFIPLHQAQKSLLLAMFDNRKE
FT                   FNDPTFYDVSSWNLEDAYDLDMARGVKLDIDVLSTEPPALDKLTLKPEAVALLINWQQD
FT                   SAALLLEQLLEKNIHVKFAAKPFSVRVNGKEQHYPAGSLQVPLKQSKSSFEKLKSIITQ
FT                   FQQNHPINITSVNTSASSSGIDLGSPDFHSIKPVKPLIITGYGVDESEAGELWYYLDTK
FT                   LGIPTTLVDATRVSQIPLSEYTHVLLPGGHYSSMNEVFARKLGQFASKGGVVIAQKGAL
FT                   SWLNKNHLLKADLKESRFFKLLFDSSDLSFGDKDTLSARQSIGGAILELKLDTSHPLSF
FT                   GMPDSKLPILKNKALGFEDSSTPFSQVAKYAQRPLLSGYLAKEYQRSLSESPAILVEPR
FT                   GKGAVVLLADNLMFRNIWLGSEKIYANALYFIPALN"
FT   sig_peptide     complement(195201..195272)
FT                   /locus_tag="Swoo_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 24"
FT   gene            195501..196079
FT                   /locus_tag="Swoo_0159"
FT   CDS             195501..196079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0159"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="TIGRFAM: IscR-regulated protein YhgI; PFAM:
FT                   HesB/YadR/YfhF-family protein; nitrogen-fixing NifU domain
FT                   protein; KEGG: sse:Ssed_0179 HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84460"
FT                   /db_xref="GOA:B1KM47"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /protein_id="ACA84460.1"
FT                   /translation="MITISDAAQAHFVNLLADQPEGTHIRVFVISPGTATAECGVSYCP
FT                   PDAVEADDMELEYNGFNAMVDEKSAPFLEDATIDFVTDQLGSQLTLKAPNAKMRKVASD
FT                   ASLNERIEYVIQSEINPQLASHGGNIMLLEVTEDGVAILQFGGGCNGCSMVDVTLKDGI
FT                   EKQLLEMFPGELTGVKDATEHQAGDHSYQ"
FT   gene            complement(196145..197479)
FT                   /locus_tag="Swoo_0160"
FT   CDS             complement(196145..197479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0160"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: sse:Ssed_0180
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84461"
FT                   /db_xref="GOA:B1KM48"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM48"
FT                   /protein_id="ACA84461.1"
FT                   /translation="MTPVELLLNRQKNKQLLALALPMILSNITVPLLGLVDTAVVGHLS
FT                   NAYYLGGVAVGSTIITLILWMLGFLRMATTGLVAQSFGAGDTQTQYKLLLQAGSLALIL
FT                   GVTAVVLQLPILNGALSLTDASAEVERYCREYFSIRIWSTPFALLNLVLLGWLLGRQQP
FT                   RAAMWQLIVANLANIGLDVLFVLGLGWGVKGAALASVFADMAGFLVAFTMVYKELNKIG
FT                   NFKFLALCKELNISSYHKLLTLNADIFIRSLCLQLSFAFMTFQGAGLGDKTVAANAVLL
FT                   NLLLLISYALDGIAYYAEAEVGRAYGQKNRKLMQESVTLAWLWSGISAVLFTLLFAFGG
FT                   ESIIRLLTSIEDVRLVASEFLFWVVLLPLLSFGSYLFDGVYIGAAKGKVMRNSMIISTF
FT                   GIFFPVWFLLQDNGNHALWAAMSAFMLARSLTLTLHYRYRLSKVI"
FT   gene            197504..198532
FT                   /locus_tag="Swoo_0161"
FT   CDS             197504..198532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0161"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   sse:Ssed_0181 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84462"
FT                   /db_xref="GOA:B1KM49"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM49"
FT                   /protein_id="ACA84462.1"
FT                   /translation="MFKSMLVILSAMICFSAQAAVILQYHHVSASTPAITSVTPEQFRE
FT                   QMQYLAENDFIVKPLSQVVDAIKAEQAIPDKTVVITFDDGYRSIAKTAHPILKEYGFPY
FT                   TLFVSIEPIKAKYREMMSWEELVLLSKEGAEIANHSWAHEHLIRKLEGETQEKWLARVE
FT                   ENILKTEREIALATGQNHKMLAYPYGEYNQAIESMLARHGFIGLGQQSGAAGHYSSLTA
FT                   LPRFPVAGVYADLTSLKVKLHSLNMPVLSQNMSDPELKNGHWRPELKVTLDISDIYPHQ
FT                   MMCYIQGQGAKAPLWLSGNEFSIRAELDLPVGRSRYNCTVPSKSRTGYYWFSQAWVRSA
FT                   SE"
FT   sig_peptide     197504..197563
FT                   /locus_tag="Swoo_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(198549..199571)
FT                   /locus_tag="Swoo_0162"
FT   CDS             complement(198549..199571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0162"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: sse:Ssed_0182 protein-glutamate
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84463"
FT                   /db_xref="GOA:B1KM50"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM50"
FT                   /protein_id="ACA84463.1"
FT                   /translation="MIKVLVVDDSPLVRQLLTHLLSDAPDIKVVGTAEDPYEAREQIKR
FT                   LHPDVLTLDIEMPKMDGIAFLRNLMKLKPMPVIMVSTLTEKGAAVTLEALSIGAVDFIL
FT                   KPKSDLTSRLMEYREELIEKIHFASKSTIRPYTPIPKPSSDKQKSTYSRNKVIAIGAST
FT                   GGTEAIQRLICQLPHDISPIVIAQHIPAAFSTSFAKRLNSNASMTVIEAQGGELLKPGT
FT                   AYLAPGSAHLVVERKGMSLYTKLLDTDPVNRHRPSVDVLFDSVAESVGKSALGVILTGM
FT                   GKDGAKGLLNMKNQGSFTVAQDEASSVVWGMPGAAVDIEASSEILHIDRIPQKILSLLK
FT                   "
FT   gene            complement(199672..200514)
FT                   /locus_tag="Swoo_0163"
FT   CDS             complement(199672..200514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0163"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   sse:Ssed_0183 protein-glutamate O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84464"
FT                   /db_xref="GOA:B1KM51"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM51"
FT                   /protein_id="ACA84464.1"
FT                   /translation="MTKADFEFIRSLAYENTGIVLPERKKHMVYSRLSRRLRQLNLKDF
FT                   TQYCSFVSNTPDERIHFINALTTNLTAFFREGHHFDYLEQVVIPEWQRKSKKRLRVWSS
FT                   ACSTGEEPYSIAMTLEKHFPISQWDLKILATDLDTNVLEKASIGNYSRDSVTNLPARYL
FT                   DKYVRHTADNQHIQMRSNIQKMIHFKQLNLLEKWPMNGPFDAIFCRNVLIYFDNETKQK
FT                   IIAKFRKMLSPQGYLFIGHSETLVNISEEFDLIGQTIYRPLGHGGKKLAKPKFSAHHL"
FT   gene            complement(200554..203925)
FT                   /locus_tag="Swoo_0164"
FT   CDS             complement(200554..203925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0164"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   sse:Ssed_0184 methyl-accepting chemotaxis sensory
FT                   transducer with PAS/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84465"
FT                   /db_xref="GOA:B1KM52"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM52"
FT                   /protein_id="ACA84465.1"
FT                   /translation="MEANYANISNTRALPIAGLLVSAIALALSLTGQATSWIATAQVLA
FT                   ILLIAAGLLKLTQWQKHTDQALNEVSNALLNNEPPHFSDIDLPSWGLLTNRIEELHHKR
FT                   QQDETTIKALDVCQANVMMADADFNISYMNDSVTEMLSQNEKALQSSLSNFDTKNLIGK
FT                   SIDMFHSNPAHQRRVLESLNGSHEANIEVAGLKFNLIASPIFVNGKRTGTVVEWIDMTE
FT                   KLAKEAEEKRTSAETGRVKQALDVCKANVMMADADYNIVYFNESLKEMLSENERTLQES
FT                   LSKFDMSTLMGSNIDIFHKNPAHQRGMLDRLTSTYETDIKVSGLTFSLIATPVFDNGER
FT                   TGTVVEWQDITAKLAKEAEEQQQAAETGRVKQALDVCKANVMMADADYNIVYFNDSLKE
FT                   MLSENERTLQESLNQFDMSTLMGSNIDIFHKNPAHQRGMLDRLTSTYETDIKVSGLTFS
FT                   LIATPVFDNGERTGTVVEWQDITAKLAKEAEDKQAAAETGRVKQALDVCQANVMMANAD
FT                   YEIIYFNDSLKAMLSENERKLQETLTRFDMTTLMGANIDIFHQKPSHQRNLLDKLTSTY
FT                   ETSIKVSGLTFNLIATPVFNNGERTGTVVEWLDVTAKLAKEAEEQKLAAENARIKQALD
FT                   NVSANTMVADADLNIIYMNNAVSNMFRAAQSDIVKDLPNFDANNLIGVNIDGFHKNPSH
FT                   QRNLLGNLNSTYSSQLHVGGRTFKVVANPIKDTNGDKIGTVVEWTDRTAEVAIEHEIDT
FT                   IISAAAAGDLSHRVSTDGKEGFFLNLSNGLNRLVGIADSVISDVVNMFDGLAKGDLTRQ
FT                   INGDYDGQFRKLQTDANATASRLTEVIGGINESANTVTSGAEEIAQGNSDLSQRTEEQA
FT                   ASLEETASSMEEMTATVTQSAQNATLANELAQEANTKADHGGKVVEQAVTAMEAINDSS
FT                   KRISDIIGVIDEIAFQTNLLALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAGAAKEI
FT                   KELIRDSVGKVTDGTQLVNQSGETLQDIVQAVTKVADMISQISIASDQQSSGIQEVNKA
FT                   ISQMDEMTQQNAALVEEVSAAGDAMAEQARNMKNQLSFFQAKEQTSSGLTSAPLALVSG
FT                   DSHGNLNISDEEWNEF"
FT   sig_peptide     complement(203821..203925)
FT                   /locus_tag="Swoo_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.308 at
FT                   residue 35"
FT   gene            complement(203949..204500)
FT                   /locus_tag="Swoo_0165"
FT   CDS             complement(203949..204500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0165"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: sse:Ssed_0185 CheW
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84466"
FT                   /db_xref="GOA:B1KM53"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM53"
FT                   /protein_id="ACA84466.1"
FT                   /translation="MTQITQQEQAIADDISQQYLTFIMASEEYGVDILSVQEIRGWEAT
FT                   TIIPNSPSHVKGVINLRGTIVPIIDLRQRFGIETLEYGATTVVIVVKVAIASDHKVIGI
FT                   VVDAVSDVFSVNHGDVRNAPDFGDETDLGFIKGLTNTEDKMVILLDINKLLGSEILPEA
FT                   SQLSNLIHNIDAQQPQAVNE"
FT   gene            complement(204548..206581)
FT                   /locus_tag="Swoo_0166"
FT   CDS             complement(204548..206581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0166"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; KEGG: sse:Ssed_0186 CheA
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84467"
FT                   /db_xref="GOA:B1KM54"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM54"
FT                   /protein_id="ACA84467.1"
FT                   /translation="MEIDLSQFSQVFFEESLEGLASMESELLKLEVNEPDDESINTIFR
FT                   AAHSIKGGSATFGFTQVADYTHLLETLLDEIRDGRRQMTTDHQDMLLLSVDLLRNMIDA
FT                   LMRKVDFADPLLAQLETRFTAALAQNSSESEEEQSVTESSSGESSPQNTTWIIDFQPGI
FT                   DILRCGNDPSLMFNELRLLGELEVTLVDSTLPDFSDMDPEACYLNWQLALVTDKPLEQI
FT                   KEVFEWVEDECTINYHQETDAPVKEQAEEAGTPANTEASPSTEVIAKPKAVTPAKTPEG
FT                   GSIRVSIEKIDLLINMVGELVITQAMLGQIGQQDTIDEESLLSMKQGLEQLASHTRDLQ
FT                   ESVMQIRMLPISFAFNRFPRLVRDIGQQLGKQVELILKGEDTELDKTVMEKIVDPMVHL
FT                   VRNSLDHGLETPEVRVSKGKPEQGSITLNAFHQGGNIIIEIIDDGAGLDTQLIHKKAID
FT                   KGLVTEDEELSEDAIHQLIFKAGFSTAEAVSDLSGRGVGMDVVRRNIHELNGTIELKST
FT                   KDKGSRFTIRLPLTLAILDGQLVRVGQHTYVVPLVSIHESLQVEEQRINRISENHELVR
FT                   LREEYLPVVKVFQEFGHDADFQEIRDGLVMVVDSNNEKIGLLVDELLSQQQVVIKSLED
FT                   NYSKVPGVSGATILGDGTVALIIDISGLVTLAGIANMKEHAA"
FT   gene            complement(206616..206978)
FT                   /locus_tag="Swoo_0167"
FT   CDS             complement(206616..206978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0167"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   saz:Sama_3494 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84468"
FT                   /db_xref="GOA:B1KM55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM55"
FT                   /protein_id="ACA84468.1"
FT                   /translation="MKKILAVDDSASMRQMVGFTLKTAGFDVTEACDGDEALKAAQGGE
FT                   FDLVISDVNMPVMDGLTLIRNLRTLPAYKFTPLLMLTTESGVDKKHEGRSAGATGWIVK
FT                   PFNPDQLLATVRKVLG"
FT   gene            complement(206978..207274)
FT                   /locus_tag="Swoo_0168"
FT   CDS             complement(206978..207274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84469"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM56"
FT                   /protein_id="ACA84469.1"
FT                   /translation="MSDQTIKLDSEITIRNIQPVFTQLCELFTQAEILHIDASQLSRVD
FT                   TAGAQLLHLFSKTCDARSLKVDWLGCQDDLLESLGELGISLPHLKVDTLEEDT"
FT   gene            complement(207464..208108)
FT                   /locus_tag="Swoo_0169"
FT   CDS             complement(207464..208108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0169"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC; KEGG: sse:Ssed_0189 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84470"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM57"
FT                   /protein_id="ACA84470.1"
FT                   /translation="MSKRLTVVISTIFGLALLGLGVAAAIQFKSHRAEPELATSFIFPT
FT                   AKKLAPFSLKDQHGNLFSNSQLADKWSLFFIGYTSCPDVCPTTMGKLSAAYPELLKDID
FT                   LQIIFLSVDPQRDTQEKLLAYMDFFNPEFTAITGEHAQLFPLTRDLGFVYAMVGEGENY
FT                   QVDHSASMALISPEGRKVAIIKPKSSTPGTLPQILTKNLISDIGKIVSTQQ"
FT   sig_peptide     complement(208034..208108)
FT                   /locus_tag="Swoo_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.678 at
FT                   residue 25"
FT   gene            complement(208139..209047)
FT                   /locus_tag="Swoo_0170"
FT   CDS             complement(208139..209047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0170"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: sse:Ssed_0190 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84471"
FT                   /db_xref="GOA:B1KM58"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /protein_id="ACA84471.1"
FT                   /translation="MAKPLSISSSDTQSQPLQWRAYYEMTKPKVVALMLLTVLVGMCLA
FT                   LPGAVPLQPLIFGLLGIGMMAGAAAAFNHLIDRRIDGLMARTYNRPLPKGRVSITKALT
FT                   FSISLAVLGFVLLYTLVNELTAWLTFASLLGYAVVYTAYLKRATPQNIVVGGLAGAMPP
FT                   LLGWTSVTGEFHGNALLLVIIIFAWTPPHFWALAIHRKAEYAKVDIPMLPVTHGTEFTK
FT                   TCILLYTILLAIACLLPVLVGMCGPLYLVGSTLLSCGFIYKSWELKFDDKPGLAMQVFR
FT                   FSIYHLMLLFIVLLVDHYLWV"
FT   gene            complement(209150..210133)
FT                   /locus_tag="Swoo_0171"
FT   CDS             complement(209150..210133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0171"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG:
FT                   sse:Ssed_0191 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84472"
FT                   /db_xref="GOA:B1KM59"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM59"
FT                   /protein_id="ACA84472.1"
FT                   /translation="MQIPSLLKITIIFTLCVILMGAYTRLSDAGLGCPDWPGCYGMLKV
FT                   PSQAHELSQVQATFPGHEVEPKKAWLEMIHRYIAGALGLLVLLIFILCLKKDEAPKKLP
FT                   GLIALLIVFQAALGMWTVTMKLMPVVVMSHLIGGFSLIALLLLLYLRTKPLRIPGGDAI
FT                   ARKLAPLALICLGVLILQIIIGGWTSSNYAALACTTLPICEGDWYNNLKLAQAFNPFQG
FT                   EHDTYEFGVLDYASRMTIHVVHRFWAVVTAAMLFWLAFKLYQQSQSSLLKRSALLLVLL
FT                   VCLQVALGISNVVLHLPLGVAVSHNAGAALLLLNLVFINYALWRKA"
FT   gene            complement(210133..210678)
FT                   /locus_tag="Swoo_0172"
FT   CDS             complement(210133..210678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84473"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM60"
FT                   /protein_id="ACA84473.1"
FT                   /translation="MNSPKKSGKKPLLILLLVFILPVVAAKIVLSLDLYQGGATNKGEL
FT                   LTTGTSYSSLAMENPKPKEWQLLYLLPEICEQVCQDRLYILQQSHVALGREQDRVHTLI
FT                   LVNDKSDISALSNSPFETAKANNQMSEMLSQQQMIIVDPLGSLVMRYPSVSGREEQVLQ
FT                   GKSLVSDLRKMLKLSRVG"
FT   sig_peptide     complement(210601..210678)
FT                   /locus_tag="Swoo_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.819 at
FT                   residue 26"
FT   gene            complement(210889..211584)
FT                   /locus_tag="Swoo_0173"
FT   CDS             complement(210889..211584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84474"
FT                   /db_xref="GOA:B1KM61"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM61"
FT                   /protein_id="ACA84474.1"
FT                   /translation="MLVILATVSLFLLLVKLGFWQLSRAELKEELQSQLTSRQAAAPLS
FT                   YRKLLSLPASEPLTGYKLSTTVTPVGNKVFLLDNQIFNGQVGYLALQVMQVNPIDPWLL
FT                   VELGFVPAGNDRRVLPKLPHINQSQTFTGRLYQKQANPMSSDLFAEEGWPKRVQNLNIS
FT                   QIETTLNHPVALAVLQPESIKGINLPHPWQPIPLSAQKHLGYALQWFSMAVAFALLVFY
FT                   FIRVRLKKK"
FT   gene            211619..211837
FT                   /locus_tag="Swoo_0174"
FT   CDS             211619..211837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_3487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84475"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM62"
FT                   /protein_id="ACA84475.1"
FT                   /translation="MNTLLVFKLVLVLLLLFILFNLARALFIMVKGESKVPMSQYLGRR
FT                   VIFSVLVVVLLLLAMATGVITPNIRPY"
FT   sig_peptide     211619..211696
FT                   /locus_tag="Swoo_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.494 at
FT                   residue 26"
FT   gene            complement(211958..212833)
FT                   /locus_tag="Swoo_0175"
FT   CDS             complement(211958..212833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0175"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   sse:Ssed_0195 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84476"
FT                   /db_xref="GOA:B1KM63"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM63"
FT                   /protein_id="ACA84476.1"
FT                   /translation="MTTKHEHYYVPAQSAWPIIGAIGLFLIAFGAGSYVQQLNTESSSG
FT                   GYILLAGIAVIIYMIFGWFRTVIAESMSGLYSQQMDRSFRQGMSWFIFSEVMFFAAFFG
FT                   ALLYARMIAVPWLGGDSNNAMTNEVLWPGFEAIWPLVKTPDGTTTQAMGWTGLPLYNTL
FT                   ILLTSSITLHMAHVSLEKGKRSAISVWLGITILLGFAFLGLQVEEYVHAYQEMGLTLDS
FT                   GVYGNTFFLLTGFHGMHVTLGTVFLIVLFFRVLKGHFTPDKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
FT   gene            complement(212830..213393)
FT                   /locus_tag="Swoo_0176"
FT   CDS             complement(212830..213393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0176"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: sse:Ssed_0196 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84477"
FT                   /db_xref="GOA:B1KM64"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM64"
FT                   /protein_id="ACA84477.1"
FT                   /translation="MEKAESNKKLISMLIAGAIGMFGFGFALVPLYDVLCEQLGINGKT
FT                   SNTASSYQAMTIDKSRTVTVEFMAQIQSDMPWEFTPEMKRMQVHPGELIRTNFKAINLS
FT                   MEETLGQAIPSVSPGQGAAYFNKTECFCFNQQRLTAKASAELPLIFFVDPDLPESISTL
FT                   TLSYTLYNITDRGYVDAIEQGAAR"
FT   sig_peptide     complement(213310..213393)
FT                   /locus_tag="Swoo_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.942 at
FT                   residue 28"
FT   gene            complement(213396..215018)
FT                   /locus_tag="Swoo_0177"
FT   CDS             complement(213396..215018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0177"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: sse:Ssed_0197 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit I; PFAM: cytochrome c oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84478"
FT                   /db_xref="GOA:B1KM65"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM65"
FT                   /protein_id="ACA84478.1"
FT                   /translation="MTSTTHDAQDNIEPEHNQADHHDDHHEAMPTGIKRWLFTTNHKDI
FT                   GTLYLWFSFIMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAF
FT                   TGLANWLIPMMIGAPDMALPRMNNWSFWILPFAFAILLSSLFMEGGGPNFGWTFYAPLS
FT                   TTYSPDSTALFVFAVHIMGISSIMGAINVVVTIVNMRAPGMTWMKLPLFVWTWLITAFL
FT                   LIAVMPVLAGTVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGI
FT                   ISAIVPAFSRKPLFGYSSMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIA
FT                   VPTGVKVFNWVATMWRGSISFETPMLFAVAFIILFTIGGFSGLMLAITPVDFQYHDTYF
FT                   VVAHFHYVLVTGAIFSIMAAAYYWLPKWTGNMYDEKWGKIHFWTSVISVNVLFFPMHFL
FT                   GLAGMPRRIPDYAVQFADVNQIVSIGGFAFGLSQLIFLYVVIKCIRSGEKAEAKPWDGA
FT                   EGLEWTLPSPAPYHSFSTPPEIK"
FT   gene            complement(215028..216569)
FT                   /locus_tag="Swoo_0178"
FT   CDS             complement(215028..216569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0178"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: sse:Ssed_0198 cytochrome-c oxidase; TIGRFAM:
FT                   cytochrome c oxidase, subunit II; PFAM: cytochrome c
FT                   oxidase subunit II; cytochrome c class I; cytochrome C
FT                   oxidase subunit II transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84479"
FT                   /db_xref="GOA:B1KM66"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM66"
FT                   /protein_id="ACA84479.1"
FT                   /translation="MKKALYCFLALLFTPPMLASEMPLNMTQGVTEISGQVYNLHMIIL
FT                   YICCAIGILVFGVMIYSMINHRKSKGAIAANFHESTKVEIAWTVVPFIILILMAIPATK
FT                   TLIAMEDPSDADITIKVTGSQWKWHYSYFDEDIEFYSLLSTPREQIDGTEAKGENYLLE
FT                   VDNPLVLPINKKVRFLMTSEDVIHSWWVPAFAVKKDANPGFINEAWTRIDKTGTYRGQC
FT                   AELCGKDHGFMPIVVEAVSEADFDTWLVEQKSKASSAAAEAQAALSKTLSMDELMTQGE
FT                   QVYMANCAACHQPNGAGLPGVFPSLIGSPLIKGAVAGHVDIVLNGKTGTAMQAFAKQLT
FT                   ATEIAAVVTYERNAWGNDSGDTVQAADISSASPASATPSESEAAVPVTLPEIEEAAAEV
FT                   VEEVKAVVLDDLTMDELMAMGEKVYMTNCVACHQAAGTGLPGAFPSLVNSPVITGPVTG
FT                   HLDMVIKGKPGTAMQAFGAQLTPQEIAAVITYERNAWGNNTGDMVQAADVNQHGQ"
FT   sig_peptide     complement(216504..216569)
FT                   /locus_tag="Swoo_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.452 at
FT                   residue 22"
FT   gene            complement(217168..217680)
FT                   /locus_tag="Swoo_0179"
FT   CDS             complement(217168..217680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84480"
FT                   /db_xref="GOA:B1KM67"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM67"
FT                   /protein_id="ACA84480.1"
FT                   /translation="MNTLIGNGPRHPGLWIDHQTHYSSQLQSSTISSVASSTQGREELK
FT                   QVSSQLATLSQQGQWIVLISPPNIGYKKLLAEAGVRMNRVLLVHAKDEVETLWAMEKAL
FT                   TSGTSSAVLCWTQSLDARDSRRLQIVAKSARALGVVIEDANSSSQVNTHNPIIDSALQP
FT                   SLFSSVH"
FT   gene            complement(217677..218294)
FT                   /locus_tag="Swoo_0180"
FT   CDS             complement(217677..218294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0180"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="TIGRFAM: LexA repressor; KEGG: slo:Shew_0127
FT                   SOS-response transcriptional repressor, LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84481"
FT                   /db_xref="GOA:B1KM68"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /protein_id="ACA84481.1"
FT                   /translation="MRPLTPRQAEILELIKCNIAETGMPPTRAEIAKRLGFKSANAAEE
FT                   HLKALAKKGCIEIIPGTSRGIRLAQTEELEEQGLPLIGQVAAGEPILAQEHVEQHYQVD
FT                   PNMFHPSADFLLRVRGDSMKDIGILEGDLLAVHKAEQARNGQVVVARVEDDVTVKRFEK
FT                   KGSTVYLHAENEDYSPIVVDLTNQSLSIEGLAVGVIRNGDWQ"
FT   gene            218514..220937
FT                   /locus_tag="Swoo_0181"
FT   CDS             218514..220937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0181"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   sse:Ssed_0201 glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84482"
FT                   /db_xref="GOA:B1KM69"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /protein_id="ACA84482.1"
FT                   /translation="MSKQDSLWFKSLRWLQKKLVHTIVVPQEPFKDLNLDPEKPLVYVM
FT                   KTESLSDIAALSEITGELGLPSPYEPLEVEGRSTPRVVCLEGAKPLMGKRESNEFFLSS
FT                   FMDLLKAHKESPDLDIQLVPVSLYWGRTPGKEDDTMKAAVLERENPTWLRKCLMILFLG
FT                   RHNFVQFSNSVSIRYMADEHGTDKRIAHKLARVARVHFSRQRKVMTGPVLPKRQALFHA
FT                   LINSESLKRAIQEEATSKKISEVEARAKAMEYLDEIAADYSDSLVRIAERFLTWLWNKL
FT                   YKGINIKGAEQIRQLHHDGHEIIYVPCHRSHMDYLLLSYILYYQGMVPPHIAAGINLNF
FT                   WPAGPMFRRGGAFFIRRSFRGNKLYTAVFREYLDQLFTKGYSVEYFTEGGRSRTGRLLA
FT                   PKTGMIAMTLNSVLRGMERPVTLVPVYLGYDHVMEVATYHKELSGKKKKKESVWQVFGA
FT                   LRKLGNFGQGYVNFGKPITLHSFLNEQVPDWREEIASDPEQKPTWLTPVVNTLANQVMT
FT                   NINDAAAVSSVTLTSLVLLASEQNALERTQLEKQLDLYLKLLKDLPYTSYTSVVEGDGK
FT                   QLVTQGLELKKLQLDSDPLGDIVSIDESISIAMTYYRNNIIHLMIIPSLVASCLTQHER
FT                   ITRDEIKAIIADFYPLLEAELFMGVEDTDKLVEQILDLFIEQQLIREDTGFSVVETSIN
FT                   QLLLLAGTVSETLQRYAIIFNLLADFPEMERSDLEAESHKLAKRLGALHGITAPEFYDK
FT                   NLYRTLSVKLKDLGYLKDNGNKADVERVRASANGLLRSSVRQTIVDSVAAERSA"
FT   gene            221045..222301
FT                   /locus_tag="Swoo_0182"
FT   CDS             221045..222301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0182"
FT                   /product="aromatic amino acid transporter"
FT                   /note="TIGRFAM: aromatic amino acid transporter; PFAM:
FT                   aromatic amino acid permease; Amino acid transporter
FT                   transmembrane; KEGG: sse:Ssed_0202 aromatic amino acid
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84483"
FT                   /db_xref="GOA:B1KM70"
FT                   /db_xref="InterPro:IPR002091"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM70"
FT                   /protein_id="ACA84483.1"
FT                   /translation="MANHMNAAKDKAAGKSLLGGAMIVAGTAVGAGMFSLPVVGAGMWF
FT                   SYSILMMLGVWFCMLVSGLLLLETNLHFEPGSSFDTLTRETLGQFWRIVNGLSIAFVLY
FT                   ILAYAYISGGGSVVNHSLQVSGIELPQSLAGLVFALGLAFIVFISTKAVDRITTIMLGG
FT                   MIITFFLAIGDLLIDIDTVKLFAPNGEDTYLPYILAALPFGLVSFGYHGNVPSLVKYYG
FT                   KKPNTIIKAILIGTLIAFVIYVCWLVATMGNIARGDFVNIIAQGGNMGVLVSALSDVMS
FT                   SSWLTTMLTIFANLAVASSFLGVTLGLFDFLADLFGFDESRGGRFKTAAVTFLPPTVLG
FT                   LLFPNGFLVAIGFAALAATVWTAIVPAMMVYKIRKKFPNSTGFKVPGGNAVIVIVMLFG
FT                   IITGACHLLAMADLLPVYG"
FT   sig_peptide     221045..221167
FT                   /locus_tag="Swoo_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.869 at
FT                   residue 41"
FT   gene            complement(222348..223358)
FT                   /locus_tag="Swoo_0183"
FT   CDS             complement(222348..223358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0183"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: sse:Ssed_0203 conserved hypothetical
FT                   AraC-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84484"
FT                   /db_xref="GOA:B1KM71"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM71"
FT                   /protein_id="ACA84484.1"
FT                   /translation="MKFNTSFIRVCYLKPVFDGMQQIFGIGYRDLNIPQTLMQEPMALI
FT                   PFTQVGHWLTELAELSQDPCYMVKLSEYLHFNRLEITGIDPLATPDVAMSIRRINYGVV
FT                   SLHSGASYYVSQSAKIMKWCYKNPYVFKQQKSLDSLRVAITLLNAQRHFLGKDYRPIRV
FT                   QLSGSAIGHEQVSELFGSPVVWNAAQTEIWFDIDEMVHSISPDQEFNAPVTMPRSLFEK
FT                   YLNMPQPHDAPKVLFEMINYSRFYGLPKVKAVAKLFNISEQQLQRRLQYLGLSFSTISN
FT                   YIISNQAIKYMLDGKEIDEIASLLGYANQQSFSRAFKRLRRCTPQQYLDRLNLKK"
FT   gene            223493..223852
FT                   /locus_tag="Swoo_0184"
FT   CDS             223493..223852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0184"
FT                   /product="putative permease of the major facilitator
FT                   superfamily"
FT                   /note="KEGG: sse:Ssed_0204 putative permease of the major
FT                   facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84485"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM72"
FT                   /protein_id="ACA84485.1"
FT                   /translation="MSLLGMPFVDTGADTALHVVALVVMVVTVSAVAVGFWKIHEMPIN
FT                   KAHKEEHHQIGLITALTWIGFVWHWVWVLAVFVAFVDGEKALRKLRDIWHEQPDNSAQQ
FT                   SLEAPQSDREVTNNA"
FT   gene            223845..225065
FT                   /locus_tag="Swoo_0185"
FT   CDS             223845..225065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0185"
FT                   /product="putative multidrug resistance efflux pump"
FT                   /note="KEGG: sse:Ssed_0205 putative multidrug resistance
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84486"
FT                   /db_xref="GOA:B1KM73"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM73"
FT                   /protein_id="ACA84486.1"
FT                   /translation="MLEGLAVWALFIYLLRLVGMPWNKFSKAFAYIGGGGWLLFVWVGL
FT                   LNFTPMDLSGGSLVQSPHIQLRPASSQIKGSVKHIYVEPNQRIEQGQLVYELDDEPYQI
FT                   ALNKAKVDLNAAEVALKLANEDVKLAMKQHQSVLADTKISQSQVVAAQKDLSWKEKTLT
FT                   RYVEQNRVVPDTITKSQLDEQQTAVALAQSQLASYVASVEKATFAEHKAGLEIEKAHLA
FT                   VASRQSDLAGQAETLAKAQWDLDSTKVYAPADGYLTNFIMREGQFVGLVPRIAMYTDEK
FT                   YVLMRVNHQAIRNVKVGQSAEFASAVYPGKVFRAQVEGIVEATGEAQGSLLARDDNVRQ
FT                   TTGQNLNNKHHFVRLKLEEGEYDLPVGAVGLAWISAEKPTALLSFLDVIRGIIIRMKSQ
FT                   IYYFYSI"
FT   gene            complement(225146..226342)
FT                   /locus_tag="Swoo_0186"
FT   CDS             complement(225146..226342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0186"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; SMART: GGDEF domain
FT                   containing protein; KEGG: spl:Spea_3267 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84487"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM74"
FT                   /protein_id="ACA84487.1"
FT                   /translation="MSAFYHRCRFLFLPLFVTALSLAIFQFSQPRLNAWHETIAQLPFW
FT                   LLSISILIAIQFNRSRLAYLAALLQAYYLFTSSAQFTIEGLDNYSEQLLLGGVFTITWF
FT                   AFIKDRGLLSPHSLIRTLGIILSFSAAFGWQWANVTFDNDLKLYLPEFITIEIRTLILL
FT                   SLCTLLVFLRGLWLSNLVSTAIVITLLLWGVNFLLPNYLPSAVSLSMLAIIYLLTVLAD
FT                   SYFLAYRDELTGLASRRALYNLVLSLGRKYTVAMLDIDHFKKFNDTYGHDVGDQVLKLV
FT                   ASKIAEVTGGGKAFRYGGEEFTIVFSRKDLSSVLPHLEKVRKEIEKYDIVLRDEKRKKQ
FT                   TKAKRNKAQERNSKRVVNVTISIGVADHQHRESFEQTMKEADKALYRAKKKGRNQLSE"
FT   sig_peptide     complement(226256..226342)
FT                   /locus_tag="Swoo_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.274 at
FT                   residue 29"
FT   gene            complement(226576..226989)
FT                   /locus_tag="Swoo_0187"
FT   CDS             complement(226576..226989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0187"
FT                   /product="globin"
FT                   /note="KEGG: sse:Ssed_0207 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84488"
FT                   /db_xref="GOA:B1KM75"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM75"
FT                   /protein_id="ACA84488.1"
FT                   /translation="MALTQRQIQLVQHSFSLVEPISEQAADLFYDSLFKIDPSLKPLFR
FT                   NNIKVQGRKLVAMLKAAVDGLDDLNTLVPVLQQLAQRHNAYGVKKSHFTPVGNALLYTL
FT                   KTGLGSEYTDEVRQAWIIVIHIVADTMKPEIEN"
FT   gene            227207..228001
FT                   /locus_tag="Swoo_0188"
FT   CDS             227207..228001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0188"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: sse:Ssed_0208 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84489"
FT                   /db_xref="GOA:B1KM76"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM76"
FT                   /protein_id="ACA84489.1"
FT                   /translation="MKVNQYVHGQPCWIELASRDAHAGKQFYSTLFDWKVQDMPIPNGV
FT                   YSMLALEVEGECSDIGAAYQMPETMSEQGAPTTWTVYFAVDNVDATVAAVISNGGNLEL
FT                   GPHDVGTAGRMALLSDPEGARFAIWQAGDHIGAKRHGENGSLCWVELASRDGQDAKTFY
FT                   SSSLGWDSRQDPMPDFTYTEWLVEDVPFGGMMEMTEEWGEMPAHWMLYFAVEDCDKTAE
FT                   MATSLGGQICVPPTNIPEVGRFSVISDPQGGFFSVITLNSVE"
FT   gene            complement(228085..231219)
FT                   /locus_tag="Swoo_0189"
FT   CDS             complement(228085..231219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0189"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; KEGG:
FT                   sse:Ssed_0210 heavy metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84490"
FT                   /db_xref="GOA:B1KM77"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM77"
FT                   /protein_id="ACA84490.1"
FT                   /translation="MLKKIIEASIKQRFMVLIITIMITVWGIQELRNTPLDALPDLSDV
FT                   QVIIKTPFPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGYSFFGDSYVYVIFEDGTDIY
FT                   WARSRVLEYLNQVSSRLPQGVQPSLGPDASGVGWIFEYALVDRSGNLDLSQLKSLQDWY
FT                   LKLELQTVAGVSEVATVGGMEQTYQIVIEPDKLAIYKLDIASIKNAIAKSNTEAGGSVI
FT                   EMAEAEYMVRAKGYRQTLDDFREIPLGITSPSGTGLLLKDVATVRKGPASRRGIAELDG
FT                   EGEVVGGIIVMRYGENALATIEAVKTKLEQLKSGLPEGVEIITTYDRSQLIESSVENLF
FT                   HKVIEEMFVVGLVCLLFLLHARSTLVAVITLPLAILIAFIVMNKMGVNANIMSLGGIAI
FT                   AIGAVVDGAIVMIENMHKHLEHFREKNNRSPNNIEHWKIVSEASIEVGPALFFSLVIIT
FT                   LSFVPVFALEAQEGRLFSPLAYTKTFAMAAAAVLSITLVPILMGFFIKGKIPKESSNPI
FT                   SRFLIAIYKPSLTLVLKFPKMTLVVALIALMSAWYPLSNIGSEFMPELEEGDLLYMPTA
FT                   LPGISASKAAEILQQTDRLIKTVPEVKRVFGKVGRAETATDPAPLTMLETTIMLKPRDE
FT                   WREGFELKDIIEQLQQTVKVPGLTNAWVQPIKTRIDMLSTGIKTPVGIKITGGDVDELQ
FT                   KIGTNIEAILSKLPHTKSAYAERVGGGRYIDITPKLDVASRYDMTLTDIQDVVRYAIGG
FT                   MDIGESVQGAERYPINLRYPRELRDNIEKLRELPVITKTGHYLPLRNLADIEITDGAPM
FT                   LKSENGRLISWVFVDIEGTSIGEYIEQAKTALDSELVVPPRYSYVFAGQYEYMQRVDAK
FT                   LQKVIPMALGVIFILLMLTFGSTLQATIIMMSLPFALVGSTWLLYLLEFNMSVAVAVGM
FT                   IALAGVAAEFGVVMLVYLNNAIKHRKESGGYEAVSDLKEALIEGAVMRIRPKAMTVATI
FT                   FFGLLPIMWGAGSGNDVMQKIAAPMVGGMVTAPLLSLFVLPALYLLIYSRKLKKD"
FT   gene            complement(231234..233033)
FT                   /locus_tag="Swoo_0190"
FT   CDS             complement(231234..233033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0190"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: sse:Ssed_0211 membrane-fusion protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84491"
FT                   /db_xref="GOA:B1KM78"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM78"
FT                   /protein_id="ACA84491.1"
FT                   /translation="MSQLEMNNKRNKLAYLLSLFMVVTPQLAHSQSLLAQTAPEPKHVA
FT                   HNHSHGSATYVCPMHPNETSHEAGSRCSICNMFLVEAEEEGEKGSHGDHLAMEQKAYVC
FT                   PMHPDETSHEAGSRCSICNMFLVEDEEEEEKGSHGDHLAMEQKTYVCPMHPDETSHEAG
FT                   SRCSICNMFLVEAEEEEEKGEIDHSNHDMSAMPADEHSGHSHQAASTPADAVFNAAEPT
FT                   PLNDGGSIKYVCPMHAHIISDVPGTCPICGMNLEKVEVGGSSKEIQIDVSGGMQQALAL
FT                   KVARVEKDTLWKFVQTVGQVDYDESQINHIHARVNGWIEKLTITSVGDKITKGQLLYEI
FT                   YSPELINAQDDFLLAQDTVKRAGKDANYQDLVRKAGLRLELLGFQPYQIKALAKSKKTQ
FT                   YRVPFYAKSDGIVKALNVRDGMYIQPATEVMSVVDLSKVWVIADVFENEQSWLAVGQKA
FT                   EISVPAMGIKGIEGEIDYIYPELDPVTRSLRVRIVVSNTDIELRPNTLAKIGIFGGPNK
FT                   DVLVIPQEALIQTGKENRVIVKLEDNNFTARKVTVGMLSQGKAEIKEGLAENERVVTSG
FT                   QFLLDSEASLKGSLMRLSSGHQH"
FT   sig_peptide     complement(232941..233033)
FT                   /locus_tag="Swoo_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.563 at
FT                   residue 31"
FT   gene            complement(233056..233472)
FT                   /locus_tag="Swoo_0191"
FT   CDS             complement(233056..233472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84492"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM79"
FT                   /protein_id="ACA84492.1"
FT                   /translation="MKTLLSLILSAFILISAAPLATAHEHSQHKADDQHHQMKVDHACP
FT                   MHAEVTGKQGDTCPKCGMNLTKVQGSSEQHKNCASCPKHKNHQHKHDKTAHTHACPMNS
FT                   SITGKEGDTCPKCGMNLEPMQAKADSKSTGHHKH"
FT   sig_peptide     complement(233401..233472)
FT                   /locus_tag="Swoo_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 24"
FT   gene            complement(233744..234175)
FT                   /locus_tag="Swoo_0192"
FT   CDS             complement(233744..234175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84493"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM80"
FT                   /protein_id="ACA84493.1"
FT                   /translation="MFTFLRRHTLLVFTLLAMLSQGVFASGSMIGMSPTHEAMMSGAHH
FT                   GQMMSMKNGESCHTEQKITPSHCCELEQTMLPGAAQNCCDGEGLCKGDCNHCLVISMTG
FT                   TLFSSKSWSGFSPSEFVMATQMPHFHSISLPQDIRPPIA"
FT   sig_peptide     complement(234098..234175)
FT                   /locus_tag="Swoo_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(234363..234785)
FT                   /locus_tag="Swoo_0193"
FT   CDS             complement(234363..234785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84494"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM81"
FT                   /protein_id="ACA84494.1"
FT                   /translation="MKTLITAVALTFASFTSLAASVSFPESIDVTGVNGKSQLNNHQIE
FT                   LTKGENLIELKYYDIFEANADDSGAWVKSQPLYLLISAETQDQYNALTPRIDTEEEAYD
FT                   FINNPVLTLKNTTGKEKEVTLLTHHQLMAKLLFAKQ"
FT   sig_peptide     complement(234726..234785)
FT                   /locus_tag="Swoo_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 20"
FT   gene            complement(234986..235471)
FT                   /locus_tag="Swoo_0194"
FT   CDS             complement(234986..235471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84495"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM82"
FT                   /protein_id="ACA84495.1"
FT                   /translation="MSKQLAHLVLIISLVGQFLLTPAMAMPSLLHAYSHAQMNDVEHDA
FT                   AGVSTMIETAVKSQLLPPQSPLLTGQSDTLDSRQNCDAIAGILVNDNSDVSIDCDALCE
FT                   MMGVGECVSHCANATGILIQANFALQVPESSASIQAGFWSTQTADPAPFNPPPIRTV"
FT   sig_peptide     complement(235394..235471)
FT                   /locus_tag="Swoo_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.859 at
FT                   residue 26"
FT   gene            235890..236453
FT                   /locus_tag="Swoo_0195"
FT   CDS             235890..236453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0195"
FT                   /product="NapC/NirT cytochrome c domain protein"
FT                   /note="PFAM: NapC/NirT cytochrome c domain protein; KEGG:
FT                   spl:Spea_3983 NapC/NirT cytochrome c domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84496"
FT                   /db_xref="GOA:B1KM83"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM83"
FT                   /protein_id="ACA84496.1"
FT                   /translation="MNLRALFKPSAKYSIFALLVVGIVVGVVGYFATQQTLHATSTDEF
FT                   CMSCHSNHSLKDEVLASAHGGGSAGVTVQCQDCHLPHNPVKYLVKKIIVSKDLYGYLTI
FT                   DGFNTQEWLDENRKEQADLALKYFKDTDSANCQHCHTRIYENQPETMKKMAKRMHERNF
FT                   QKEPDKRKTCVDCHKGVAHVYPKG"
FT   sig_peptide     235890..235988
FT                   /locus_tag="Swoo_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.659 at
FT                   residue 33"
FT   mobile_element  complement(236717..238073)
FT                   /mobile_element_type="insertion sequence:DUF1568 IS
FT                   element"
FT   gene            complement(236867..237847)
FT                   /locus_tag="Swoo_0196"
FT   CDS             complement(236867..237847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0196"
FT                   /product="protein of unknown function DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   sse:Ssed_1948 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84497"
FT                   /db_xref="GOA:B1KM84"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM84"
FT                   /protein_id="ACA84497.1"
FT                   /translation="MPRPRRSQISLEDTPMYHCCSRVTRRAFLFGDDELTGKNYDHRRD
FT                   WVESQLLKLAVVFAIDIAAYAVMSNHLHLVLRVDIYEANAWSDREVVEHWHNLFKGTDI
FT                   TQKFAKGEVIESFEVNSLKHSIAQYRSRLSDISWFMRCLNEPIARMANKEDKCTGRFWE
FT                   GRFKSQALLDDAAVLACMAYVDLNPIRAKMATTPENSNFTSIQRRIKAALNGEQPTSLL
FT                   PFVGNERNEMPKGLMFNAKDYLQLVDDTGRIIRQDKRGAISQTSQRILDRLNIPQENWL
FT                   KLSTDFGDLFKGAVGTLQELDAFCEHQEKKRRQGAANCHRWLDSA"
FT   gene            complement(238245..238793)
FT                   /locus_tag="Swoo_0197"
FT   CDS             complement(238245..238793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84498"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM85"
FT                   /protein_id="ACA84498.1"
FT                   /translation="MVVFLLLVISFNVYTEEIEGIPNFNRIRVISECNESQPFGIKLSL
FT                   VNSGEFDYFFPKVALPQNGAMLKSNFNIALYDQLDDYPLNFSEEKINFKTDEADQLNEF
FT                   SDLVIKKGEEYRERVNILKYYDLDPARKYLVSLESFFETYNEKTYRSYGITSSILVFEG
FT                   GLCRNITNEELNVMLRGKD"
FT   gene            complement(238795..248796)
FT                   /locus_tag="Swoo_0198"
FT   CDS             complement(238795..248796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0198"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: Fibronectin type
FT                   III domain protein; YD repeat-containing protein; FG-GAP
FT                   repeat protein; KEGG: shm:Shewmr7_1180 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84499"
FT                   /db_xref="GOA:B1KM86"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022045"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM86"
FT                   /protein_id="ACA84499.1"
FT                   /translation="MRPTSWMMKLFSTALFLFSFSVTAEWEPEPQPVPNIPYSVTVPSI
FT                   SLNGSYEISWLLTSSGSPSFLTYRLKESKNGGAWNIIYQGNLSHYTVANRQSGKYQYRV
FT                   DARIDTVWGGYKTSQNTYVIRTPSSITVPLSDTNGAYSVSWAAVSGATGYQLEQRVGSG
FT                   SWTSIYSGTARSRSVSGLGTNKYQYRVKAKYGSISGNYRTSAVTYVVRTPSSISVPSND
FT                   GDGAYSISWAAVSGATGYQLEQRVGSGSWTSIYSGTGRSKSLSGLGTNTYQYRVKAKYG
FT                   SVSGSYRTSAATYVVKTPSSISAPSNDGDGTYSISWAAVSGATGYQLEQRVGSGSWTSI
FT                   YSGTGRSKSVSGLGTNTYQYRVKAKYGSVSGSYRTSAATYVVKTPSSISAPSNDGDGTY
FT                   SISWAAVSGATGYQLEQRVGSGSWTSIYSGTGRSKSVSGLGTNTYQYRVKAKYGSVSGG
FT                   YRTSAATYVVKTPSSISVPSNDGDGAYSISWAAVSGATGYQLEQRVGSGSWTSIYSGTA
FT                   RSRSVSGLGTNTYQYRVKAKYGSVSGGYRTSAATYVVKTPSSISVPSNDGDGAYSISWA
FT                   AVSGATGYQLEQKTGSGSWTSIYSGTGRSKSVSGLGTNTYQYRVKAKYGSVSGGYRTSA
FT                   ATYVVKTPSSISVPSNDADGAYSISWAAVSGATSYQLEQKVGSGNWASIYSGTSVAKSV
FT                   SGQTNNTYQYRVKAKYGSVSGGYRTSSVVTVLLPPPVPASIATPTSTVANGSYTISWPA
FT                   SATATSYTLAERVNGGSWSHTTVSGLNKSYSGRGNASYQYAVRGCNASACGGWKYSGTF
FT                   NVLNKPAVPSSITTPSTNYTSSFTVSWPATSTATSYTLAQSVNGASWTHETVNGTSKSY
FT                   TNRTNATYRYAVRACNSSGCSNYRYSNTFTNTLPPSSISVPSSSTTGSFTISWAQVSTA
FT                   TSYRLQESVSNGAWSTIASPTATNYNRTGRPNGSYKYQVRACNASGCSAWRASSTLTVL
FT                   MPPPVPASLSVPTVTNTNGIIELSWSASSTATEYTLQEQKNGGAWESGTLAATSYTRAD
FT                   RTNGNYIYRVRACNTSGCSGWRTSSTVTVLLPPLTPSSVSVPSSTVTDGNIAISWSSVS
FT                   TATSYTLQQSANSGAWTNLASQGGTSFAQVVNADGSYQYRVNACNTSGCSDWKVSSAVT
FT                   VTLPPAWRQTKQTSVTDAGGSDTAPSESIDLTAAVLKGKAGVSGGQASYQIPIDLPPGR
FT                   NGIQPKVSLSYNSQGGNGIAGVGWSLNAGSAISRCGATYAQDGFTRAVTFSADTDRLCF
FT                   NGQRLITLSSNDSYGTSGTEYRTEMDSFVKVVQSGEINSASTSFTVHRPDGSQATYGSN
FT                   ANSRFTPSGLTTTLTWKVTQESWANGNNTIDYEYDTSVSGEHLLSKIYYTGSAGTDGDR
FT                   VVEFIYENRTDNRKSYMVGGQLIIQRRLKNISTYFGSTKVAKYEMNYGYSNASARTLLS
FT                   SVQQCGYKSGAEQCVSSTQFSWADSQYIETTPKIVSFSGQTSVYGEGELQLIQPLGDIN
FT                   GDGTLDWPNVLASAEMELISEHQKPVATCHYTYLSASNTCIAADIDADGKVDLHQVSAG
FT                   TLHFYLSKTNTWFDTSIAINSLTHGIGGDKYDQVQAVSDYNGDGYPDLLIYSFGDGKDR
FT                   SLYLYPHSQNIETPFSFNSRYLVSNDFNTFLENYKWQQRRNVEAVGDIDGNGLSDFMVS
FT                   DVYSSGHGYTPNEPKYLLLNKSTPSSFNFESKPLDSLPQRVFGSIFIDTNGDGLRDWIH
FT                   YSGDATTNQGWMIRVNKGGGSFTSATKFASTGTIPIGLIMQGNPQEPTDEFYYIAHQRA
FT                   FKIADIDNDGIEELLFPHDVLTNGCMSFNGNYQRCGLSIHSPTSELSTPLLTQMRNSAQ
FT                   DDQTLYRYKMLKFSHQDSNISAVKLNSPFMGTYGESALMDANGNGLLDMVFAYGPDSSG
FT                   VWLESPEAGPLGTEYGLYIQRGYGSGSGQTANDYDAIDYLQSVTDNLGNQSQWRFRPLS
FT                   TGENSAGELKVHNRVDDYVGNGYIHFGSSMYVVQSFEQSNGVGGTSETEYAYKGAMYNL
FT                   QGRGFTGFREIIEKDVARNRVTSSVFKQKFPEVSLLESQTVNIDGTTVATTEQTWADNP
FT                   QHTISGVYHNINTSTVTHSYGLSGSSEQRSSVEQTIDTADVTEHGNIKKRTKVVTDYID
FT                   GGANRYQTVVDTVFIPDTDNWFLGKFESRKTTTNVMARGWASDPYTSTDTEQWQTLTVD
FT                   SWDTTHYKPTQVTHTASGSSCSRLESTTLNSYGLPSQVSVTGDSSSCSALTARSTSFTY
FT                   TKNGTSQADDGYLPYKVTNAKGHVTTTEYDMGLGVPTKVTAPNSIITQTQYDAIGRPVQ
FT                   MSQTGSPTQYLRYLLASSGSHAPTHAKLMTRTTSAGMPTQELYLDSLGRTLRSATQGFD
FT                   GSNYQYLDKKYDSLGHLTHESLPFYDGDSADYTIFSDFDGFDRPKQRSLPNGESGGLIS
FT                   TYSYTGLKTDITVDSRTMSRTYGMQGLLYETVDAAGGSNRFAYDGAGRPLVIQDANSQQ
FT                   IKASYNGFGHKTQVIDPNQGTTTFGYNTLGELDSQTDANQVTQTFALDTLGRITAKTLT
FT                   GSNANGSASYTWDTLKQGMLSSETQNGITRSYSYTSNLQLATSSVKVATSAGGDNVTRT
FT                   VKHQYDSFYGRPKALTYPNNLTLEYRYNDTGYLNQTRNAASGYIYRTVTDMDAAGHLTG
FT                   SQMANALLTQSSSYNSEGTMASTQVTSSLGLLHQHYYEQYDSFMNLTAERNAVTGLEKR
FT                   YVYDNLNRLEQYSFSNAGFAIYDSATPFAATVDYGYDAVGNLLKKSDYSRNTANAYEYN
FT                   SSCTSDSNAGPNAVCAITKLNGTKVSFKYDKRGNLISGDNLTMTYNALDKPLTISGRGP
FT                   GNNTSTGFVYGSDNMRALQTRTVSGTTTKTHYVDKLFETDNDGSWRAYISDIAVLSYTP
FT                   QKSHQLLYTLRDRLGSATTMVDHQGNVISRRYFDPFGRTSTASTAGSLGDLLDTNRNRR
FT                   GFTDHEHLNEQKLIHMNGRVYDYNLGRFMSVDPLIQSPTSTQSVNPYSYIMNNPLAGTD
FT                   PTGYKAEVDEHKIKVSTIGSRIKQTVTATVSKSGGTTKVHLTGGNGAAQNAVKGAITGK
FT                   LASAGFKVSDIGGAKEVAQGGGDSVQNKSENESLGSTSKWNKPTDSQQLTIKDKAKSEI
FT                   TKNEEFIASLRTPDSSGYRRIAAAYGYNSKQDFSKTAEVLINRAIKVIEKLKNIIENPL
FT                   QVSVFQNYGEDYGQEVGGRIAVSTLYLSKKSDVTTMSHELMHTLGYGHGIKNFDTLSSY
FT                   AKWARNPVINRWHSDLSTLADRKSYRKILKDNVYVYENSLNGK"
FT   sig_peptide     complement(248722..248796)
FT                   /locus_tag="Swoo_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(249097..249369)
FT                   /locus_tag="Swoo_0199"
FT   CDS             complement(249097..249369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0199"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="PFAM: protein of unknown function DUF1145; KEGG:
FT                   sbm:Shew185_4166 protein of unknown function DUF1145"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84500"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM87"
FT                   /protein_id="ACA84500.1"
FT                   /translation="MTFIVTIGKGITLLAWVLMGYNLVMPFNGEISLILNTLLLLTLVM
FT                   HSIQILIFHRLFKTQLPLTRSDYLNVFAFGVFSLLAYRREVIEKS"
FT   gene            complement(249433..250014)
FT                   /locus_tag="Swoo_0200"
FT   CDS             complement(249433..250014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0200"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: conserved
FT                   hypothetical protein; KEGG: sse:Ssed_0218 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84501"
FT                   /db_xref="GOA:B1KM88"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM88"
FT                   /protein_id="ACA84501.1"
FT                   /translation="MAKNRPSSGQVRIIAGQWRSRRLPIQDLEGLRPTTDRVRETLFNW
FT                   LAGDLVGARILDCFGGSGALCLESLSRYASYAKVFELQASAAQQLKENLNTLKCSSDVA
FT                   EVIKGDTLALLTVAPTEAFDIVYIDPPFRKELAEKTITLLAQNSWLKENAQIYVETESE
FT                   LVHLNVPSDWVQLKEKKAGQVTYRLYQYQP"
FT   gene            250287..251762
FT                   /locus_tag="Swoo_0201"
FT   CDS             250287..251762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0201"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: sse:Ssed_0219 signal recognition
FT                   particle-docking protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84502"
FT                   /db_xref="GOA:B1KM89"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM89"
FT                   /protein_id="ACA84502.1"
FT                   /translation="MAKKGFFSWFRKDKSQDEVQTQEVESVTESQEKARIEAEAVEQAR
FT                   IEAEAVEQARTEAEAVEQARIEVEAAEQARIEAEAVEQARIEAEAAEQARIEAEAVEQA
FT                   RIEAEAAEQARIEAEAAEQARIEAEAAEQARIEAEAAEQARNDAEAAEQTRIEAEAVEQ
FT                   AEVVTEERQPEPQEKPAKEGFFARLKRGLKRTSENIGSGFIGLFKGKKIDDDLFEELEE
FT                   QLLIADVGVETTTRLISSLTEQASRKQLKDGEALYELLREEMQKTLEPASIPLVPENAD
FT                   GPFVILMVGVNGVGKTTTIGKLAKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIP
FT                   VVAQHTGADSASVLFDALQAARARNVDVLIADTAGRLQNKSHLMDELKKVVRVMKKQDE
FT                   NAPHEVMLTLDASTGQNAISQAELFKQAVGVTGITISKLDGTAKGGVIFAIADKFGIPI
FT                   RHIGVGEQIDDLRTFDAKDFIDALFTQEADEKK"
FT   gene            251804..252499
FT                   /locus_tag="Swoo_0202"
FT   CDS             251804..252499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0202"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: sse:Ssed_0220 cell division ATP-binding
FT                   protein FtsE; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84503"
FT                   /db_xref="GOA:B1KM90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM90"
FT                   /protein_id="ACA84503.1"
FT                   /translation="MIQFEQVSKVYPGGQKALSDVNFHLQRGEMAFLTGHSGAGKSTLL
FT                   KLITVIERANAGRVLINGHNIADLSAKDVPYLRRDIGMIFQNHHLLMEKSVFDNVALPL
FT                   VIEGFSHGEIKKRVHASLDMVGLYGKERHKPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDSGTTVLIATHDLGLIARMKYRTLTLKQGHVLGSDELS
FT                   ASTTYSPKI"
FT   gene            252526..253491
FT                   /locus_tag="Swoo_0203"
FT   CDS             252526..253491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0203"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sse:Ssed_0221 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84504"
FT                   /db_xref="GOA:B1KM91"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM91"
FT                   /protein_id="ACA84504.1"
FT                   /translation="MSNKPQLVRSKLPISGRIVMFFIRHIQHAMGSMGELWRNPVSSLM
FT                   TMAVLGVSLSLPAALQVLVKNAEAITQSWNSAAEISLFIDDARSDKTIQSLISRVKVYS
FT                   EVSEVNYINRDQALEEFQSLSGFGEAISYLDTNPLPAVVTVTPTLKYSSPTGARELLKK
FT                   LEQEPEVSFGRLDIEWLERLQAVVRLLERTVLAIAALLVLAVVLVIGNTIRLAIMNRRT
FT                   EIEVMKLVGATEAFIQRPFLYTGIWFGIIGGVLAWIIINLLVWYLDSALAELLGLYGSQ
FT                   LEMQTLTLVELGQLVCLASFLGWLGSYLSVRQHLRAIEPS"
FT   gene            253836..254687
FT                   /locus_tag="Swoo_0204"
FT   CDS             253836..254687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0204"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: sse:Ssed_0222 RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84505"
FT                   /db_xref="GOA:B1KM92"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM92"
FT                   /protein_id="ACA84505.1"
FT                   /translation="MTNQSMALTVPHGSGSLEAYVHSAHNISMLEPEQEYELAKRLQET
FT                   GDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPDVGVRLVS
FT                   FAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKSKKRLGWFSDEEVGMVADNLG
FT                   VSKADVTEMESRMAAQDPAFDLASDNDDDQDFSPVHYLEDHSSDLASQVENDNLESNNQ
FT                   ARLLSAIKTLDERSQHILQARWLNEDKTTLQELAATYQVSAERIRQLEKNAMNKLKGRM
FT                   EA"
FT   gene            254874..255104
FT                   /locus_tag="Swoo_0205"
FT   CDS             254874..255104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84506"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM93"
FT                   /protein_id="ACA84506.1"
FT                   /translation="MFPTFIGIPYIQVKAMVDDVPYIISTFPPSVEVKGVCAWNIYADS
FT                   PRMDSYQLCTCLQNIYPFVPKLETRNSKLET"
FT   gene            complement(255101..256615)
FT                   /locus_tag="Swoo_0206"
FT   CDS             complement(255101..256615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0206"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sse:Ssed_0223
FT                   O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84507"
FT                   /db_xref="GOA:B1KM94"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM94"
FT                   /protein_id="ACA84507.1"
FT                   /translation="MATDKFQLRALSPLHQAAVDYPERDALVWHQDGVKHQLSYSALSQ
FT                   KVVAIGEQLTAQGLLPGDRLACIDVNSVELILLYWACIDTGVIFCPLSPRFPIKQLSKL
FT                   IKQHRLNYIWSGAHYSPLFSSHQAKPQVPELLFSDNGLSTAKLTVDFNSSSRAKAVEVS
FT                   IESPANLILTSGSSGQPKAAVHSLSNHIVSATGSADQIPLEVGDAWLLSLPLFHIGGLA
FT                   IINRCALAGAAVVMQDKTLSLTAQLKQTPITHLSLVSTQLVHLLESQSTTKESSPLQGV
FT                   KSLLLGGGAISLDLIERLNTLNINSFTSYGMTEMSSQITTGTASADGSCGQTITGRELK
FT                   IVDEQIYVRGGTLFLGYLEWSDNQAKFNLPLEDGWFPTKDRGYWDKQGKLHILGRCDNM
FT                   FVCGGENVQPEEIEAALKLHPQIDDAIVFPQTDSEFGHLPTAVIKPSLLCTEGIEQLTA
FT                   SDEFEQFLCDKIARFKRPRLYYPWPEVESVGLKVSRKLVIEAVLKG"
FT   gene            complement(256624..257679)
FT                   /locus_tag="Swoo_0207"
FT   CDS             complement(256624..257679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0207"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: sse:Ssed_0224 O-succinylbenzoate-CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84508"
FT                   /db_xref="GOA:B1KM95"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM95"
FT                   /protein_id="ACA84508.1"
FT                   /translation="MKINTLELYQYQLPLDKCLPVGKQRIDSRKGVILSLELLDEAMTP
FT                   RIEQVEIAPLSGLDIEGNPIQDFSQETLEQIIDELAITLPQLIGKPVDLLLEQSKKTQY
FT                   PSLAFGLSLLHAKINGQLTGHHISLQNMKSVPLIYRAQNEALSVLHDRVRSLASEVHSI
FT                   KVKVAQTSLEEEIKLIHEILAIRPALKLKLDANRGFTLEQAIEFAACLPLHAIEYIEEP
FT                   CITPQDNPAFYQAIEMPWALDESLNDPDYQFEMQDGLTALVVKPMLIGSLEKLQRLQSE
FT                   AEHAGVRFILSSSLESSLGIEALAKLSQSMTPDEIPGLDTLGAFSADILISSGKPHLLG
FT                   LDSIKLINRYQ"
FT   gene            complement(257679..258458)
FT                   /locus_tag="Swoo_0208"
FT   CDS             complement(257679..258458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0208"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sse:Ssed_0225
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84509"
FT                   /db_xref="GOA:B1KM96"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM96"
FT                   /protein_id="ACA84509.1"
FT                   /translation="MLALSSYGDKSKPALVMLHGFLGAQTDWQAIVKQLTNQFYCVCID
FT                   LPGHGLSPTLALPTPGFDLITKHIQAAIDSLSIEKYHLLGYSLGGRIALHLARNNTQKL
FT                   LSLSLESCHPGLQTSEEKQLRAKNDLSWSKKLTELPIEAFLALWYQQGVFAELSIEARQ
FT                   KLIEKRRHNNPVGLLNIYLASSLAEQSNLWELPASLPFSCHYIVGSDDSKFLALATRWK
FT                   EQTSVKVSVVKQAGHNVHLAAPQEYSNWLIQTLIEDK"
FT   gene            complement(258458..260167)
FT                   /locus_tag="Swoo_0209"
FT   CDS             complement(258458..260167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0209"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   sse:Ssed_0226
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84510"
FT                   /db_xref="GOA:B1KM97"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /protein_id="ACA84510.1"
FT                   /translation="MQIEKTAELNLLWGTLILEELSRLGVQHICMAPGSRSTPLTLAAA
FT                   KQSKLKQHLHFDERGLGFMALGLAKASQAPVAVVTTSGTAVANLYPAVIEAWLTHVPLI
FT                   VLSGDRPPELIDCGANQAIIQPAIFAQYAKQINLSTPDLAIRPEALLTLLDEAISNQSQ
FT                   PLHINCMYREPLYPSTMSANFTQYLSTLGNWQHTNHAYNQYGKPNLSSLPSSDAMARFV
FT                   HGKGVIIAGTLTPDCDPQALVALSQKLGWPLLTDAQSQLRQHPGVIGNIDQLLHQPKAK
FT                   ALLMQAERVLVIGGRLLSKRLIDYLAQNKWKSYWQVLPRQMRLDPSHSAKQIWHASVTN
FT                   ITSLSWPRSSEANWALQLTQQNDEMERLFEQQIDNAEFGEAMVVRAIAKSQTKQQQLFI
FT                   GNSLPVRLYDMFAPITTEQGATFTNRGASGIDGLLASACGVAMHQGRATTLIIGDISQL
FT                   HDLNSLAIASHCSSPLVIVILNNDGGNIFNLLPVPDEKLRSDYYRLAHGFEFGYGAAMF
FT                   GIPYNRVEELESFEESYQDAIHYEGASVIEVIVPQQQASDQIARIASWIKQS"
FT   gene            complement(260273..261265)
FT                   /locus_tag="Swoo_0210"
FT   CDS             complement(260273..261265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: swi:Swit_0986 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84511"
FT                   /db_xref="GOA:B1KM98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM98"
FT                   /protein_id="ACA84511.1"
FT                   /translation="MSFLINDGYKKMTLDVASYERIDYWREQICHEFVQLDCEPLNKDR
FT                   FHGEIRGGLNFGLLSVSEVQGEAQIVTRTKQQIAHSSEAYFLMSFQLFQQGVVKQNGRE
FT                   AILQPGSFTLYDSSEPYSLTFEKEFHQLIIQMPKHVLSRYLIHPEKYTAVPLSGKEGIG
FT                   AVLSNFIFSVVKEYKELDTIHPELVENFLNMIAMAYSCSVMHNKLKKKALSKDALVERV
FT                   LSYIENNYANHQLSNQHIADAHGISLRYLYKLFQKQEHTIHQIIQKRRLMMSRQLLQED
FT                   SKFDFSLDSLSYAVGFTSSSHFSRAFKDYFGECPRDFRQKIFLESTRDS"
FT   gene            complement(261292..262290)
FT                   /locus_tag="Swoo_0211"
FT   CDS             complement(261292..262290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0211"
FT                   /product="Phenylacetaldoxime dehydratase"
FT                   /EC_number="4.99.1.7"
FT                   /note="KEGG: psb:Psyr_0006 putative phenylacetaldoxime
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84512"
FT                   /db_xref="GOA:B1KM99"
FT                   /db_xref="InterPro:IPR025702"
FT                   /db_xref="UniProtKB/TrEMBL:B1KM99"
FT                   /protein_id="ACA84512.1"
FT                   /translation="MMNNMPKNWTPPAPAWTSLWKTDEENLVCGLFAIQGQHSAPLDDW
FT                   AKKAFTGEFSPKLLEQGMFTDKAGITNYLYIAYWFASDYKTWWQQSAANSWWASPLLDE
FT                   GDISVWREVFTMPHQRFETLHSSENAHGAARLSPSLEGPMMEHGYSGAARDRIPCSSSQ
FT                   DIKNDNSIWEHLQVNVENKSNRIKLSPPKNMCVIRSGQDWTHCEEDEKEYYLTNVHTVL
FT                   KKGMDYLSNNPVKTHCASMRFITKTDGNWCSVEQTFGLGYGNDIYAFENWAKSHPTHIA
FT                   IFDRFMGMVEKYNVDLKLQLWHEVTLIPEQDCEFEYINCHGQTGLLCYINI"
FT   gene            complement(262298..263302)
FT                   /locus_tag="Swoo_0212"
FT   CDS             complement(262298..263302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0212"
FT                   /product="Nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: psb:Psyr_0007 aliphatic nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84513"
FT                   /db_xref="GOA:B1KMA0"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA0"
FT                   /protein_id="ACA84513.1"
FT                   /translation="MTNIYKVAVVQASPVFMDLDATVEKTIELIEKAAKENAKLIAFPE
FT                   CWIPGYPWWIWLNAPINNLKYIQTYHENCLVLDSESFNKIKESAKINNIFVSLGASEKD
FT                   HGSLYISQFLFSNQGELIQARRKLKPTHVERTLFGEGDGSDLDVFETELGRLGQLSCWE
FT                   HLQPLTKYTMFSKHEQVHIGCWPSFSCYQQAFSLGPELNNALSQVYAAEGQCFVLAPCG
FT                   IVSPEMINLMVENEEQGEMLKEGGGHAQVFAPDGSPMCIKLAENAEGLIFADIDLGLIN
FT                   IAKSFADPVGHYARPDVTRLWFNPSQQPVASQFCLEDEDLETEEAQLTKHSDE"
FT   gene            complement(263314..265644)
FT                   /locus_tag="Swoo_0213"
FT   CDS             complement(263314..265644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0213"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: swi:Swit_0989 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84514"
FT                   /db_xref="GOA:B1KMA1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA1"
FT                   /protein_id="ACA84514.1"
FT                   /translation="MNEKVKYNNYSNSIIVLSLLFNAPVFSEESDKKEKSQTLEVITVT
FT                   AQKRVESLQETPIAVTAFTADGLEKMQVGNIAEIENFTPNLVFDTSSPIGGSSTSAAVF
FT                   IRGIGNTDFSLTTDPGVGTYIDGVYVSRSIGGVLDLLDVERIEVLRGPQGTLFGRNSIG
FT                   GAINITTRKPYDELAGRLDLTLGSFNRTDVRGSIDIPFTDELLSTFAFSSKRRDGFVER
FT                   PLIGDELGNEDQLAFRGALYYEPNDEWNFQLSFDHSDIDEESAANVAVGFTPGAGTIGW
FT                   ALATYPTLSPDAAIVAGLKDLDKYITKDDKDVSYGTYNNGSSATVDGASFVANTHQDNF
FT                   DLKYTAAYRRTKAAFHADADNTPFQITEISNPDYYHKQISHELQFLGTAMDDQIKYIAG
FT                   VYYFDESGTDNVFVPLHLPTPDLSAGFPAGLNNYADVENSSLAEYLQATWDINDTFSVT
FT                   AGVRHTLDKKQFDYTQYLAADIQGNPLPFFPGAVDETGTFRPGLSPLVGNGSGSISDNF
FT                   EQTTFKLGVDAILDDGTLLYYSFSQGFKSGGFVLRYVESVAAPRTFEPETLDAHEIGIK
FT                   WQSDNERIRVNGAVFYSDYQDAQVTFFDKLGGPITANAGEIDIKGVELEITALITDDLI
FT                   LDIGYGYIDAAYNNINPVEGLSLTLDKSAKLVNTPENSLHIGLDYSLYFDESDIAFRVD
FT                   YAYTDDVFNDSQNSKFLFQEAHDMFNASIRYNLNESVGFVAFVNNLTDKRVIKSGNSNF
FT                   GLGFHSASYNKPREFGLAVKYTF"
FT   sig_peptide     complement(265561..265644)
FT                   /locus_tag="Swoo_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.978 at
FT                   residue 28"
FT   gene            complement(265854..267944)
FT                   /locus_tag="Swoo_0214"
FT   CDS             complement(265854..267944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0214"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   mlo:mll4199 enoyl-CoA hydratase/3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84515"
FT                   /db_xref="GOA:B1KMA2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA2"
FT                   /protein_id="ACA84515.1"
FT                   /translation="MNNPLCHVRYLCIETGIQLNVTDNNTLAVIEINSPPVNAISQQLR
FT                   AELLILFQSLASQDLHSVLLTCTGRTFVAGADIKEMDTEPLEPHLPELIATIVRFPKPV
FT                   IAALHGTVLGGGLELALACDYRLAVSKTKLGLPEVNLGIIPGAGGTLRLMNLIGVKAAI
FT                   EFACTGKPQNADEWLNTALIHKLVHKGDLTEQALSFCRQLTLTESKQNTEADFSIQGQY
FT                   IDWDSTEKRVKRLAKGVEAPALLLNEIKAIYSLGLSFEHALKRQRRLFLQLRDSDQAKA
FT                   LRYAFFTEKKNQKLATSTSSTRTINTVGVVGAGNMGVGIARCFIDAGMDLIWIEQTEEA
FT                   LLRGMDNLRKGYQSKITKGHMTEQDLDDKMQLVKGSTVYDRLAPCDLVVEAAFEDLEVK
FT                   KIIFKALDQHCKDSAILATNTSYLDINSIAKVTSRPDQVVGLHFFSPAHVMKLIEIVRA
FT                   ENTADDVIKTMLALGVKLRKYPVEVGVCFGFAANRMYTRYGREIQQMLLEGNSIVAIDE
FT                   AMTSFGMAMGPLTVQDLSGIDIGYQARAKQADKPYDLGYFRPSASMVENGRLGRKTQAG
FT                   FYQYLASGEKVESQEAQLLVDNEAKKLSIIPHRLTAEAIQQRAMLALVSEGLLIIDEGI
FT                   VNDISLLDIIWLHGYGFPRFKGGPMYWGAKLGCADIDEKLQLLRHQYSADIWPEVTLSN
FT                   LK"
FT   gene            complement(267937..268272)
FT                   /locus_tag="Swoo_0215"
FT   CDS             complement(267937..268272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0215"
FT                   /product="Ethyl tert-butyl ether degradation EthD"
FT                   /note="PFAM: Ethyl tert-butyl ether degradation EthD; KEGG:
FT                   pat:Patl_2708 ethyl tert-butyl ether degradation EthD"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84516"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA3"
FT                   /protein_id="ACA84516.1"
FT                   /translation="MIRIAISYPKTKNNNPTEQFDMDYYRERHMALVEINYLPHGLIRW
FT                   ELDIPQIGLGEPPVFAIGYLYFTNLQEMKNAFKQAGSIVLADIINFTNVTPIIVVSEIT
FT                   IMGGSHE"
FT   gene            complement(268302..269237)
FT                   /locus_tag="Swoo_0216"
FT   CDS             complement(268302..269237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0216"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein; PaaX domain protein
FT                   domain; KEGG: pen:PSEEN2789 transcriptional repressor for
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84517"
FT                   /db_xref="GOA:B1KMA4"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA4"
FT                   /protein_id="ACA84517.1"
FT                   /translation="MASEDNYLKFINQRVEKSSSGPSMLVTLFGDLVSQHGNWIWLGSL
FT                   ITGLKPFGYSERLIRTSVFRLVKSDWLITKKVGRRTYYALSETAKAHHDKAARRIYSSE
FT                   PSSLADAWTVVIPIFVPDNVKETFKKQLQWLGFSPLTNGAYAHLEVDKQSLEDTLLELG
FT                   LKDAVIVLSCKVDGSHSKNVFKRLVKEYWGLETLEASYKEFLDAYRPLIIKFNKGKMPS
FT                   DETCFLLRILLIHEYRRILLKDKQLPEDMLPNGWVGFEAHELVGKLYAQLAQASVNYAV
FT                   ENLENAQGHLPYVSAKFWQRFLLNKLSVEP"
FT   gene            complement(269324..270397)
FT                   /locus_tag="Swoo_0217"
FT   CDS             complement(269324..270397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0217"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   Ferric reductase NAD binding; KEGG: mmw:Mmwyl1_3091
FT                   phenylacetate-CoA oxygenase/reductase, PaaK subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84518"
FT                   /db_xref="GOA:B1KMA5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA5"
FT                   /protein_id="ACA84518.1"
FT                   /translation="MNNEFYQLNIASLDRSTSDSVAITFDVPQALQSTFRFKPGQYLTL
FT                   KHDIDGQEIRRCYSISAPVSSHKLEVGIKSIPDGLFSNFANNQLTVGQSLAVLPPTGNF
FT                   ICDLKQHTNICLLAAGSGITPMLSIAESVLENSTESHISLVYSNKQMQSMMFRERLSFL
FT                   KNRYISRFNFINLFSREDSEVELFNGRLTPEKISALIKAGIVQLDAFDSFFLCGPNEMV
FT                   DSIRQVLLEKNIDADAIKSELFFAGDISQALNLKRQEEYGERIRQVKLKIDGRKLSIDL
FT                   ISGGKTILDAALDQGADLPFSCKGGVCATCKARVIKGKVEMDLNHSLTDEEIKQGMVLT
FT                   CQSHPVSDDVEIDFDVT"
FT   gene            complement(270465..270992)
FT                   /locus_tag="Swoo_0218"
FT   CDS             complement(270465..270992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0218"
FT                   /product="phenylacetate-CoA oxygenase, PaaJ subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaJ subunit;
FT                   PFAM: protein of unknown function DUF59; KEGG:
FT                   reh:H16_B1360 phenylacetic acid degradation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84519"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA6"
FT                   /protein_id="ACA84519.1"
FT                   /translation="MTLSSATHSATINTVTVEYAARRKFRLNHEHGKIFDLLDAVYDPE
FT                   LTGVSLWDLGVLQNVSQQGAQWLVTISPTYSGCPAIDIMIEDIKVCLTNAGMEPVKVET
FT                   QLSPAWTTDWVSPAGKTAMISHGIAACESQVICPQCHSQHVSRLSQFGSTSCKALYRCL
FT                   DCLESFDYFKPL"
FT   gene            complement(271012..271758)
FT                   /locus_tag="Swoo_0219"
FT   CDS             complement(271012..271758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0219"
FT                   /product="phenylacetate-CoA oxygenase, PaaI subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaI subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   bbt:BBta_2867 phenylacetic acid degradation protein PaaC"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84520"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA7"
FT                   /protein_id="ACA84520.1"
FT                   /translation="MNANLLKYVTGLADDSMVLSQRLSQWCSHGPTLEEDIALTNVALD
FT                   YLGRARMFYQYAAELEGLGRSEDDFAMWRSEREYSNLLINELPNGDFAFTLVRQWLLDE
FT                   FYQLYLSSLLLSTDKTLTSIAAKAIKETGYHLIRSRQWLDVLANGTDESRQRINDALDE
FT                   IIGYIPELFTNTDAEKALPDIAVSRAELEPLWQQQIAQFCEQIGLVFPEVQWQVTGGRE
FT                   GVHSEHLGYLLTEMQCLARSHPTAKW"
FT   gene            complement(271772..272074)
FT                   /locus_tag="Swoo_0220"
FT   CDS             complement(271772..272074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0220"
FT                   /product="phenylacetate-CoA oxygenase, PaaH subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaH subunit;
FT                   PFAM: phenylacetic acid degradation B; KEGG: bpt:Bpet1925
FT                   phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84521"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA8"
FT                   /protein_id="ACA84521.1"
FT                   /translation="MSNSSSFYQTSELYEVFIRSARGLEHKHIGSLHAESAEQAITYAR
FT                   DVYIRRSEGLSIWVVKSSDVHSSQESDIAHFYDPMDDKPYRHAQFVQLPDAIKNM"
FT   gene            complement(272088..273041)
FT                   /locus_tag="Swoo_0221"
FT   CDS             complement(272088..273041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0221"
FT                   /product="phenylacetate-CoA oxygenase, PaaG subunit"
FT                   /note="TIGRFAM: phenylacetate-CoA oxygenase, PaaG subunit;
FT                   PFAM: phenylacetic acid catabolic family protein; KEGG:
FT                   bpt:Bpet1924 putative phenylacetic acid degradation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84522"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011881"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMA9"
FT                   /protein_id="ACA84522.1"
FT                   /translation="MNITENQASESLANFEHKIAEEQKIEPKDWMPEAYRANLIRQMSQ
FT                   HAHSEVIGMQPEGNWITRAPSLLRKMILLAKVQDEAGHGLYLYSATETLGVSREEMVSA
FT                   LHEKKAKYASIFNYPSLSWADIGAIGWLVDGAAIVNQISLQLTSYGPYARAMVKICKEE
FT                   SFHQRQGYNILIQLCEGTPEQKLMAQDSLNRWWWPSLMMFGPHDSESANSQKSMKWKIK
FT                   RQSNDDLRQKFIDQTVEQAEFLGLTIPDPDLRWNEERGHYDFGEIDWNEFKKVISGDGH
FT                   CNRDRIKHHQQAHKEGDWVRAAMTAYATKKSIKNVA"
FT   gene            complement(273155..274357)
FT                   /locus_tag="Swoo_0222"
FT   CDS             complement(273155..274357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0222"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: pla:Plav_2698 beta-ketoadipyl CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; beta-ketoadipyl CoA
FT                   thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84523"
FT                   /db_xref="GOA:B1KMB0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB0"
FT                   /protein_id="ACA84523.1"
FT                   /translation="MKDVFIYDAVRTPIGRYGGALSGVRADDLGALPIKALMGRNPKVD
FT                   WQNIEELFYGCANQAGEDNRNVARMSGLLAGLPITVPGVTLNRLCGSGMDAVGTAARAI
FT                   KSGEMSLAIAGGVESMSRAPLVINKAEKGFDRKMELFDTTMGWRFINVALKAEYGVDSM
FT                   PETAENVAEAFSVSRADQDKFAYRSQQKTAAAVDEGRFENEIVSVSVKRGKQHLEFDTD
FT                   EHFRRETSIDGLSELSAPFREGGSVTAGNASGINDGACALLLGDAEAQALYGLTPLAKV
FT                   TAMATSGVEPRLMGIGPVSASRKALALAGLKIEQMDVIELNEAFAAQALAVLRELGVDD
FT                   DDARVNPNGGAIALGHPLGMSGARLVTTAAYELQRRKGKYALCTMCIGVGQGIAIVLER
FT                   L"
FT   gene            complement(274354..274830)
FT                   /locus_tag="Swoo_0223"
FT   CDS             complement(274354..274830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0223"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dac:Daci_0569 phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84524"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB1"
FT                   /protein_id="ACA84524.1"
FT                   /translation="MQTDDCWCSGEIADQRARKIGIEMLENDQGSQRLGLKITKHNARQ
FT                   CQVEMSVTSNMTNGHDICHGGYIFSLADSALAFACNGVGVVAVTSAAQIDFMNAANLGD
FT                   VLSAEATVKFRQGRQLICDVKICNQESQLIALCRGRQVSLNNRAQTQNTIGNNI"
FT   gene            complement(274839..275627)
FT                   /locus_tag="Swoo_0224"
FT   CDS             complement(274839..275627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0224"
FT                   /product="phenylacetate degradation, enoyl-CoA hydratase
FT                   paaB"
FT                   /note="TIGRFAM: phenylacetate degradation, enoyl-CoA
FT                   hydratase paaB; PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   spe:Spro_3078 phenylacetate degradation probable enoyl-CoA
FT                   hydratase PaaB"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84525"
FT                   /db_xref="GOA:B1KMB2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR011968"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB2"
FT                   /protein_id="ACA84525.1"
FT                   /translation="MDKAILLEKINGYACIKLNRPECLNSFNQQMHKELADILDVLHHD
FT                   DSIRALILTGEGKGFCAGQDLSDRSVNQDDSPTDLGESVEHFYNPLIRRITAMPKPVIC
FT                   AVNGVAAGAGASIAMACDIVIAAKKSSFILSFSKVGLVPDSGASWHLPRAIGLPRAKAL
FT                   ALLGNRLDADIAERWGLIWQVVNGDVLMETAHAMATELASRPTQAFANIKRLLNESFNS
FT                   PMAQQMESERVAMQVLGFAHDYQEGVDAFLTKRTPIFIGK"
FT   gene            275714..276313
FT                   /locus_tag="Swoo_0225"
FT   CDS             275714..276313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0225"
FT                   /product="regulatory PhaM protein"
FT                   /note="KEGG: mmw:Mmwyl1_3102 regulatory PhaM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84526"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB3"
FT                   /protein_id="ACA84526.1"
FT                   /translation="MPIFAIEQHIPVIEPTSFIHPNATIIGDVIIGKHCYIGSNACLRG
FT                   DFGRIEIHDFCNVQDNCVLHSFPLQACVLEEYSHIGHGAILHGCTIRRHSLVGINAVVM
FT                   DFADIGAESIIGAASFVKSRFNCPARSMLLGSPAKIVRQVSDEEFQWKTRGTDEYIELT
FT                   RRCQTSLREVTPLTTVEENRPMFQPAQVHQPKNSSN"
FT   gene            complement(276340..278391)
FT                   /locus_tag="Swoo_0226"
FT   CDS             complement(276340..278391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0226"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: MaoC domain protein dehydratase; Aldehyde
FT                   Dehydrogenase; KEGG: dge:Dgeo_1913 phenylacetic acid
FT                   degradation protein PaaN"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84527"
FT                   /db_xref="GOA:B1KMB4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR011966"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB4"
FT                   /protein_id="ACA84527.1"
FT                   /translation="MKIKSYVCGGWVSGTGRCVTSKNAFTGETVATTSSMESGFDNALA
FT                   YGRLIAGNKLRQFTLHERAEMLKSLATHLMRKKEDFYQLSYLTGATRSDSWIDVEGGIS
FT                   TLFSYSGMVRRELVNEKFIVEGKVEPLSVNGSFIGQHILMPKMGVSVHINAFNFPVWGM
FT                   LEKIAPSLLAGMPVIVKPATATCYVAEAVVKEIVASKILPEGCVQLICGGVGDLLDHLT
FT                   EQDVVTFTGSAKTGKMLRSHDNILSKNIPFNMEADSLNACILAPDVQQDMPEFDAFIKE
FT                   VHREMITKAGQKCTAIRRVLVPSAMMDCVGDALSKRIQSTLVGDPTNDGVKMGALVNQA
FT                   QCADVQSAVDQLLFSCDVIHGGWDSMNTIGIDYDKGSFFPPTLLRCDTPLTSQQVHDIE
FT                   AFGPVSTLMPYDSIEQAIEIVGKGKGSLVSSVFSYDNDNIRTLVYGMACYNGRILVNNR
FT                   DCMKESTGHGSPLASMVHGGPGRAGGGEELGGIRAVKHYMQRTAIQGSPNTLQAVTNEY
FT                   VPGADTTTSLQHPFKKYFEELNIGESLTTHRRTVTEADIVNFGCLSGDHFYAHFDETAA
FT                   ADSLFGKRVAHGYFLISAAAGMFVEPAPGPVLANYGLDSLRFIQPVGIGDTIEVSLTVK
FT                   RKIYKKTKPDDAHPAGVVVWDVKVVNQDNEVVALYDILTLVAYKNAAQ"
FT   gene            278594..279895
FT                   /locus_tag="Swoo_0227"
FT   CDS             278594..279895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0227"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="TIGRFAM: phenylacetate-CoA ligase; KEGG: azo:azo0303
FT                   phenylacetate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84528"
FT                   /db_xref="GOA:B1KMB5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB5"
FT                   /protein_id="ACA84528.1"
FT                   /translation="MTNESTNNRVGVGLHSIESASIDELRALQFERLKKTLNHAYTNSP
FT                   AYKRKFDEAGVHPDDFNHLDDLRKFPFTTKQDLRDNYPFGFFAMPMDDIVRIHASSGTT
FT                   GQPTVVGYTQEDIHTWADIVARSVYAAGGRKKDKVHISYGYGLFTGGLGAHYGAERLGC
FT                   TVIPMSGGQTAKQVQLIRDFNPDIIMVTPSYMLNIADEIERQGIDPKSLALRCGIFGAE
FT                   PWTDAMRSNIEQRLGIDAVDIYGLSEVMGPGVAQECIESKDGPTIWEDHFYPEIINPET
FT                   GEIVEDGEPGELVFTSLTKQAMPIIRYRTRDLTSLLASTSRSMRRMDKITGRSDDMLII
FT                   RGVNVFPSQIEEQLLSIEGLSPHYLVEVAKMGHMDYLTVKVERSLDQQCNKEQAKLLES
FT                   KIKSVIGISSKVVLLEPQTIARSEGKACRVTDLR"
FT   gene            279921..280637
FT                   /locus_tag="Swoo_0228"
FT   CDS             279921..280637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0228"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: bja:bll6414
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84529"
FT                   /db_xref="GOA:B1KMB6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB6"
FT                   /protein_id="ACA84529.1"
FT                   /translation="MYLSQKELCTMMDLVSFTLQHNTTLGSRQLLLDKLMEMFRADYGA
FT                   SCCWNPNEKYYQEGVFSNMSLDNISKYNDYYQFHDPITNKLRQFRRAVAVSEVISRDQL
FT                   IQTEFYNDFLQRDGLSFGVNLHIYCGQEHVFDVRLWRSQQQGDFDVKHLNQLDLLLPYL
FT                   RAMGEREPLKESLSFNLFTQRELEVISQIKSGMNDKNMARTMNVSVTTLRSHIRSIYKK
FT                   ADVHSRTELISKLAPN"
FT   gene            280890..282257
FT                   /locus_tag="Swoo_0229"
FT   CDS             280890..282257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0229"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: bpa:BPP3587 indole acetimide
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84530"
FT                   /db_xref="GOA:B1KMB7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB7"
FT                   /protein_id="ACA84530.1"
FT                   /translation="MTIKDETKKQILQLHQKVDFQYGRSTGFSDYHAYLYQNKQASHKQ
FT                   VDNLSEGDINNQVLYGMTIAVKDNIEVAGMPNTLGNKALAGHIPQHDACIITRLKEAGA
FT                   VINGKANMHELALGVTNINPSYGHALNAYNPEYFAGGSSGGTAVAVALGLADAGIGTDT
FT                   GGSSRIPAALNGIVGFRPTTGRYPNDGLGLISKTRDTAGPMAKDVDTLARLDAVLAGEP
FT                   SIDSLPSFPPKKLRLGIPRAYFYGNTEPAVLAAVEDVLQALAKAGVTLIEVDPQGIEAL
FT                   NQSISFPVVLYEAKQHIQDYVEKALPGTAIEDFAAQICSGDVKNLVDSIFNQPIPEPMY
FT                   QEAINSFRPKLQSLYQDYFDKHRLDAVIFPATPLTAQKITNDNDLVILNGSEEPTFSTY
FT                   IRNADPASNAGIPGLVIPIGFNPEGLPISLEIDGPAGSDRQVITIGKLIETIIKNL"
FT   gene            282283..284472
FT                   /locus_tag="Swoo_0230"
FT   CDS             282283..284472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0230"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pat:Patl_3904 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84531"
FT                   /db_xref="GOA:B1KMB8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB8"
FT                   /protein_id="ACA84531.1"
FT                   /translation="MKTSKISQLILLSYLLPSAVWAADIEENEKIDASKLEVITVTAQR
FT                   RGENIQKVPVAVTAMNAEMLEKQDVHDLNTIATRVPGLSFSPFAPGQNIISLRGASSND
FT                   DGAGTDNSVAVFVDDVYLGRVSNVNPEMFDIERVEVLRGPQGTLYGKNTIGGAINIISK
FT                   LPSLDELDAKLRLNIGNYGRRDVAGYINGPLGDNIAAKLSFSSRKNDGWVDNVTLNSKQ
FT                   KDNDVFAGRAQLLYEGDNFQALFSGDYSKLDVTDMARTPVDTGAKGDPAVWSPAYVAAC
FT                   KEGAPFCAAGAVDGYAKQKAYGVSAKLTWDLDLGELISISAYRDSESDWNMDATGSPAL
FT                   ALIDDIIDNSDQFSQEFRWVGQTDSFNYVAGAWYMNENTDRSECFDLSLDTDCSTGMDG
FT                   SDFYHQVNETNSYALFGQFDWKFTTDWILTVGGRYSYETKEIDNVAKAGDFVIINENFG
FT                   IDSPVTLKESWGAFTPKVALKYTVSDDTTAYLSFAKGFKSGGFAAAPQSLAETKPLEPE
FT                   EATNFEFGIKSDISDTFRLNTTIFHTDYKNLQIQSFGPRSSGEDFGVFNTFNAGDAKID
FT                   GIELEFTWLPTDNLKLYGFYGYMDSEFVDTVVPNSAYPNQSGQEMLRTPKNKYSINLEH
FT                   NIDLDSGDYFTTNLNYRFTDEQRGELEPYAIQPAFKLLDASFTWHSANDNWEVSIWGKN
FT                   LTEEVYITHVYTVASSVVAVYGEPRMYGVSVSWSM"
FT   sig_peptide     282283..282351
FT                   /locus_tag="Swoo_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            285123..286073
FT                   /locus_tag="Swoo_0231"
FT   CDS             285123..286073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0231"
FT                   /product="cytochrome C family protein"
FT                   /note="TIGRFAM: cytochrome C family protein; PFAM:
FT                   multihaem cytochrome; KEGG: sse:Ssed_0227 cytochrome c
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84532"
FT                   /db_xref="GOA:B1KMB9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMB9"
FT                   /protein_id="ACA84532.1"
FT                   /translation="MICRLVKRVLVGIAALAWVSVSVNAARWDHLTGEQLEQKLTEKFT
FT                   QGQYSPKGADSCLMCHRKNEVVMAIFDGAHGSMNNKQSPMAGLQCEACHGPQGKHNKGG
FT                   KEPMIAFGEESKLSASAQNSVCQGCHNDPKQMAWHTSTHNLEEIACADCHNVHSAKDPA
FT                   LDKLTINDTCTSCHSKEKADMNKRSSHPLKWDQMTCIDCHSPHGSMNESALNKPTINDT
FT                   CYSCHAEKRGPVLWEHAPVTENCVTCHNPHGSVNDDLLNSRAPQLCQQCHAPDGHASRV
FT                   VPEPGMDAFGGGKSCLNCHNKIHGSNHPSGSLFQR"
FT   sig_peptide     285123..285200
FT                   /locus_tag="Swoo_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            286088..288094
FT                   /locus_tag="Swoo_0232"
FT   CDS             286088..288094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0232"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sse:Ssed_0228 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84533"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC0"
FT                   /protein_id="ACA84533.1"
FT                   /translation="MMFKLNIITVSLLAMSGSVMAANFGVGQANTESVNMEKYQCKRCV
FT                   SETGYSGKVTLLTGYNSPDDLHAGNALGTAEDGAIAAISGDLRYLNSTGYKASMQAHQL
FT                   GLDNGFANLKVGKSGLYELELDYQAIKTYESGDARSQLWQNDGMLTPSVYPNQFDLALQ
FT                   REKSAIGLSYDEGRYNTFVRYSQEEKTGTQSASLVAPLPTNFGLPVDSTTKQLDAGASL
FT                   AGDNWLTELSYFGSYYSNNIQDLSLPYLSDVYSAAPDNQAHQVSLSGQYQLDRTVMSGR
FT                   LVTGRMTQDDSLIQMSGNPLQSWDGEIETLDGRFAVTSMLSNRLRVGASVDHSKRDNKS
FT                   SSWEFTQYSYNALSGAFKQNVPQDIERNTYKVNASYRLASGYRVQAGFDRKEVDRSYSE
FT                   REQTDENNLWAKLNVTAFDKLNINVKASHGVRGGSEYQVNELTSSEDNILMRKYYLADR
FT                   TRNALELKFNHSPLSWVSIDLTGRYALDDYDATIIGLTESKDYGYDLNISLQLSKNLIA
FT                   YGFAGQQWIDSIQAGSQSFSSPDWQADIQDEFINLGTGFSYSGLMEDKLTLGGDYLFSN
FT                   SISDTYLEGSALVGSDLQYGDYFSYNHSVRMYADYALSPKMALKLSYQYERYYDTDGAQ
FT                   VGINTVPGLTTLGELNHDYNAHQVMLSFSYLLR"
FT   sig_peptide     286088..286153
FT                   /locus_tag="Swoo_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            288118..290634
FT                   /locus_tag="Swoo_0233"
FT   CDS             288118..290634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0233"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="TIGRFAM: anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase Fe4S4 region; KEGG:
FT                   sse:Ssed_0229 anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84534"
FT                   /db_xref="GOA:B1KMC1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC1"
FT                   /protein_id="ACA84534.1"
FT                   /translation="MERRSFLKMSAALGCAASVTGCKTSSDDANVVPPKPPVGEEQITW
FT                   SSCLVNCGSNCPVKVFSRDGVITRVETDHDVVDGDDIYQVRACARGRSLRQRTYAVDRL
FT                   KTPMKRVGKRGEGKFVPISWDEAAKTIGTKLSSVINEHGNKAIFRSYGSGAYYGFASNA
FT                   CFNRLFNLNGGCLNAYGNYSWAQQMEAAKHTFGTGSTTGSSTVTLSNSDFLLGVAYNPS
FT                   EIRQSGSGEGYDYLKALQKSNGLKVVMIDPRYTDSMLGKESKWLPIRPGTDAAFAEAIA
FT                   YQMISSGWVDANSLDFINKYAVGFDADSIAAQQALFAASGDATKQEYAKVMKPEENYRD
FT                   YILSQGIYSDQPLKTPEWAEKITGIPAAQLEQIATDLQNAKAPYIVVGAGVNRQANGEQ
FT                   SMRALYMLSVLTGKLGTLGSSNGELPYMSSMSRAGIPTGSNPVKESISFFTWSEAIHHG
FT                   ETMTARSHGVRGTDGLDTPLGTNIKVIISASDSSLLNQHAEINNTARILEDETGVELIV
FT                   SCDCWMTPGAKFADIILPDTSWLESNDLVNDSYASGALGYITAMKSAIEPMWDCKSMYE
FT                   AAALIAKYMGCEAEFTEGKTEEQWLEELYQKTKDNSNNLGVYPAFPATYKEAQEIGFFR
FT                   KNMNDKHVALESYIKGGKPLSTPSGKIEIYSAELAWRAANWDQESKTQVKGDTITAIPQ
FT                   YTVTWDGYEDTDTSTDFPFQLAGYHTKGRTHSSYHNVPWLREAVEDAVWVNPMDASEQG
FT                   LNSGDEIEMYNERGSIAVKVRITPRVAPGVLALGQGAWFKPGNTLGSTGHIIDEGGAIN
FT                   SLTRYQPSPVAKGNPQHTNRVAIKKI"
FT   sig_peptide     288118..288198
FT                   /locus_tag="Swoo_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.807 at
FT                   residue 27"
FT   gene            290649..291326
FT                   /locus_tag="Swoo_0234"
FT   CDS             290649..291326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0234"
FT                   /product="dimethylsulfoxide reductase, chain B"
FT                   /note="TIGRFAM: dimethylsulfoxide reductase, chain B; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sse:Ssed_0230 anaerobic dimethyl sulfoxide reductase, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84535"
FT                   /db_xref="GOA:B1KMC2"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC2"
FT                   /protein_id="ACA84535.1"
FT                   /translation="MTQPTQYGFYVDSTKCTGCKACHVSCKDRQSNEIRNNSNPEGNAL
FT                   PALEGVTWRRVYEYGGGEWTVGNNGCFEQNVFAYYMSIGCNHCSEPVCVKACPTGAMHK
FT                   RRQDGLVHVAQDLCIGCESCARACPYDAPQIDSERKVMTKCDGCFERIAEGRKPVCVES
FT                   CPLRALDFDTMDNLRAKYGDGDGHIAPLPSPSITSPNLIIKANVNGRPAGSGEGQILNF
FT                   SEV"
FT   gene            291382..292041
FT                   /locus_tag="Swoo_0235"
FT   CDS             291382..292041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0235"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: sse:Ssed_0231 cytoplasmic chaperone TorD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84536"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC3"
FT                   /protein_id="ACA84536.1"
FT                   /translation="MSLDNKFDFEAGQGLARILHHVLLSYPTVETLDNLKTHSVAQSWP
FT                   EFGLSADNTAGRAALTTYLSQWSAEQLNELKLDYGQLFFGPGEPNAMPWGSVYLGEQQL
FT                   LNDRSTLDLMAFYKQQGISFELEFTQPLDHIALFFAVIDSLLGQLVLNPDDEPVRRTLA
FT                   VLMQQHMLPWSHRCFELAIEHAQTDFYRGIAHLALDFQQVLAVVFQVIPMPVRLHR"
FT   gene            292049..292531
FT                   /locus_tag="Swoo_0236"
FT   CDS             292049..292531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84537"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC4"
FT                   /protein_id="ACA84537.1"
FT                   /translation="MSVIQAIGQQNIKAEFAHRLQGFLSQDPDVRELFSGATSMTTVVN
FT                   LLAALSFQEGDARFQTDALDEELVFSLFFDSFYLLFIKELEHNNLSQAEKLILQLSRYY
FT                   GELMAKRIVQAETGLGAEELSIRAELLKRANCVLQAWEQLDKRYAQQRGNSRNMGR"
FT   gene            292723..293694
FT                   /locus_tag="Swoo_0237"
FT   CDS             292723..293694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0237"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: spl:Spea_3970 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84538"
FT                   /db_xref="GOA:B1KMC5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC5"
FT                   /protein_id="ACA84538.1"
FT                   /translation="MHRLLSRLDYFTLKVFIGLVEYNNGSVVAQKLNTTQPKVSRALSC
FT                   VREVFCDELFVRRQYGVKPNAIAENLYPFAKAIVSAYDEMAELTMALPLRTHLIIAAQE
FT                   HLSAFLVESIMELCEQLGSEISVTIQPWSDNVQELLAQGKIDFAIAVNSESFENVESVK
FT                   VGEAHYHFVAAKKGHPLFSEQLNLANLFKNKLVLINYSQVGLTKHWCEDYADERGLELK
FT                   VSFKTSSLAMALAHVAKSNDVCWTASVFACLYFKSRNDIDYIDVTDFYENELFPEGKFK
FT                   RYDYYLQYHKSLNNDFSKQLSDLLSRKMQLALDAYAKDGGRS"
FT   gene            complement(293706..294671)
FT                   /locus_tag="Swoo_0238"
FT   CDS             complement(293706..294671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0238"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: spl:Spea_3969 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84539"
FT                   /db_xref="GOA:B1KMC6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC6"
FT                   /protein_id="ACA84539.1"
FT                   /translation="MKDIRLSDLDLLSINIFVNLYENRSATLVAHKLNIPAPKISRCLK
FT                   HTREILGNELFVRKKYGLIPNEFASEVYPIAKELMECATKLQKLYCTSDNGLIRHFEIA
FT                   APDLISYPFPKILLSAIKDAGKSVSFNISRWNKHSIDNIISGEVDLGLCCSKELDNLRR
FT                   SDESLIALRLKKLNKLFLICHNQHPLLKEEITLESIASYPFINSNMGYSELELSPLQEY
FT                   CQSQNIHLETEINLTGLTGLFEYLRSSQSVTLLPYSTIFNVINNIPDLHACRLSEVESE
FT                   RLYRQVRTPSLYLVYRNNDKTPEHQWLSSEIQDLIELTLH"
FT   gene            295163..295654
FT                   /locus_tag="Swoo_0239"
FT   CDS             295163..295654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3968 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84540"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC7"
FT                   /protein_id="ACA84540.1"
FT                   /translation="MNASIILNYAFVYFVLFLVVPFVLVTFTLTCIKFFKSSEQSITNV
FT                   KLRTYTLEGEPVGFVNKLNNLVNGKYNVLYGTTLDSIFDVDKGDSEEHAHHYLQSCHLD
FT                   YVLVDNESSAIKLVITDPQHNSEENSRYIDNALAKMGVKVLHLAKNDCDETLLRASLAA
FT                   "
FT   gene            295737..296210
FT                   /locus_tag="Swoo_0240"
FT   CDS             295737..296210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0240"
FT                   /product="formate-dependent nitrite reductase"
FT                   /note="KEGG: spl:Spea_3967 formate-dependent nitrite
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84541"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC8"
FT                   /protein_id="ACA84541.1"
FT                   /translation="MSSLFKYSVFLLLSVFSLVLMLSVSTNLIAAELNINKSKECIKCH
FT                   KRNGMMRGVHGNDALDIRCQDCHGEKQGHPRQASNLIGFSDSSAVKPRTQVQACLQCHD
FT                   HFRLFEHDWSHAVHSDKVNCASCHQLHSTTDSMVDLLATKRSQLCSRCHSVEK"
FT   sig_peptide     295737..295829
FT                   /locus_tag="Swoo_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 31"
FT   gene            296221..296904
FT                   /locus_tag="Swoo_0241"
FT   CDS             296221..296904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0241"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: spl:Spea_3966 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84542"
FT                   /db_xref="GOA:B1KMC9"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMC9"
FT                   /protein_id="ACA84542.1"
FT                   /translation="MSNSRRLFLKGACVAAVGASGFTLVRAKEAGKNTSKPVYKYALVH
FT                   DETKCIGCDACSIACREVNQVPEGVSRLEIKREGPFGEYPNQYFRFTRHSCQQCESTPC
FT                   VDVCPTGAAYKDPDTGIVSVDEWKCVGCQYCIAACPYQIRFINPITKAADKCDFCKDTR
FT                   LKEGKKPACVSACPTKALTFGDITDPDSQIVKVLKSAPSYRSKLDLGTRPKVFRIASQG
FT                   GEVKL"
FT   sig_peptide     296221..296304
FT                   /locus_tag="Swoo_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            296901..297842
FT                   /locus_tag="Swoo_0242"
FT   CDS             296901..297842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0242"
FT                   /product="cytochrome c nitrite reductase, NrfD subunit"
FT                   /note="TIGRFAM: cytochrome c nitrite reductase, NrfD
FT                   subunit; PFAM: Polysulphide reductase NrfD; KEGG:
FT                   spl:Spea_3965 polysulphide reductase NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84543"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMD0"
FT                   /protein_id="ACA84543.1"
FT                   /translation="MNPFHFDGLIWHWPIAIYLFLAGVSAGAICFAVLLKQFKLGEDAY
FT                   KSGFVQAACLISPLAVFAGLGILVIDLTKPFDFWKILVFYNPRSVMSVGVAVLLIYQVA
FT                   LFAWLACVFKEPVLTWCQGRWSVVDKGFKALMKYEATITGLLVLLALSLGAYTGFLLSA
FT                   LRTYPMLNNPVLPLLFLISGISSGAAATLLGGVLLKGNPDGKEVHFIHNIEIPIILLEL
FT                   VLLFTFFAGLILSGGQSQVAALTAIGEGFWGWVFWGGVVVMGLSMPLALNLFMKASSKR
FT                   KFSYVAMTASFSLVGVLLLRNFILYTGQMTIA"
FT   gene            complement(297954..298391)
FT                   /locus_tag="Swoo_0243"
FT   CDS             complement(297954..298391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0243"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   slo:Shew_3598 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84544"
FT                   /db_xref="GOA:B1KMD1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:B1KMD1"
FT                   /protein_id="ACA84544.1"
FT                   /translation="MDKFDKAIISELRKNARHSISHIAEAVNLSRSAVSERIKKLEQRE
FT                   IIRGYQVLLSESQKEGVSAYFEIQHQCPRCADVVHVFHAIPEVITCRGITGDMDLLVYV
FT                   QANSMRRLHEIREFIDAQTDIIKIKTHVVMSEWIDNQGESI"
FT   gene            298574..299839
FT                   /locus_tag="Swoo_0244"
FT   CDS             298574..299839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0244"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   slo:Shew_3597 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84545"
FT                   /db_xref="GOA:B1KN48"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN48"
FT                   /protein_id="ACA84545.1"
FT                   /translation="MNQIKGKIGRWQGAGLMATTLLGTGVFILPQMTIETAGSGALIAW
FT                   LVLTLAIIPVTLVFGRLASVFPHAAGPAYFVEQAFGRTSGRTIGLLFLLVIPLGAPAAI
FT                   MMTFKFVDVLVTLSGWAEVMTELLLLGVLAVLNFRGVQVSAKLQFALTLGVVSVVVALF
FT                   GAGGLNLSEMESLTSAVKPEVALIMAAAGIAFWSFLGVEAMTHLANDFRDPKRDMIPAM
FT                   MIGTLLVGLVYLACTLLLLLFPGTSNLAMVAVFDSLLGGYGAQVIGILGIASGLATVNV
FT                   YTASAARLVWSFSREGVLPKYFELLNHYGAPVRASSVLLAVMAVVIVLTYITGQDLEGL
FT                   IAWTNGVFVIIYLVSMLAAIKLLSRRFLPLVSLSCLLCLLLAFALGMNMAYALILTAIL
FT                   YPLLWWQKVHLLRRERAQVILN"
FT   gene            complement(299899..300510)
FT                   /locus_tag="Swoo_0245"
FT   CDS             complement(299899..300510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0245"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: shn:Shewana3_3957 TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84546"
FT                   /db_xref="GOA:B1KN49"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN49"
FT                   /protein_id="ACA84546.1"
FT                   /translation="MISISLLRRTSIALVAAVITLSLFAFMAKLIDAEHPQQIETVQVP
FT                   EFEIAPIIKDKEPIKKQIELKPKEELVEPTIPQRTVSGTDTGITAQTIETIKMPTLSTE
FT                   YNRDSMTSEALPIVQVSPRYPIIAAQNGKEGYVILGFDITKMGTVTNVKVLEANPKRIF
FT                   NKAAIQAIKNWKYKPKMEKGVAVIQSNQQVQLDFTLEQQI"
FT   sig_peptide     complement(300433..300510)
FT                   /locus_tag="Swoo_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.768 at
FT                   residue 26"
FT   gene            complement(300872..301321)
FT                   /locus_tag="Swoo_0246"
FT   CDS             complement(300872..301321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0246"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   sse:Ssed_0247 protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84547"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN50"
FT                   /protein_id="ACA84547.1"
FT                   /translation="MIAKLKQFLTSHSQAVTPEEQTRQLNLAAVSLLLEVVFADETLSN
FT                   EEAKLLPSMLTDALSLTQSEAEELIEEATKIQGNSTSLYEFTSEINDQCSVEQKQKLIL
FT                   AMWKLAYADGQLCRYEDQIIRRTAELLYLKHSELIQMRNIAMEAR"
FT   gene            complement(301460..301978)
FT                   /locus_tag="Swoo_0247"
FT   CDS             complement(301460..301978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84548"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN51"
FT                   /protein_id="ACA84548.1"
FT                   /translation="MKLSAIFGLLISSTLLTAPATAGWFDDLFGKEEAKPAVTQTQDTD
FT                   LVSNVMSQLDLNQSQAEGGLGSLLSLAQSTLGGDDFGPIANAIPGIEGLLSAAPEVDKD
FT                   SGMSGLLSKAGDLGASLQGGAEVYDAFEKLGISKELAAPMVNIVKGYLDTNAGEGTSDL
FT                   LMKGLSAIL"
FT   sig_peptide     complement(301910..301978)
FT                   /locus_tag="Swoo_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            302187..302900
FT                   /locus_tag="Swoo_0248"
FT   CDS             302187..302900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84549"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN52"
FT                   /protein_id="ACA84549.1"
FT                   /translation="MPLSAIFTEAYNFFRNHISQLAALTVPILFVQVGIQLWLGMEMAN
FT                   ADMENPQFGGIHMAAVMALLLVFSLLIASLTIFLEIRSQGHEANTALILKTSLSFVPGL
FT                   LLAGVFSGLAILAPVMLFAAFGPLWLVGLTMSIYIFARLAYVNFMVVVERLTPLEAIKG
FT                   SFKFSGPIAFKTLMVLMLYIPISLIGGSLSSLAQSVGFPLQLVVEVFVAFIGLFVNVAL
FT                   FRLYMVSRPNVEEQV"
FT   gene            302961..304376
FT                   /locus_tag="Swoo_0249"
FT   CDS             302961..304376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0249"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: sse:Ssed_0250 Sel1 domain protein repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84550"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN53"
FT                   /protein_id="ACA84550.1"
FT                   /translation="MLTDVEFVAHFSPELGQDYRVAKSYVTDVPTQALLQIRSLTHKLT
FT                   ELLALPMGITFDSPNLYDRIETLNSRRVINVRVTRAMHKLRGDGNRGAHPEKYHLTSEQ
FT                   LQQLSEKSIERLLSLIESLFVQVTGKSLPKYHFEAFDSLAGRDLCYRAVMESDPQAQYL
FT                   VGMSLKTRALMQREQELALGDEHDGKGSELGSSSETLKKAEYWFGLASTSEMDARYEYG
FT                   VAKIHGYSGEPDVIAGEEAIAQAAAAGVVNAMALLGYFYLVGGKSLAVDRDKALDYLQR
FT                   AADLEQSEAMANLGVLYYQEGALTQAYQFIAKAAQAGFPHAQYHLALMLARGEGCEVDP
FT                   LGSEQWMAEAAELGQIDAMFSRAQSMLNDDNAFGTDLSQAELYLREVIKYGHSVPAMIE
FT                   LSIALADGVLGRIDVVGSASLLKLAREHGNEHELSVISPLWDSLSQQVENVIAVTKNKA
FT                   ELVALKRAQELLA"
FT   gene            304457..305716
FT                   /locus_tag="Swoo_0250"
FT   CDS             304457..305716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84551"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN54"
FT                   /protein_id="ACA84551.1"
FT                   /translation="MVVMAEKEGIVNRTPDNQQLDDIAKDYVKLVLAVGLHDASYVDAY
FT                   YGPESWREKCQLQPLRSLKRDVAALLGRLGALKLTGGDRRLLERQEFLGKQLASVEYYI
FT                   NHLLGSESCFATESTGLYDTQAEIFSPESFQPALDDIDCLLPGSGELTGRFDAYRAQFI
FT                   VPEHQIPKVFSAAVEKSRELTSTYIDLPENESFRIEFVNDKVWSAYNWYQGDYQSLIQL
FT                   NQDQPLYLERCMQLASHEGYPGHHLFNLLQERELVREAQWFEYAIYPLYSPISFLSEGS
FT                   ANYGLSLIMSDCELIEFEHEHLMPLAGMTGDIEHYHKVLRCYKQLAHLDNSVCQQLIDG
FT                   KVSPNEAESLLVRFGLYSESRAKQRVKFYQANRAYVINYNHGEDSVARWVERGEADKNE
FT                   RWKRFESLLKRPLMASQFVS"
FT   gene            complement(306056..306418)
FT                   /locus_tag="Swoo_0251"
FT   CDS             complement(306056..306418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84552"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN55"
FT                   /protein_id="ACA84552.1"
FT                   /translation="MIYSQFQQSPFQTRFSGARGWMAFAIGLAVITLTLIALPFVLLIG
FT                   AISFILLSLFGRIFMKRQLARFRQQQAQAGQAKQESGFYQSDSAQDQGPFQEARFGTER
FT                   HQAKPHQGRTFEHDPS"
FT   gene            306764..308635
FT                   /locus_tag="Swoo_0252"
FT   CDS             306764..308635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0252"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   aha:AHA_3367 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84553"
FT                   /db_xref="GOA:B1KN56"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN56"
FT                   /protein_id="ACA84553.1"
FT                   /translation="MKSHSLKKKILFSVVIALSLVIVLLSWQSYLSQKEQLQQSSLEQV
FT                   QRLGSQQAHNIQQWFAVRENIIKALGSQSLYNPLNPLKQAQVSGDFELTYFGSNDGVMY
FT                   DSDPSINRDGYDPRSRGWYQEAMNQGGLIVTKPYVDVAYNILVVTLAQSTTGGVVGGDL
FT                   PIAGIVDDIERMALPADGYAVLMHKDGTVIAYKNAGKAMRPAYEIDNDLSHGLPAMSQS
FT                   SNAFTPAYFESESREKLLWGVSIPDTDWELVLVLDRQTLEAPLSSLLIKQLGLSLIILI
FT                   ASVLAISALVNILLGPLSKVSQALAKIADGNGDLTQRIEVESDDEVGVLAESFNRFVGS
FT                   QHELITHIRQLATELDLDAERSLNTNQAAVQELQRQQQEVAMVATAVTEMSCATQEIAS
FT                   NAENTATAAQQSSSSSEQGKNQVDQTRHSINSLASEVTLATEVIGDLSQHAQSISGILS
FT                   TIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQEIHATIETLQ
FT                   QMTARAVQLMKTSQELAGNSVNDADEAALALEEITQAVSLISDMAGQIATAAEEQTQVT
FT                   AEITQNTIAIKDVTDDITGSAMDTLEHAQQLKQRANDLNTKVATFIL"
FT   sig_peptide     306764..306859
FT                   /locus_tag="Swoo_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.490 at
FT                   residue 32"
FT   gene            complement(308679..309635)
FT                   /locus_tag="Swoo_0253"
FT   CDS             complement(308679..309635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0253"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_0253 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84554"
FT                   /db_xref="GOA:B1KN57"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN57"
FT                   /protein_id="ACA84554.1"
FT                   /translation="MSLDNLSRIDLNLLVILQVLLEEQSVTRAASRLHVSQSALSKSLN
FT                   RLREALGDPLFIRTSHGLKPTSHAMQLGTKLPDMLQGLYQLTQPPSFVPASSDRHFSFA
FT                   MVESAYETLLPYFIGPILNNAPNLKLDSYVWMEQSIQSLQNGQIDFGISGRDLHPQSDF
FT                   QIDHLPDGIAHQTLFTDHQVCLVREDHPILAAVAAKQWDLQVYLEMSHVQVRCEGNDWW
FT                   ALDYHLAELGHRRRLSTTVPDFYGAASVCAHSDLIFTLPSSFARHAIKLYPLVELALPF
FT                   EFIPLAYVLLWHERNDEEPGHRWVRDTICKSVAKAFN"
FT   gene            309743..310945
FT                   /locus_tag="Swoo_0254"
FT   CDS             309743..310945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0254"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sse:Ssed_0254 drug resistance transporter, Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84555"
FT                   /db_xref="GOA:B1KN58"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN58"
FT                   /protein_id="ACA84555.1"
FT                   /translation="MRRNLLPILMSMVVLSPLAIDIYLPSMPAMATEFAVSASDVQSTL
FT                   ILFLFAMGVGQIVIGPLADRFGRRPIALGGVLLYIASSILAAVAMEFHWLQIARVLQGL
FT                   AACSTSIVVFSAVRDCFTPKEGARYYSYLNGVICVIPALAPTLGGLLALQFGWRSTFVF
FT                   MTLYAIVMMILIGYRLPETRPANTVTTGPLYRWSRYQPVLVEPHFVFYALCCMAGMASI
FT                   LSYVSYAPVWLIDNLGVSELTFSGLFGLNAVVNIAACFAAPMVINRLGNRPTVILALVT
FT                   MLASALIQVLLQGVGPTQGLAAAFSFMLPMMLLCIGFALLLGPATSMALAAFGERAGTA
FT                   TAILGFIQMSGASLIAGLVQQTELTAPYAVAVVMGALTSGLLIVMAMSRFDHWHQEQYA
FT                   H"
FT   sig_peptide     309743..309838
FT                   /locus_tag="Swoo_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.737 at
FT                   residue 32"
FT   gene            311173..311697
FT                   /locus_tag="Swoo_0255"
FT   CDS             311173..311697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0255"
FT                   /product="DTW domain containing protein"
FT                   /note="PFAM: DTW domain containing protein; KEGG:
FT                   sse:Ssed_0256 DTW domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84556"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN59"
FT                   /protein_id="ACA84556.1"
FT                   /translation="MQVSTELIVLQDPSEVGHAKNSVRLMELVIPETQVYVGETPQDFQ
FT                   ALRHYLNTCGKPVFLVYPSDSSSDVAETSFTEQAVLLLLDGTWRKAYKLLQLNPWLQDY
FT                   PALHLDLTSASNYKIRKASRADSLSTLEAAAMMLKAIEPELQITPLTNALDAMVQQRIR
FT                   SMPPAVRKRYE"
FT   gene            complement(311934..314045)
FT                   /locus_tag="Swoo_0256"
FT   CDS             complement(311934..314045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0256"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: sse:Ssed_0257 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84557"
FT                   /db_xref="GOA:B1KN60"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN60"
FT                   /protein_id="ACA84557.1"
FT                   /translation="MTSWSTLLSKLTSSKPSLIYQLNLWQQEDSPPLALIQDHQFIGAN
FT                   SAALSYFQTQSDGFIQASPYDFSPRIQSSGRSSVEYTRQMIEQASKGDITEFNWHYISR
FT                   QGTDLPTKVTLFPFKLDELNVLIAQFESKNRRSQTRTKASNGLDTLPKELMSLILEDNA
FT                   EAVYITDSHHSILAVNKAMCRICGYSSEQLIGSKTDLINIDDHPLNVTAEYNKAIEDRG
FT                   NWQGEVWKLRSDGSQFPAWKSCRKLTVEEQVYFVTIFSDISAKKQLESKLTEQAMFDSL
FT                   TGLPNRFHLKKLLNQAIKQTEMRPNTLGAVMFLDLNGFKNINDCFGHATGDKVLQLVSA
FT                   RLEASCIENAEIARLGGDEFTLVVQNCTSRQEIEALSKQIMSLFDTPFEIDDQKLYLGT
FT                   SIGISLFPEHSNHADKLLSLADTAMYSAKKSPSHLLFYDKKMHQEAEQKLHTLSELRHA
FT                   HNLDQFKLAYQVIVNLECNSLIGVEALLRWQKPDGKVINACDFVPLLEETGLLITIGQW
FT                   ALQLACEQMLEWRNYSPDLKVCVNVSPMQLEHHDFVQQVTQSLQSSKLPAEALVLEITE
FT                   LALLRQPETVTKTLLALKALGVSIAIDDFGAGLSSLSKLGTLPIDSLKIDAGFAQRLSE
FT                   PQGKELCQAMIQLAQALDISFVVEGVETLQQKEILEKMGKGFGQGFFFGHPEDATKFTL
FT                   DNFSTDKTA"
FT   gene            314362..314718
FT                   /locus_tag="Swoo_0257"
FT   CDS             314362..314718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84558"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN61"
FT                   /protein_id="ACA84558.1"
FT                   /translation="MEFSINNWLKLFPVLILTTLLFSTASLAKDKLSLSEKADAADKLS
FT                   QDLESEQLQKAREAARDTKVRERKILKRQESGDWETEQRDKAQKQFHERESRQDKYLRE
FT                   AKEAAAKERKIPKP"
FT   sig_peptide     314362..314448
FT                   /locus_tag="Swoo_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            314762..315397
FT                   /locus_tag="Swoo_0258"
FT   CDS             314762..315397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0258"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sse:Ssed_0259 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84559"
FT                   /db_xref="GOA:B1KN62"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN62"
FT                   /protein_id="ACA84559.1"
FT                   /translation="MSLCPLCECDALSHFHQDKKRAYLRCDNCHLVVVPKHYLLCDEQE
FT                   KNTYDQHRNDPQDMRYREFLGRAVNPLFSQLPLGAEGLDFGCGSGPTISVMAAEAGFAM
FT                   KNYDLYYYNVPQNLARTYDFITMTEVIEHIAEPKSLLMRLERLLNPGGVLVVMTKLVEK
FT                   EMEFGQWYYKGDPTHICFYSMETFDWIAKQFSWRLECVDSDVVFFHKH"
FT   gene            315681..316988
FT                   /locus_tag="Swoo_0259"
FT   CDS             315681..316988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0259"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="KEGG: shm:Shewmr7_3816 amidohydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84560"
FT                   /db_xref="GOA:B1KN63"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN63"
FT                   /protein_id="ACA84560.1"
FT                   /translation="MNRSDLIAASKQLLLAGAALSCAFGVQADSEIDVKQLSQDIEHQV
FT                   IEWRRDLHQHPELSNREFRTSKVIKQHLESLGLEVTSNIAHTGVVGILKGGKPGPLIAL
FT                   RADMDGLPVKEEVDLPFASKATDTYRGQEVGVMHACGHDTHVAILMGVAQNLVKIKEQL
FT                   SGDVMFIFQPAEEGAPAGEEGGAELMLKEGLFANRKPEKIFGLHVTSSMPTGMIGLRAG
FT                   PAMASEDSFTITVNGKQTHGSRPWNGVDPIVTSAQIINSVQTIVSRQVDVTAAPAVVSF
FT                   GAINGGIRSNIIPDEVELIGTIRTFDQDMRADIKLRLANSATMIAQSMGASATTKIDQG
FT                   YPVTVNNPELVAQMKPVLAGVVGDEMLIEPGLITGAEDFSYYALETPGLFFFLGVTPKG
FT                   TDHTTAPSNHSPRFYVDESALVVGVEALTQLAVTSL"
FT   sig_peptide     315681..315767
FT                   /locus_tag="Swoo_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 29"
FT   gene            317036..318367
FT                   /locus_tag="Swoo_0260"
FT   CDS             317036..318367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0260"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   sse:Ssed_0261 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84561"
FT                   /db_xref="GOA:B1KN64"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN64"
FT                   /protein_id="ACA84561.1"
FT                   /translation="MIGRLTGLVMAAGVLFTSAAVQATEAKDISSFTLDNGMKIMVLED
FT                   ASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGSEKYGPKMFDRTMEAAGGANNA
FT                   YTTENLTVYTDWFPSNAIETIFDLEADRIGKLDIDAKMVESERGVVASERLTGLENSNW
FT                   RTLQEELKGAAFRAHPYSWSVIGHESDIAAWSLDDLVQYHKTYYAPNNAVVVIAGDVKL
FT                   AEVKALADKYFAPIPAQAPPKEVKTVEPLQKGERRVFVQKASVSTPNVMLGYHVPATSH
FT                   QDYYALNLLSNILSTGNSSRLYQSLVEKQLALEVMAYLPMTIDPNLFYVMAVANPGVTA
FT                   KELELNLIAEINRVARDGVTEQELEKVKNIKLMEFYRSMETINGKANTIGTYELYFGSF
FT                   DKLFNAPEAYNKVTTADIQRVAQIYLRRANRTVAVLAATEEADE"
FT   sig_peptide     317036..317107
FT                   /locus_tag="Swoo_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 24"
FT   gene            318364..319809
FT                   /locus_tag="Swoo_0261"
FT   CDS             318364..319809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0261"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   sse:Ssed_0262 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84562"
FT                   /db_xref="GOA:B1KN65"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN65"
FT                   /protein_id="ACA84562.1"
FT                   /translation="MNTLTNLSNRSNKLMAAMALGSILMLSACSSTAPSKVVDTGSFNV
FT                   PSYEQYVLDNGLTLYLMPQKEVPLITVNAVVRAGAVNDTTAGVASMTAKSLLLGSNGKS
FT                   KSEIELMVDFLGASIDAGAGKEGSYLEADFMAKDSETILPLFQNLLLSPNFDRKEFEKL
FT                   RQREIGGLSQAKESPRSVISRYFDKLIFGKHPYGNTSSGNRSSLAELEASQLRAFYKSY
FT                   YQPSNTAITLVGDFDVAQMKANMEALFGQWKGSEPIVKAELKSAQPKLDKSQVLLVNKG
FT                   DAVESTFLIGGKGIARDNPDYVGLQVINTILGGRFTSWLNDELRVNAGLTYGARSGFVA
FT                   YSEGGVFKISTFTKTETTKETIDLALKTYARLWETGIDQETLDSAKAYVKGQFPPKYET
FT                   SGQLAGLLSDMYLYGFDDSFINDFQSNVDGLTLAETQRLIGKYFPQKNLQFVLIGNGEK
FT                   IKHIASEYGEVTQVDIEAVGFGG"
FT   sig_peptide     318364..318456
FT                   /locus_tag="Swoo_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.524 at
FT                   residue 31"
FT   gene            319928..320608
FT                   /locus_tag="Swoo_0262"
FT   CDS             319928..320608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84563"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN66"
FT                   /protein_id="ACA84563.1"
FT                   /translation="MASLQAFLFLSVASMEPVISALLFYTLIQRDEGLEKDVVTKSSDS
FT                   MFENIHAFEGDDAIDWCHIRESIKVLILAMAQIELSLTDGEHNVTNLGALFTDMADHLG
FT                   EVNDFLSTQSDTPVLVMAHSTILVDKVNEGVVAFQFYDRISQRLQHVIMGLALMEEVLS
FT                   SKERRTSQDAWKKLQEGIQESYSLDCERKMFDLLLKGTPVHEALKLYKEEYQKEETEDD
FT                   IELF"
FT   gene            320589..321110
FT                   /locus_tag="Swoo_0263"
FT   CDS             320589..321110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84564"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN67"
FT                   /protein_id="ACA84564.1"
FT                   /translation="MILSCSKYGLLYCLFLCFPITSWAERANFSEFCSALDGQWQGSSA
FT                   KSKQKPVQTKINANCSDDRRQLILTVNPSAKHPLSETWWFRARGEAISLIYFDGVDEDK
FT                   SQLFSLYHHQGSYSLLGEGELNSRPAMIQLRFDQKEVGWLWLQNIQYLDDDTDRYLFYR
FT                   GIEMLPAAEQ"
FT   sig_peptide     320589..320663
FT                   /locus_tag="Swoo_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.929 at
FT                   residue 25"
FT   gene            complement(321130..321594)
FT                   /locus_tag="Swoo_0264"
FT   CDS             complement(321130..321594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0264"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   sse:Ssed_0265 RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84565"
FT                   /db_xref="GOA:B1KN68"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN68"
FT                   /protein_id="ACA84565.1"
FT                   /translation="MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLR
FT                   RAGLDYNDLTRVTRHKDFESFLQAMEGKRIMACTTKGSRHHTELSFEKEDVLLFGPETR
FT                   GLPIEIIESLPTSQRLKIPMTPNSRSLNLSNAVAIISYEAWRQIGFEGAV"
FT   gene            321747..322685
FT                   /locus_tag="Swoo_0265"
FT   CDS             321747..322685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0265"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: spl:Spea_3945 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84566"
FT                   /db_xref="GOA:B1KN69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN69"
FT                   /protein_id="ACA84566.1"
FT                   /translation="MDLAKLSRISMKHLITLHVMLDTLSVTASAERLCLSPSSVSKTLS
FT                   QLRLNLDDELFYRHGNKLVATQLARRLGPAVHQIINDMNQIMTQEVFNPAVYEGRFSLA
FT                   MRESTFELLAAKLSAHVLNLAPNIRLDIHFKNTVGFDGLVKGTLDFIILPHDLSQPPIA
FT                   RSELVWETLINDEMVCLMNASHPLAIKSQLSIDDYLNYSHVGISDTDLNIPFFEMQLAQ
FT                   QQRSRAVPISVADFGSAVLMCHHSELLFTCSRRWAENAFQANGLVTKRLPFDYGEVAYS
FT                   LVWHRQSMNDPALRWLYEQIVGFTTKLGAFE"
FT   gene            324231..325064
FT                   /locus_tag="Swoo_0266"
FT   CDS             324231..325064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0266"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: ddi:DDBDRAFT_0205288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84567"
FT                   /db_xref="GOA:B1KN70"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN70"
FT                   /protein_id="ACA84567.1"
FT                   /translation="MDFYSESNINRYEVSKLYGLASEYNKISNFCKLVWSSLWSEKKDL
FT                   YKFAPSIMLYGSPGTGKTTLLKNVAYSLKDDNLKYVTLSLELMLDKDLGMSSKRLRDFF
FT                   EHIKSLALQDYKVFVHFDDVDSVLCSRYISNESSGVKRFVNTFIKEIDYLLDVECDYLP
FT                   IILITTNMFSMIDTAVKRRFSLKFEIENRVSVEEFRNWIYPMCDDLKIKNELNYELLYK
FT                   LMNEKELTNFDVYLILQELFLEQLTGIKVTGLNLVQKFEEAKSSKSDFERQRKQS"
FT   gene            325088..325297
FT                   /locus_tag="Swoo_0267"
FT   CDS             325088..325297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84568"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN71"
FT                   /protein_id="ACA84568.1"
FT                   /translation="MTKKMSAARKAAESTIRHEDLVDAIENFGKKHGLDVEATEGNDPR
FT                   GDVRVSRKDYAKLESLMDEKLNKK"
FT   gene            325308..325523
FT                   /locus_tag="Swoo_0268"
FT   CDS             325308..325523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84569"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN72"
FT                   /protein_id="ACA84569.1"
FT                   /translation="MSNEQDDYIEVKVHRDGVTTTTAKKAVKQKVKMVVSGHDIQPGAK
FT                   KILRENGIKFYENVDASDFDTDSEVE"
FT   gene            325525..325857
FT                   /locus_tag="Swoo_0269"
FT   CDS             325525..325857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84570"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN73"
FT                   /protein_id="ACA84570.1"
FT                   /translation="MELDFYKGFECVDSVSVGKELWGDILKIECLDEVSSDESIIPDGF
FT                   DGEGEKIERISLLEIRKSMLESLSRLLLKNSRLERDENTIVALSKIIEIMRFINSDDIS
FT                   HFKLDV"
FT   gene            complement(326697..327575)
FT                   /locus_tag="Swoo_0270"
FT   CDS             complement(326697..327575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0270"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Radical SAM domain protein; KEGG: spl:Spea_3944
FT                   radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84571"
FT                   /db_xref="GOA:B1KN74"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN74"
FT                   /protein_id="ACA84571.1"
FT                   /translation="MSRVATVNQIIPFSCVDGPGSRLVIFLQGCNFNCKNCHNPYTIDM
FT                   CNSCGDCVATCPVNALSLTSSKEGKSKIVWDSDLCTQCDICLSTCPKQSSPKTRQYSVP
FT                   QILELIRAQVHFINGITISGGEATLQLPFIIELFQAIKASQDLMHLSCMIDSNGYLSEG
FT                   GWLQVMPYLDGVMIDLKSWQQETHNYITGRDNHRVFSSLKLLAKHGKLYEIRLLHIPHV
FT                   SDFDSEIDAVASYLTRLPANVRIKLNAFQHHGVTGESLNWPICSEEQMLELAARLTERG
FT                   VANLVLPNVYL"
FT   gene            complement(327598..329169)
FT                   /locus_tag="Swoo_0271"
FT   CDS             complement(327598..329169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3943 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84572"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN75"
FT                   /protein_id="ACA84572.1"
FT                   /translation="MDINLMASQDNFAKIIRDPNLSSKQKSNYLALEAEASLTYLSISP
FT                   ELTQAKSTGVICDMFEGHAPFKPRYVLPDYAKLLQNGSTYLELSAAQDLDEALNALTII
FT                   YHHVPSVTSIPVYLGQLDEVLLPYCQGLDEESIYRKIKLFWIMLDRTLPDAFMHVNIGP
FT                   TDNIVCRTILRVDAELKQIAPNLTFMYDPSVTPDELLQLAANNICECSKPHIANYPIHA
FT                   NSYDDRGFGIVSCYNSLPLAGGANTLVRLNLKEVALTAHSISDFFDNILPKYCRLTFEL
FT                   IEARSKFLHEESNFFNSFLVKEGLIEESRFAPMFGIYGMAEAVNILQGTPEFSEDNIDK
FT                   PSSHYGHNTAANELGHKISKALDAIVKSTPVTYGYNGRALLHSQGGISIDKEVTPGVRI
FT                   PYGTEPNPIAHIQALAEHHQYYTSGISDILTIDETIKSNPQAMMQLCKGALSLGFREFT
FT                   ANVASNDLVRVTGYMIKLSDIATFKQAGSRTNTTSLGFDAAANTRILERQPRVIAHEQS
FT                   PSYAAD"
FT   gene            329481..330461
FT                   /locus_tag="Swoo_0272"
FT   CDS             329481..330461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0272"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sse:Ssed_0271 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84573"
FT                   /db_xref="GOA:B1KN76"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN76"
FT                   /protein_id="ACA84573.1"
FT                   /translation="MFNALILTQEGKSTLANVGQLQVSDLPEGEVLVDVSCSSLNYKDG
FT                   LAVTGTGRIIRNFPMVPGIDFAGVVVESSDKRYKAGDRVILTGWGVGENHWGGMAEKAR
FT                   VNADWLVPMPEACDAEKAMMIGTAGLTAMLCVQALQTANIQPDSGEILVTGASGGVGSV
FT                   AVTLLARLGYKVVASTGRAEENSELLKSLGAAEVMERSELEQDARPLEKQRWAGVIDTV
FT                   GNKVLATALAQMNYGGAAAICGLAGGFALPTTVMPFILRGVSLLGVDSVSCPFEKRQKA
FT                   WEQVLSLLPESYYQQAGQTITLDQVPEFAGKIVKGEVTGRVLVKL"
FT   gene            330754..332751
FT                   /locus_tag="Swoo_0273"
FT   CDS             330754..332751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84574"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN77"
FT                   /protein_id="ACA84574.1"
FT                   /translation="MSNHIKLALAVSAALSMSGCLEVEDNNNNDDVVAALEAQNQLLQD
FT                   QNTTNALPITLSGTLKGATDDVDLSDAQVSIKFAGEWSTPVPISDAKILLEKQPAYSDF
FT                   TLKVESPSEAFVAMTYKSITRHSGQGQVVNQDLGEILVGKPKEKVLTLLQTGENIFVED
FT                   LAVYPLYEVEHQGYNIHNLVLQQPEEFAGFTKETGEYKLILAEGIPTEIHAELDIDSDG
FT                   VNDFELELGQSGLASQLLSSSKVWAEDTLYLKEINQLNEYNLRLTILNEQGEVLEDARV
FT                   SSENNDHGNAYFDYDSVTGQYVLEAAYRGWLNVEIPSFQVGELHYTSAEMSIYETEFEQ
FT                   QYRVSISGSQYRVFRTEVVEGELNLAVNLSTFSYESPSIEVLSNNVKDSSLEVFYSAPV
FT                   ALVEEDNVQTSVELMATDAMTIIPGNTQNDQGITPGTTYVMHAPKSVGTSVELMLNGTK
FT                   LTASPAAELADGEYQYRVGDLVNVIADEEQNVYSDDSEGFTVSKSAFNVNDVVLDNRNY
FT                   TTNGALIVAKNTADVVVNCSWCGGSGNVRLYTPTSINNLEELIFTLKSYTNNGVVQDYH
FT                   REIRVVVDGQLYSTSKEFMLKAAQNENISANYYYPQVGTSLDSGYRYSNYTYLNLNDDV
FT                   VGSENSMTFDYSYTTKEGDTQTGTITYKVK"
FT   sig_peptide     330754..330822
FT                   /locus_tag="Swoo_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.517 at
FT                   residue 23"
FT   gene            complement(333029..333949)
FT                   /locus_tag="Swoo_0274"
FT   CDS             complement(333029..333949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0274"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_0272 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84575"
FT                   /db_xref="GOA:B1KN78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN78"
FT                   /protein_id="ACA84575.1"
FT                   /translation="MELEDIYRQDLSLLIALQILVEECSVTQAAKRLHLSQSATSRILS
FT                   RLREMLGDPLFSRVGQKLVPTQFALDCYQQLQQPTGQLIEMLSPKAFVPNECQQHFTLA
FT                   ATDYAMQALIPFILPDIYNKAPNIKLEIIPVQHRELQSQLSVQGADMAICRAIGQTQQL
FT                   NQTFLGRVGVSCLLSAEHPLAHQALTLEDYLHFPHATIAISDGVKALLDAAIASYPPRD
FT                   ELLRTPHLDSALALLQFHPAIITLPAGIAELAALKHRLRVKPLPFDIPPLDYNLFWHSR
FT                   AELDKAQQWLREEISNSIRRLLKAE"
FT   gene            334489..336009
FT                   /locus_tag="Swoo_0275"
FT   CDS             334489..336009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0275"
FT                   /product="flavocytochrome c"
FT                   /note="TIGRFAM: flavocytochrome c; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase; KEGG: spl:Spea_3939
FT                   flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84576"
FT                   /db_xref="GOA:B1KN79"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN79"
FT                   /protein_id="ACA84576.1"
FT                   /translation="MSNKDLLGRRNFIKGMGAAAGVAMAAPALAVSENANGVKWDKEVE
FT                   VLIIGSGFAGLAAAIEATRKGAKDVHIFEKMSYFGGNSAINGGLFAAPDTPMQKQEGVK
FT                   DSVDTMVADQLAAGRGIADEALLRHVAEHAVEALQMTLDAGSEYHPYLQQLGGHSVART
FT                   YQTTVSCGAGITQPLLQECRKLGVHTHNRAKFDGFILDEKGGVVGVKMREGYYFDKPES
FT                   GKLVRIKARRGVIMATGGFAQNINMRMAQDPTLTAEVGCTNAPGATGEGMFEMFRLGAV
FT                   PVHLAHIQSGPWASPDEGGFGYVSNYSIYNFPHSIAIDRLTGKRFMNEIADRKTRADAE
FT                   LNCRDAQGNPLPPILITSYEDSKQHPNTKKVLKYNVGWKFDSIDALAKHFDVPLAPLKK
FT                   QIAEYNDYVKTQSDPQFGKNMTEAKGKFIQAPFTVVRLWPKVHYCQGGVQINTNAEVKD
FT                   SLTGKPISGLYAAGEVCGGIHGVSRLGSCSIPECMVMGMTAARIMMQA"
FT   sig_peptide     334489..334581
FT                   /locus_tag="Swoo_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT   gene            336038..336391
FT                   /locus_tag="Swoo_0276"
FT   CDS             336038..336391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0276"
FT                   /product="tetraheme cytochrome c"
FT                   /note="KEGG: spl:Spea_3938 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84577"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN80"
FT                   /protein_id="ACA84577.1"
FT                   /translation="MKMYKLMLGLVLAGLVSLSAQAIEQRDYHKEVIGKDCKSCHDQGV
FT                   KNYPSDQACLQCHDVDELAEETARSEEDKWQNPHNNLHYGKELPCIECHGEHEAKKPIC
FT                   SNCHTFKYDKHKE"
FT   sig_peptide     336038..336106
FT                   /locus_tag="Swoo_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.799 at
FT                   residue 23"
FT   gene            336664..337908
FT                   /locus_tag="Swoo_0277"
FT   CDS             336664..337908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_3937 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84578"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN81"
FT                   /protein_id="ACA84578.1"
FT                   /translation="MKYMVLFSGLLFSNVLVASELPDFLDMNDIENAKFQCLGESPQYS
FT                   AQDQKYIDILWEETLTYLRAYAEALTNDQNSGCLNSDIAMVDSTEGGQHMCVMDRRDMK
FT                   LMVKNVYQVINNADAAKKCFGAREDVSWIYSPGGELESRSEVAQWINRTTFKQFFDKQV
FT                   TDKEVQQYGKSFTENFYKMVTGSEIKMPAVFPHDISANALPNLWASAGWFPMYAEESER
FT                   NDKNFNNIRGGYAYAEIFGHWGLLRIDEINGEKVGAEIGMTVQAVNSLYPFHNHAVSEM
FT                   YYNMRTPACANQFRTMAIREDSPLIRTVKEDSKVRRVQFDEGQHNSQTMWLSGSNAQDS
FT                   LTYFHQNTIHAFDIDGQCEASPEERAIVSVWARSNAHDTRNDYGTTLLCESAKHPGTPA
FT                   KRGEVIQCDLTKVKW"
FT   sig_peptide     336664..336720
FT                   /locus_tag="Swoo_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.979 at
FT                   residue 19"
FT   gene            complement(337981..338856)
FT                   /locus_tag="Swoo_0278"
FT   CDS             complement(337981..338856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0278"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: spl:Spea_3936 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84579"
FT                   /db_xref="GOA:B1KN82"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN82"
FT                   /protein_id="ACA84579.1"
FT                   /translation="MLKIELLESFIAIAESGNLSKAAEKICRTQSALSLQIKKLEESVG
FT                   QPLLHRDNKGVTLTASGKTLLNYAYKMMQLSSKALDDLKECQNRESIRLGVPTDYINRY
FT                   LGSCLLEFIREFTCIELIIDTDVSGNLYKRLHNGEFDLIVATHWHPPAAGHGELLFERR
FT                   FHWVAAKGGNAHKRETIPMALYPENCPIRAQVFANHQISMRPMSVLLSTPSPAAMCMAV
FT                   ENDLVIAPIAEFRINDKMQIIDPVEHNIPSLPVFNESLYLNPDTQTEATNQLIDLIKAN
FT                   VKELGEVPLN"
FT   gene            338978..339646
FT                   /locus_tag="Swoo_0279"
FT   CDS             338978..339646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0279"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: sbn:Sbal195_0259 putative transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84580"
FT                   /db_xref="GOA:B1KN83"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN83"
FT                   /protein_id="ACA84580.1"
FT                   /translation="MSSWKQREQYLVQVAQRCLQGHKTFDLYRSHLVNASQISKGTIYN
FT                   HFTTEADLILAVSCCEYEYWLGLAKQDLKEHQDPLTCFLYHHCNRLYYTLSEKRFVVDR
FT                   VMPNQDLLNQANELLRLRFETLYEEYVSLNKRMILDIGEVAGFDRVELVMNYLRGAMIN
FT                   SDDADKHFGDVQLYYQFSYALSQLMGHSDRRIPTKLAFAAWLSAKHREKHQVTIINSAA
FT                   "
FT   gene            complement(339630..341009)
FT                   /locus_tag="Swoo_0280"
FT   CDS             complement(339630..341009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0280"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: sse:Ssed_0278 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84581"
FT                   /db_xref="GOA:B1KN84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN84"
FT                   /protein_id="ACA84581.1"
FT                   /translation="MASIISPDKIPNRIFIKLLLGFWLCSSIIIATVGLLPLLQQNHDR
FT                   APLPPHLEKLLSKFADRISNQPQLLEAGKLSRLTHRRNFKGKPVRLYLVNDQGRVINTD
FT                   KVSRGMRRFMLMAEEANQPISHQFKNELLFGPYNFDVTGKQYSLYGRFADHHPRPWFFF
FT                   LAENKLLTLSLAIALSGLLCGLLAWHLGKPLRTLRLSADSLAAGDLTNRVDDATTQRKD
FT                   EIGLLAQAFNGMADSVENMVNSQQRLISDISHELRTPLTRLQLALALARKKGVDTAETQ
FT                   RIGYEAEQLELMIAELLELSRVKLNRHDIKHLVSLNETLNQVLDDADFEASQQGKRLVI
FT                   DIDDAITLPTNPRPLARAIENLLRNAISYAEMEINIIAQAAGNQIIITISDDGPGIENK
FT                   QDLHEIFKPFYRPQSARERESGGWGLGLAIAKAAIDAHQGEITAQNRASQGLEIIIKLP
FT                   S"
FT   gene            complement(340997..341680)
FT                   /locus_tag="Swoo_0281"
FT   CDS             complement(340997..341680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0281"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sse:Ssed_0279 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84582"
FT                   /db_xref="GOA:B1KN85"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN85"
FT                   /protein_id="ACA84582.1"
FT                   /translation="MNHILLIDDDLGLSELLGQLLELEGFKLTLANDGEAGLALALEQK
FT                   FDLILLDVMLPKLNGFEVLKALRVKKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELIARIKAIIRRTNLQIDETQPSIHEYGDIKLDPSRQEVYCQDMLLILTGTEFTLLF
FT                   EMLQNGGELISKELLSEKVLGKKLMPFDRSLDMHLSNLRKKLPDRTDGRPRVKTIRGKG
FT                   YIWLP"
FT   gene            341911..342375
FT                   /locus_tag="Swoo_0282"
FT   CDS             341911..342375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0282"
FT                   /product="protein of unknown function Spy-related"
FT                   /note="PFAM: protein of unknown function Spy-related; KEGG:
FT                   sse:Ssed_0280 protein of unknown function, Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84583"
FT                   /db_xref="GOA:B1KN86"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN86"
FT                   /protein_id="ACA84583.1"
FT                   /translation="MKKNTLKAGLLAIVASTTLMASSVYAGDDHQHHGKSHHMKGERSG
FT                   HHGDIRKMFRGLDLTDTQKAEIKALVKEQRKAMKEEQVSKEERSAHRSEFFALISADNF
FT                   DEAKAQALIEKKQQKRQEKGVAMLKIQNEVYQLLTPEQKVKFKEKFERRH"
FT   sig_peptide     341911..341991
FT                   /locus_tag="Swoo_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            342497..343366
FT                   /locus_tag="Swoo_0283"
FT   CDS             342497..343366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0283"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   sse:Ssed_0281 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84584"
FT                   /db_xref="GOA:B1KN87"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN87"
FT                   /protein_id="ACA84584.1"
FT                   /translation="MTQTSQYDFWVKLASRAAVATALTLVIIKMAAWLYSGSASMLASL
FT                   TDSFADGLASLVNFAAIRYAIVPADHDHRYGHGKAEPLAALAQSAFILGSAFLLLFHGG
FT                   DRLINPAPINHAMLGVVVSIIAIVLTFALVMLQKKAVEATSSTVVEADALHYKSDLFLN
FT                   AAVLLALVLAQYGWWWADGLFAILIALFIGQQALELGYRSIQSLLDRELDNDTRLKIVE
FT                   LAQEDPQVKGIHDLRTRESGKTTFIQCHLEIEGSLSLREAHAIADRTEARIRAAFDDAE
FT                   VIIHQDPV"
FT   gene            344054..345588
FT                   /locus_tag="Swoo_R0007"
FT   rRNA            344054..345588
FT                   /locus_tag="Swoo_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            346019..348913
FT                   /locus_tag="Swoo_R0008"
FT   rRNA            346019..348913
FT                   /locus_tag="Swoo_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            349032..349146
FT                   /locus_tag="Swoo_R0009"
FT   rRNA            349032..349146
FT                   /locus_tag="Swoo_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(349707..350372)
FT                   /locus_tag="Swoo_0284"
FT   CDS             complement(349707..350372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0284"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: sse:Ssed_0437 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84585"
FT                   /db_xref="GOA:B1KN88"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN88"
FT                   /protein_id="ACA84585.1"
FT                   /translation="MASPLIKAVIFDMDGVLIDSEPAWQLAEYQTMRNQGLKISYQDTL
FT                   QTTGLRIDEVVSYWYQRFPWKDYDNPKTATEIVNKVVQHILDDGTAMQGVFKALDFCEA
FT                   NGLKIGLATSSSQAIIQAVLNKLEIGHYFSSIQSAEHLNRGKPHPEVYLNCIDDLELSC
FT                   SQCVAIEDSFNGLIAARAANMQTIAIPAPEQKNDQKWIIAHKQLDSLLELPEYLQDKF"
FT   gene            350786..353383
FT                   /locus_tag="Swoo_0285"
FT   CDS             350786..353383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0285"
FT                   /product="aconitate hydratase 2"
FT                   /note="TIGRFAM: aconitate hydratase 2; PFAM: aconitate
FT                   hydratase domain protein; Aconitase B, N-terminal; KEGG:
FT                   sse:Ssed_0438 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84586"
FT                   /db_xref="GOA:B1KN89"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN89"
FT                   /protein_id="ACA84586.1"
FT                   /translation="MLEAYRKHVEERASEGVVPKPLDAQQVAELVELVKNPPAGEEAFI
FT                   LDLLENRIPPGVDEAAYVKAGFLDAVAKGEVTSSILSSARAVELLGTMQGGYNIEPLIA
FT                   QLDVEAQAPLAVEALSKTLLMFDSFHDVVEKMQAGNEFAKQVVNSWAEAEWFLNRPKLE
FT                   EKISLTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNARDGIVPDEAGVIGPIKE
FT                   IEQLKTKGFPLVYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGFCLGGKIAPI
FT                   FFNTMEDAGALPIELDVSKMDMGDVIDIYPYQGVVKRHDSDEVISEFKLKTDVLMDEVR
FT                   AGGRIPLIIGRGLTSRAREVLKLEPSDVFVLPQDVADTGKGYTLAQKMVGKACGVTGIR
FT                   PGQYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGEMQPGITLRDLVHAIPHKAIEMGLLTVEKKGKINFFSG
FT                   RVLEIEGLESLKVEQAFELSDASAERSAAGCSIKLDKEPIIEYLNSNIVMLKWMIAEGY
FT                   GDRRTIERRITAMQEWLANPELMSADEDAEYAAVIEIDLNDIKEPILCAPNDPDDAVLL
FT                   SDVKDTKIDEVFVGSCMTNIGHFRATGKMLDKFASTLPTRLWIAPPTKMDRDQLTEEGY
FT                   YAIFGRVGARIEIPGCSLCMGNQARVAEGATVVSTSTRNFPNRLGTGANVYLASAELAS
FT                   VAALLGRLPSAEEYQTYAKELDATAADTYRYLNFDKIESYTEKAGEVIFQSAV"
FT   gene            complement(353525..353992)
FT                   /locus_tag="Swoo_0286"
FT   CDS             complement(353525..353992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0286"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: sse:Ssed_0439 regulator of RpoD, Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84587"
FT                   /db_xref="GOA:B1KN90"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN90"
FT                   /protein_id="ACA84587.1"
FT                   /translation="MLKQLEKAEQRWGGANTLIDHWLNNRRKLLINYCKIAGIPPYDST
FT                   EKSLPAITLVKEFCDQLMDYVSEGHFEVYDQVVTACEKNGVSSKELAQKLVPRISETTD
FT                   SALDFNDKYTELVDDKVLFQLDKDLSSLGHAMETRFELEDKLLEVLHTKHS"
FT   gene            354494..355558
FT                   /locus_tag="Swoo_0287"
FT   CDS             354494..355558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0287"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: sse:Ssed_0440 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84588"
FT                   /db_xref="GOA:B1KN91"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /protein_id="ACA84588.1"
FT                   /translation="MAELKNDRYLRALLKQPVDRTPVWMMRQAGRYLPEYKATRAEAGD
FT                   FMSLCKNQDLACEVTLQPLRRYDLDAAILFSDILTIPDAMGLGLYFETGEGPRFQRPTD
FT                   TIDAIKKLSIPDPEDELGYVMRAVSTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKT
FT                   FEKIKKMAYEEPATLHMLLDKLADSVILYLNAQVANGAQSLMIFDSWGGALSHHAYREF
FT                   SLRYMQKIVDGLTRHADGRQVPVTLFTKGGGLWLESMAETGCDALGLDWTVDIGDARRR
FT                   VGHKVALQGNMDPSVLYASPERIHQEVDQILSSYGEGTGHVFNLGHGIHQHVDPEHAGA
FT                   FINSVHELSAKYHK"
FT   gene            complement(355636..357117)
FT                   /locus_tag="Swoo_0288"
FT   CDS             complement(355636..357117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0288"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: sfr:Sfri_0484 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84589"
FT                   /db_xref="GOA:B1KN92"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN92"
FT                   /protein_id="ACA84589.1"
FT                   /translation="MNSLFSRLLLSASLVVFILILALWQWFQFNQEFSRDQVQQSLHRD
FT                   LALHMSHINPLLSQGITSDAALKEAFHDFMLLGPSFEIYTLDTLGNVVAYDAKAEKIKR
FT                   LRVDTHALKNFIDGDELPIKGMDPRSTNSKKIFSAAYLQSPDGKKTGYLYVIIGGEDFD
FT                   MWQSLVSEHQAPRFWVGVALASILFALILFALLARYLTNPFSRLERDLGVLGSQKLSDG
FT                   LSLPDEYRGSSEIQQLSLHINHLLEKISQQHQAINQQQQARHDFMLHLSHDLKTPLTSL
FT                   QGYIDTWLLMPDSERSSDLIEVAANSGRHLQRLLSQMLELAALENGQITPDFKPVELTH
FT                   ILHELVLIFAPRAKQQNVILDFELDSELTVLTDPQLLMRVLSNLIDNAIRYTPAGGSIT
FT                   IKSRPHQSEELLHVNENPVWLCVSDNGSGMHKHELQALKQLKAKPTFNRSDVLPQLGVG
FT                   LAIVRQLLGLLKCNIDIESVPGEGSQFHIELQQVK"
FT   sig_peptide     complement(357049..357117)
FT                   /locus_tag="Swoo_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.573 at
FT                   residue 23"
FT   gene            complement(357117..357848)
FT                   /locus_tag="Swoo_0289"
FT   CDS             complement(357117..357848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0289"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sfr:Sfri_0485 two component
FT                   transcriptional regulator, winged helix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84590"
FT                   /db_xref="GOA:B1KN93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN93"
FT                   /protein_id="ACA84590.1"
FT                   /translation="MNGTRTANNQYTHKILLVEDEPDLANLVKLNLNTLNFDVIHCTTL
FT                   KQANQNLELKSFDLILIDRTLPDGDGLMLCQQLRHAGKETPCMMLTAKDSEADIVLGLE
FT                   SGADDYLTKPFSVLELRARVKALLRRGHQTEHEEQQLDFNGITINCDTREVIAFDTQLE
FT                   LTAREFDLLLFMAKHPKQVFSRLQLLEAVWGYSYSGYEHTVNSHINRLRAKLSHCTPAA
FT                   ELVKTVWGVGYKFSPPETRSH"
FT   gene            complement(357930..358661)
FT                   /locus_tag="Swoo_0290"
FT   CDS             complement(357930..358661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84591"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN94"
FT                   /protein_id="ACA84591.1"
FT                   /translation="MNTFKTLPRNKLLLVAAISSSLFLSACSDSDNTPEVTPPAPPAPV
FT                   VNQVYSVTVTNLTANQPMSPITLIAHGDISAWQVGSPASLALETIAESGDGSLFSSMDD
FT                   VDSVTVGAGILPPGMSESIELSLAPDDVDSLSILTMLVNTNDAFAGLNDFSLGELAVDQ
FT                   TIRFRSIAYDAGTESNSEAKGTLPGPADGGEGFNAMRDDVDRVHAHPGVISQDDGLTDS
FT                   VLSASHRFDNPVLSIMINRTQ"
FT   sig_peptide     complement(358581..358661)
FT                   /locus_tag="Swoo_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.459 at
FT                   residue 27"
FT   gene            complement(358672..359376)
FT                   /locus_tag="Swoo_0291"
FT   CDS             complement(358672..359376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84592"
FT                   /db_xref="InterPro:IPR009465"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN95"
FT                   /protein_id="ACA84592.1"
FT                   /translation="MNLNKVSKILILNGLMLAAPSMAAELEISITNLTQGNHFTPILIT
FT                   AHDNTSHQFQAGEMASPALQKMAEGGDIADLMAAATGNNELTVGNPAEGLLAPGGKVNE
FT                   IMLDTQSMTHLSIVAMVLPTNDAFIGLDAWEIPTTPGTYTINVNAYDAGTEANDEIVNG
FT                   GGMPGAPGIPAAPGMDAGMNGTGVSDTSANDKVHIHAGVLGDMDEAGGISDLDSRIHRW
FT                   LNPVARVVVEVK"
FT   sig_peptide     complement(359305..359376)
FT                   /locus_tag="Swoo_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            359731..362343
FT                   /locus_tag="Swoo_0292"
FT   CDS             359731..362343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0292"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; KEGG:
FT                   sse:Ssed_0441 sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84593"
FT                   /db_xref="GOA:B1KN96"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN96"
FT                   /protein_id="ACA84593.1"
FT                   /translation="MHIGKKLIVFVVGFCLPAVIAVSYCLSMWFEHRVDRLRMNAVNAE
FT                   LVAIKTQLNSDIKQLTLMADVYAVPIADLSPMSRVSLDEAWRNSTISDSLSLFYLNRGE
FT                   LEPFSPLYDDILSFEFDKLPKELLSHTKRKSGVYIEDNSGFMVSQVPITDHKSVLIVRK
FT                   LTEELLSSYGANDFVHKIYFAPGPADDHYIIDGAKYIVDLDVASLLPRQDSHLEVQFST
FT                   EMYNKVWLKYDLVTFGIVGLGLLILIIGYIWLKLGLIRPFHRLMSQLADIDPKAKAYTP
FT                   IQGSGCSELIVMADRVNTLLARIFQQKERAKITLESIAEAVILTDTHAKVVYLNPQAER
FT                   MLEIKEAKAIGAKIDTLLKADKTIKSALLNVMGSQVQQTILNKHMFRTGNAKVMERSVS
FT                   SLLNHQQEVVGSVIVLRDITQEEKLKRQLRVRANFDPITSLLNRRAFEERLTHFSENAH
FT                   SLAICYFDLEQFKLINDSCGHSAGDQMLAMVAKAIQSCLNKEDLLARLGGDEFGLAIRN
FT                   QSAVEVAQIVKRVISRVSLQVLHHHACHYRVGVSVGIAIARAPYIASKELVKDADIACL
FT                   AAKRKGSNQIHFYDDKDKESVYQRNAPMWAVRIGQAIEHNELLLYYQEIKGMGEGVNRQ
FT                   RMEILLRVQEPCGRILAPAQFIEAAERFKLMNEVDKEVIRKTFLWLSLHEDIWDDHCIS
FT                   INLSGNSLGAEGMVEYIAKQYERFEIPSQCICFEITETSAIQNRNRAMDMINHLRKLGF
FT                   SFALDDFGSGFASYGYLKELPVDYVKIDGCFVKNLANNAKYFAIVKSIHDVCCAMGIET
FT                   VAEFVENQDIIDKLEKIGINYAQGYAIGRPKPLNNYVQSRTIQVEQAKLVSEVQLLSA"
FT   sig_peptide     359731..359814
FT                   /locus_tag="Swoo_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.695) with cleavage site probability 0.407 at
FT                   residue 28"
FT   gene            362416..363219
FT                   /locus_tag="Swoo_0293"
FT   CDS             362416..363219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0293"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: son:SO_0438 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84594"
FT                   /db_xref="GOA:B1KN97"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN97"
FT                   /protein_id="ACA84594.1"
FT                   /translation="MDGLNGKVIIITGASEGIGRALALSMAPLGCKLVLSARNESRLLS
FT                   LAHEIESQGEPPLVFATDVTSQSQCQELIDATVEHFGCLDILINNAGMTMWSKFDELSD
FT                   LSVLERIMQVNYLGPAYLTHAALPQLKLTQGQVVVVASLAGLTGVPARAGYAASKHAVM
FT                   GFFESLRIELAEHNVAVTTLCPDFVTTQAHKRALDADGEPLGQTPIQESRVMSAEECAR
FT                   MMLPVISGRNRMMITSLRGKLGRFVKLVAPGMIDRMARRASSSGY"
FT   gene            complement(363253..363477)
FT                   /locus_tag="Swoo_0294"
FT   CDS             complement(363253..363477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_0430 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84595"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN98"
FT                   /protein_id="ACA84595.1"
FT                   /translation="MKYSIGDLVYQGETAGVHNWNTISGTSFYWHPDWLHIAEEANGVT
FT                   PTAQITVSNNQITQTDAEQTIINHLNTKS"
FT   gene            complement(363641..364933)
FT                   /locus_tag="Swoo_0295"
FT   CDS             complement(363641..364933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0295"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: sse:Ssed_0443 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84596"
FT                   /db_xref="GOA:B1KN99"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:B1KN99"
FT                   /protein_id="ACA84596.1"
FT                   /translation="MNVLVIGGGGREHALAWKAAQSAQVETVFVAPGNAGTSMEPKLEN
FT                   VAIQVEDIPALVAFAQDKAIEITIVGPEVPLALGVVDAFNDAQLPIFGPTQGAAQLESS
FT                   KAFTKDFLARHNIPTAAYSNFTEIEPAKAYVTQVTANTGFPIVIKADGLAAGKGVIIAE
FT                   DQIQADAAIEDMLAGNKFGEAGSRVVIEEFLKGEEASFIVMVDGKNILAMATSQDHKAR
FT                   DNGDYGPNTGGMGAYSPAPVVTQAVHDWTINNVIRPTVDGMAAEGNVYTGFLYAGLMIA
FT                   PDGSAKVLEYNCRFGDPETQPIMMRLQSDLVALCLAATRGELDKVTAEFDSRAAVGVVL
FT                   AAGGYPEAYRKHDVIDGLDLGNNNAKVFHAGTSMKDGHVVTNGGRVLCATALGNSVTEA
FT                   QQAAYALVEKIHWDDIYFRTDIAYRAISRES"
FT   gene            complement(365106..366713)
FT                   /locus_tag="Swoo_0296"
FT   CDS             complement(365106..366713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0296"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: spl:Spea_0432
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84597"
FT                   /db_xref="GOA:B1KNA0"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /protein_id="ACA84597.1"
FT                   /translation="MNNARPIRRALLSVSDKTGILEFAKSLHAQGVELLSTGGTARLLA
FT                   DNGVPVIEVSDHTGHPEIMDGRVKTLHPKVHGGILARRGIDELVMEQNNIKPIDLVAVN
FT                   LYPFAETVAKEGCTLADAVENIDIGGPTMVRSTAKNHKDTTIIVNAHDYDRVIAEMEAN
FT                   QGSTTLETRFDLAIAAFEHTAAYDGMIANYFGTKVPAHSQDECHERSLCAEDSKFPRTY
FT                   NTQLVKKQDLRYGENSHQTAAFYVDTNIDEASVATAVQLQGKALSYNNIADTDSALECV
FT                   KEFSEPACVIVKHANPCGVAIGENLLEAYNRAFQTDPTSAFGGIIAFNAELDAETAAAI
FT                   VERQFVEVIIAPKVCQAARDVVAAKANVRLLECGEWANKTTSLDYKRVNGGLLLQDRDQ
FT                   GMVGLDEVKVVSKRQPTEAEMKDLMFCWKVAKFVKSNAIVYAKNSMTIGVGAGQMSRVY
FT                   SAKVAGIKAADEGLEVQDSVMASDAFFPFRDGIDAAAAAGISCIIQPGGSIRDEEIIAA
FT                   ADEHGMAMVFTGMRHFRH"
FT   gene            367119..367598
FT                   /locus_tag="Swoo_0297"
FT   CDS             367119..367598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0297"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Zn(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: sse:Ssed_0445
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84598"
FT                   /db_xref="GOA:B1KNA1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA1"
FT                   /protein_id="ACA84598.1"
FT                   /translation="MYRIGELAKQCEVKADTLRFYEKHGLLAPSSRSDSGYRLYNEHDA
FT                   ERLRFILRAKAVGFTLAEITELLSIELDKSNWACADVKGMVDIKLEHVNQKIAELKHFQ
FT                   VSLERLSDACCGGPESAEHCSILEALESNTDSIKCENHGHHHDASQYTKNCQSKG"
FT   gene            367602..368873
FT                   /locus_tag="Swoo_0298"
FT   CDS             367602..368873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0298"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: sse:Ssed_0446 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84599"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA2"
FT                   /protein_id="ACA84599.1"
FT                   /translation="MLLANFIDLFLDSAPWLLLGLFLAGMLKMFVPMAWMQKQLGGHGF
FT                   KATVKAAVLGAPLPLCSCGVIPAAVGLRRSGASKAATTSFLVSTPETGVDSVTVSYVLL
FT                   GPFMAIVRPIAAVTSAIVAGLLVGRDDNDSAVIAESESQSVKPSSSSSCCSASKGVKNT
FT                   PEVTMTPINADESLMVHPATKVKADSCCSNKPVEKQKANNSCCSTSSDTVDEGEACCES
FT                   TKDVATELKGTPVLNRIGKGLHFAATDLVRDTTVWLLIGLFFAALVQTYVPGDFMAKWG
FT                   DGILAMLVMVLISVPMYICATASTPIAAGLLLAGVSPGAVLVFMLAGPATNIATLGVVT
FT                   KELGKRALFGYLGGVLGVALLSGILVNYLVETFGFEVMPQIGEQHNLLPEAIVYSSGVV
FT                   LAILMVKVLVEKLPKNWWRRDCCS"
FT   gene            complement(368969..369373)
FT                   /locus_tag="Swoo_0299"
FT   CDS             complement(368969..369373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0299"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: NUDIX
FT                   hydrolase; KEGG: sfr:Sfri_3789 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84600"
FT                   /db_xref="GOA:B1KNA3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA3"
FT                   /protein_id="ACA84600.1"
FT                   /translation="MTDSVKKRVHVAVGVIINDKQEILLAKRLDHLHQGGKWEFPGGKV
FT                   ELGETVTDALKRELKEEVNLDVASSSPLMEISHDYPDKQVLLDIHLVTNFTGKARGLEQ
FT                   QEICWVPKKELINYEFPEANKPILDKILAD"
FT   gene            complement(369377..369589)
FT                   /locus_tag="Swoo_0300"
FT   CDS             complement(369377..369589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0300"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   slo:Shew_3443 protein of unknown function DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84601"
FT                   /db_xref="GOA:B1KNA4"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /protein_id="ACA84601.1"
FT                   /translation="MPTSVKCPTCQKDVIWNNESKFKPFCCERCKLIDLGDWASEKHAI
FT                   PVKPEFDADDLDNLGYDEADFFKEN"
FT   gene            complement(369665..370399)
FT                   /locus_tag="Swoo_0301"
FT   CDS             complement(369665..370399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0301"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   sse:Ssed_0421 protein of unknown function DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84602"
FT                   /db_xref="GOA:B1KNA5"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA5"
FT                   /protein_id="ACA84602.1"
FT                   /translation="MTELTYEQPLNEKTRSFLRLEYLSQQLETNVEQDHQHRCFYPLFS
FT                   LCELTERCDYRGEVLKDLDKQIITLSNWQTLPHIDKQQVEFYLNRLVTAKETLQACDRP
FT                   GSALKQDRFLAALRQRFNMPGACCNFDLPQLHYWLAKPWDVRQQEYLAWVENFTALLSP
FT                   IKLLLELTRQTTQFNDTTAKVGFFQGNSNQALSMIRVKIDSQQGCYPTISGHKNRFAIH
FT                   FVQFEQQKHSDKTIEFQLATCA"
FT   gene            complement(370408..371013)
FT                   /locus_tag="Swoo_0302"
FT   CDS             complement(370408..371013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0302"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: sse:Ssed_0422 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84603"
FT                   /db_xref="GOA:B1KNA6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA6"
FT                   /protein_id="ACA84603.1"
FT                   /translation="MTNLVVGLTGGIGSGKTTVANIFAELGIELVDADIVAREVVAIGS
FT                   LGLTKIAQHFGADILNSDSTLNRAKLREHIFSKPEELEWLNALLHPIIRTEMLKQLDNT
FT                   RSPYSILIAPLLFENGLDRLVDRTLLVDISPEQQRNRTKIRDSVTAEQVQKIIDSQASR
FT                   EDKLSKADDVIDNHGERSALRNKVVALHNNYLKLSNNT"
FT   gene            complement(371051..371962)
FT                   /locus_tag="Swoo_0303"
FT   CDS             complement(371051..371962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0303"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: sse:Ssed_0423 prepilin
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84604"
FT                   /db_xref="GOA:B1KNA7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA7"
FT                   /protein_id="ACA84604.1"
FT                   /translation="MSEFISTMSHNLWLFAMISFVFAAVIGSFLNVVIHRLPVMMKREW
FT                   QQECNQYLNEYHEALVKPIAKKLEKPIDSYPEKYNLVIPHSACPKCGTHIKPWHNLPIL
FT                   GWLMLKGKCASCKTHISARYPVIELLTGLAIAFLALHFGPTIEFALATTLTFGLIVLTG
FT                   IDLDEMLLPDQITLPLLWLGLIINLNGTFVSPTDAIIGAAAGYMSLWSVFWGFKLLTGK
FT                   EGMGYGDFKLLAVFGAWLGWQLLPIIVLLSSLVGAIIGIGLIVTKKINHTNPIPFGPYI
FT                   AIAGWIAMIWGSSINAWYLSTL"
FT   sig_peptide     complement(371891..371962)
FT                   /locus_tag="Swoo_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.678 at
FT                   residue 24"
FT   gene            complement(372533..375205)
FT                   /locus_tag="Swoo_0304"
FT   CDS             complement(372533..375205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0304"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   SMART: DEAD-like helicases; KEGG: gme:Gmet_0675 type III
FT                   restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84605"
FT                   /db_xref="GOA:B1KNA8"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA8"
FT                   /protein_id="ACA84605.1"
FT                   /translation="MFQLKSYQQGALDTLASFFKRCRETNNIETSFSESLKENNFTDVP
FT                   YRAYKFDNTPYVCVRIPTGGGKTILGTYAISTAAKEFLSKSYPITLWLVPTTTIQQQTV
FT                   AALKSNPAYTEHLNKAFANNVSVYDIADVNQIRSQDIGNKAIIVVSTLANLRVTKTTDR
FT                   KVYQYHEDFEPHFSKLTSANPAFDKLEKVTEDDVSENGLTVRDIGKVKYSFANLLALYN
FT                   PLVIVDEAHNARTPLTFDTLKRVYPAAIMEFTATPNTTGTNASNILYHVSAAQLKAEEM
FT                   IKLPIILTEHVNGWEEAVRDAVLTRERLAVKAQKDTDYIRPIVLLQAESKSGKVTVDVL
FT                   KQCLMEQHHIDESKIAIATGTQRELDGLDIFQPDCPVEFVITIEALKEGWDCSFAYVFC
FT                   SVKQVSSSKDAEQLLGRVLRMPYAKRRVIEDLNRAYAHLSTNSLAQAAKELADKLIAMG
FT                   FEELEVATFLRQQDASQGELFDSSGNKKPESKLSPTTLMVEVKDVVDSTLLTEEDRSSI
FT                   KVSEVEGRKVVTVTGKVSDTLKKALEKVAIEPKKSIERSIKMHNQSVYAAQSPSENGAK
FT                   FAVLPRLCVMSQGELELAEKEVFLDAFGWNLLDYPAVLDYKPTEDTTSFSVDLQGKKVK
FT                   YSFVDDTQTLNLNFANTDVTQDELVGWLDMECRQSDVTQREMTGFMSNVINHLMKKPEL
FT                   TLTTLIRNKYPLANAIQDLVSEYRKQAATKGYQQALFSNESEVLTTYDFSYEFKANNYP
FT                   ARPPYYSGSYDFNKHYYPQIEDMKSSGEEFDCAQIIDLMPEVKHWVRNLVRREEASFSL
FT                   PLAHGNFFPDFIVELNDGRILVVEYKGEAYKTNDDSAEKRLVGDLWAKHSQGNCLFLMA
FT                   VKKDDNGQGVRQQLLNIIS"
FT   gene            complement(375208..376740)
FT                   /locus_tag="Swoo_0305"
FT   CDS             complement(375208..376740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0305"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   pen:PSEEN0753 adenine specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84606"
FT                   /db_xref="GOA:B1KNA9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNA9"
FT                   /protein_id="ACA84606.1"
FT                   /translation="MPILNWLNKEQSVTAARDCPYRLLEQVPELSYGEANTDNMLIQGD
FT                   NLEALKALIPTHAGRVKCIFIDPPYNTKSAFEHYDDNLEHSHWLSMIYPRMELLHQLLA
FT                   DDGSIWITLDDNESHYMKVILDEIFGRKNFVANCIWQKLYTVKNSAKYLSDMHEHVLVY
FT                   SKNKQIWERNLLPRTEKSASNYSNADDDKRGAWTTNAIQARNYYSLGTYEIVSPSGRKH
FT                   VPPQGTFWRISEDSFKKLDSDNRIWWGKDGNNVPRVKKFLSEAKDGVVPATFWSYQDAG
FT                   SNADAKKEVREVFNELDEIFITPKPEKLIQRILNIASKEGDLVLDSFLGSGTTSAVSAK
FT                   MNRKFIGIELGEHAESLCVHRQKKVIDGEQGGISKDVAWQGGGGFNFYRLGEVIFNENG
FT                   SLKEGISFNALASHIWYGDTRNSLDQKEKSPLLGVHNGTAYYLLYNGILGDKRPDGGNV
FT                   LTSKVLAILPEHPLDAENGKKVIYGETSRMGSARLKSENIIFKQIPYDVRGR"
FT   gene            complement(377050..379182)
FT                   /locus_tag="Swoo_0306"
FT   CDS             complement(377050..379182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0306"
FT                   /product="AAA ATPase"
FT                   /note="KEGG: sbn:Sbal195_0587 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84607"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB0"
FT                   /protein_id="ACA84607.1"
FT                   /translation="MSKSRYLIRVTSVSGLNTHKDLVTIRGVPIESFRTQSAKKVVFAK
FT                   VAKNDLPILPEVGQHWKLTGTASEHYEIVNGFKYLAVKLDVSNAKVTLPDTGELFIDFV
FT                   SSCADFKGIGAVKARELWNKFGKGIYDLMKEQNPKSFESLLSPESIKALLDGWRKYDNL
FT                   KYQSWLSGLGIRPEISGKIVKYHKEGTINSIKENPYRMMTFGMSFKDSDALAQTKFNMS
FT                   LNDDRRLVAAVEQVLNQWIGKGHTFAYRDDIFSDVITLLQDKQAAILALKKGLDNGTFI
FT                   IADEGTYHPTGMLVIERIIAKRFKKLAKLEAWSFQHDDAYEQACSSSEFPLTERQGEAV
FT                   YNALNYSISAVFGGAGTGKTTVIRSVVAGFEALGFEIHQIALSGRAAKRMRESTGRPTK
FT                   TIAAFLRDEPVVTEKAAVIIDESSMVDANTMYQIITHTHDSVKFVLIGDPDQLPPIGAG
FT                   LVLHAIQDSKLVPKVTLDIVKRQDAESGIPGYSCDVKNGIVPERLSTGAVTFHEVPETE
FT                   INETIVGLYAEATNATQIIAATYKRENGGINALNHLEQTTLNNSSPELQFSLFNEDFIL
FT                   NLKVGDPILLTKNDIKLDIQNGTLGELTSVATTENGFGEITLDDNRIINLDEALLDHIQ
FT                   LAYAISLHKAQGSQFERIVIPIVPSKLLDRGWIYTAITRAEKEVHLIGNAKLFKRYIKE
FT                   PSKAHLRQIYLSKLLN"
FT   gene            complement(379179..379604)
FT                   /locus_tag="Swoo_0307"
FT   CDS             complement(379179..379604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_2918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84608"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB1"
FT                   /protein_id="ACA84608.1"
FT                   /translation="MANGIQLAQENVERFELWIASQTDSDFKQIVYRGRLNRAEVAKGA
FT                   GFAKSVLRQNPRIKHLLEELELNLRKRAVLPESIETKNQSKAYDQTENKSIREKQRLTS
FT                   LEQEMIALKAENTLLRRKLSRFEELSSVLADLGRLPS"
FT   gene            complement(379652..380128)
FT                   /locus_tag="Swoo_0308"
FT   CDS             complement(379652..380128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP2907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84609"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB2"
FT                   /protein_id="ACA84609.1"
FT                   /translation="MATSQEQWTQAFEILEHFERKLIEPKEFNWTYFKETTGVSKATLW
FT                   RNENFRSEHARISKLIKKYKEKNADYDLEQSILSVKDHEILELKKQIFELEKKLGRERE
FT                   RLAYAAIIARQSNIDPNRFMEESPLLKAQANAKKNEINTPKIDDKALDRFRKKQ"
FT   gene            complement(380132..382828)
FT                   /locus_tag="Swoo_0309"
FT   CDS             complement(380132..382828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP2908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84610"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB3"
FT                   /protein_id="ACA84610.1"
FT                   /translation="MSKLINLNDKRILTYVQNFERIELIGQKMFSDLSYFKSQNYSDEK
FT                   WQYKGKILFFSVNNKSKKNKKVFNPFVSRAIKCFLLNQLWKNRLKNEPLSYSRVQSFVR
FT                   VGVDLHNAGIDSIEKINTSTYSSIWNNISSSVGLINDFNLFIKFLDKEHVLPSNIDIIS
FT                   SKVVTSGLEFKALEQKMPKPELVQAIIELKNKVEAQCDYSEQGVSDLLCIYTQAFQYGL
FT                   GLRLGEILRLSKDCLFYHEGKLLCRVWTEKGCEPVPRYVLGDWKELILEVHTKIIEITK
FT                   NYRQYASQIDSGILAVIRERIQEYENARKLDADGLENELDLFFKAKEKEVKNSWKLKRK
FT                   PNPEVEYALDEVYDYLPVGSTAKSTPSLLKAYQAWGLEINATPIGKGRNTYSVTGQSLI
FT                   SFVKWQKSLRAENLTQQEFLSILHGRKITRQHGRDKDIFELTSELSGGSATCYTFAPDE
FT                   FKGKGRAPTTMSRRQASILLKKYAYGLLDEDEMDMTSFGRYFPELPFYYSNAKTKDIRI
FT                   ANPHLEFSDHKKISTRVSFEKNPDSPVRYSVTGGYAVKKASIEKYIYAKYFEINHAVLN
FT                   ELNDIDKAEQLDQIKKTDAIESSNQLPIEIKSRSFKTEQMVSEYLFLRAMRKTGMKGEI
FT                   SFVSYIPEILDYASVNYFFKGNDRYPTAFERFGVKASKEVVKEWQSHQGRHWRTTSLFR
FT                   SGANKSIVNKLMGRKDAQGKHYDHNTGTERAKVIRDAMSDNVNRFIGAIPNTVAELKRK
FT                   NAPQELINEVLNKELQTVSYTPEGMCTRSLELNPCEYHLRCMIGKTGNGCKHFIVDLDD
FT                   PSALEPIKTLRDQTIHEIERLVELRDNTGNIAINMHLEHNLKLLKNTESVLESASNLLG
FT                   NKESKELLPFKDKGSYPDDCPFQCGDK"
FT   gene            complement(382812..384551)
FT                   /locus_tag="Swoo_0310"
FT   CDS             complement(382812..384551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0310"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: vpa:VP2909
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84611"
FT                   /db_xref="GOA:B1KNB4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB4"
FT                   /protein_id="ACA84611.1"
FT                   /translation="MKDLAPNPIVLSEDSSSIPEHQRSVIGRLGNTIELAHNESYLKTV
FT                   KVLDTDGMVFTLNPSLFLTGDEEIDRVMRPFMIASIQQYMPKTLSVIEKQISVFTSTYR
FT                   NEQDINKAIQDTVLVAHEKGDDNISSLRRLLKWFIAYEVEGLDLDLCEKIHSLVFGGNK
FT                   NSYLALYSLDAENGPFIREELRILQAAALNPNIHIENRVVLKLCLEFGLRPIQIALLKQ
FT                   SDFIVDEELELAYLKIPRVKQKNRYRRTHFTKRLVSSELAELLSTLIAIHRTVYKELEI
FT                   EDAPLIMRRHIFFRVGNLANPYLVTDEVTDEVTDEVTDEVTDEVTDEVTDEVTDEVTDN
FT                   DKRIVNKNPYFEDFQKCNWEDITHHISSSQIDYRLDLISKLLPNSPRTGLPFQMNAYRF
FT                   RYTLGTNAVTQGMTEIEVAELLDHSASGSVKHYFHYTHEMFEILEDATLDRVENKFFTA
FT                   AWRKQELVGNIYGEDVVSPSTAISIGKCQKNAPCVLEPAVACYQCDKFCPNKNAEGHHQ
FT                   QLKSLQSRAKKAKLVSNREVAHQFDEAIAGCEAAIQYAEGLDVIAIQYESANDVGKLNV
FT                   KAD"
FT   gene            complement(384553..385779)
FT                   /locus_tag="Swoo_0311"
FT   CDS             complement(384553..385779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0311"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: vpa:VP2910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84612"
FT                   /db_xref="GOA:B1KNB5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB5"
FT                   /protein_id="ACA84612.1"
FT                   /translation="MNELSIKISPTAFKHLNGAHFPLLIINDELELNSAAYLLHRYNNG
FT                   TALKTVEREAKALRKFYLFCISNNIDFIGRFSKLERLTIGEIEHLHGVLSLREDTGELV
FT                   SQTYFLHNWSTILRYIEFLYSFYQSRINDPHRLSTSRIVLEGMRNSFGINAKTPHNGIQ
FT                   NERIGLTPELQVKFLAIIDPTNENTLNPYKSEKVRWRNFCFFMTLMMGGNRKGESLGLK
FT                   VRHFNLSGSSKSSKYFEIIKEDRTFDDYGRKEIPQVKTKGRKVELTPQLAEIFEYYITK
FT                   IRPLFKGAKKSEYMFISIRDGKPLSALTPNMSLNDLIVQYPEFKGKLSPHILRNTFHDI
FT                   LENVLDVEFEGVAPIRKQQNKATIQEYAGGWTAGSKMVSHYPKGSIQRKVADLQIRLQE
FT                   ALLSNNGEI"
FT   gene            complement(385999..387261)
FT                   /locus_tag="Swoo_0312"
FT   CDS             complement(385999..387261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0312"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sbn:Sbal195_4061 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84613"
FT                   /db_xref="GOA:B1KNB6"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB6"
FT                   /protein_id="ACA84613.1"
FT                   /translation="MATATASKKTNKKTAKAQPKVFTYEWKGLNRDGKKTSGELRGATI
FT                   AEVKSQLKSQGVNPKSVKKKAASLFKLGDPKVTAMDIAMVTRQIATMLQAGVPLVTTIE
FT                   MLGRGHEKVKMRELLGTILTEIQSGIPLSDALRPHRQYFDDLYVDLVAAGEHSGSLDAV
FT                   FERIALYKEKAEALKSKIKKAMFYPAAVVIVAIGVTTLLLLFVVPQFQEIFAGFGAELP
FT                   AFTQLVIHISEALQASWYIFAVAIIITVFLFRRAHLHSQTFRDKVDALILKIPAVGPIL
FT                   HKAAMARFARTLATTFAAGVPLIDGLESAAGASGNAVYRNALLKVRSEVMSGMQMNVAM
FT                   RTTGLFPDMLIQMVMIGEESGSLDNMLNKVANIYEMQVDDAVDGLSSLIEPIMMVVIGT
FT                   LVGGLIVAMYLPIFQMGKIVS"
FT   gene            complement(387315..389024)
FT                   /locus_tag="Swoo_0313"
FT   CDS             complement(387315..389024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0313"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II protein E domain protein; KEGG: sse:Ssed_0425
FT                   type IV-A pilus assembly ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84614"
FT                   /db_xref="GOA:B1KNB7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB7"
FT                   /protein_id="ACA84614.1"
FT                   /translation="MPTTGLHLGLSTLFIRKNLLTEEQIASSIAKSRQSKQSLVSTVIS
FT                   EKLISAREIAELCYEEYGTPLLDLDEFDIASIPEDFLNKKLIEKHKCLPLFKRGNRLYI
FT                   GTSDPTNIAALEDFQFSAGLHAEAILVEDDKLTKALEKVLEEDISALDIGGIDEDALAG
FT                   IEVEDTSKRDDDQNGESGDDAPIVIYINKILTDAIRKGASDLHFEPYEKRYRIRFRIDG
FT                   ILHEVSEPPVNLSGRISARLKVMSKLDIAERRVPQDGRIKMKLSRTKSIDFRVSTLPTI
FT                   WGEKIVMRILDSSSAQLGIEKLGYEDDQRELYEEMLSKPQGMILVTGPTGSGKTVSLYT
FT                   GLNILNTEERNISTAEDPVEINLEGVNQVHINLKAGLTFASALRSFLRQDPDVVMVGEI
FT                   RDLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRLINMGVPGYNIASSVNLIIAQRLAR
FT                   RLCPECKQPENVPEHELQKLGFPQTAIDKGITTYKPIGCDLCSGGYKGRVGIYEVMKMS
FT                   DEIARTIMEGGNSLQIANQAKTQGMRDLRGSGLLKVIQGVTSITEINRVTSF"
FT   gene            complement(389109..389552)
FT                   /locus_tag="Swoo_0314"
FT   CDS             complement(389109..389552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0314"
FT                   /product="General secretion pathway protein"
FT                   /note="KEGG: sdn:Sden_3388 methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84615"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB8"
FT                   /protein_id="ACA84615.1"
FT                   /translation="MKGIQLSKKLNKQAKGFTLIELMIVVAIIGILAAVALPAYRDYTG
FT                   SAHGGAAMKGLGAFTSKAVTCVQSGRACDSINGDTGQLAGSTAVTGLSATAEFAEGVGG
FT                   DIAFDEGSCAVTATINPNGTVTFAAASSGTGADDAQCQDGAGI"
FT   sig_peptide     complement(389442..389552)
FT                   /locus_tag="Swoo_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.831 at
FT                   residue 37"
FT   gene            complement(390393..391283)
FT                   /locus_tag="Swoo_0315"
FT   CDS             complement(390393..391283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0315"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: sse:Ssed_0427 nicotinate-nucleotide
FT                   diphosphorylase (carboxylating); TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase; PFAM: Quinolinate
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84616"
FT                   /db_xref="GOA:B1KNB9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNB9"
FT                   /protein_id="ACA84616.1"
FT                   /translation="MLENDIRLAVKVALEEDLGYQDESSSSSEQAQERASADITAQLIP
FT                   ADRHAQASLITREEGVFCGKAWAEQVFNQLGGEVALHWHVDDGDLLVPNQVLCEFSGPA
FT                   RAILTGERTAMNFIQTLSGVATLTKQYTDRIATTNTRLLDTRKTIPGLRTAQKYAVTCG
FT                   GGKNHRIGLFDAFLIKENHIMACGGIAQAISKARELQPDKLVEVEVESILELQQALEAG
FT                   SDIIMLDNFDVTMMIAAVELNKRLPDAQQAKLEVSGNVTLETIGDFAKTGVDYISVGAL
FT                   TKHVKALDLSLRLKS"
FT   gene            391549..392121
FT                   /locus_tag="Swoo_0316"
FT   CDS             391549..392121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0316"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: slo:Shew_3434 N-acetylmuramyl-L-alanine amidase,
FT                   negative regulator of AmpC, AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84617"
FT                   /db_xref="GOA:B1KNC0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC0"
FT                   /protein_id="ACA84617.1"
FT                   /translation="MVGQNPIKLNAGWVQSGVRECLSPHFNARPKGEVSLLVIHNISLP
FT                   AGCFGTPYVDQLFQGCLDLEADISFGELKGLEVSAHFMIRRDGEIVQYVSCDERAWHAG
FT                   VSEFQGRQGCNDFAIGIELEGTDLIAYSELQYQALLRLTLALFNAYPMLNMDRLVGHSD
FT                   IAPGRKTDPGDSFDWLKYRDGLTQALA"
FT   gene            392174..393028
FT                   /locus_tag="Swoo_0317"
FT   CDS             392174..393028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0317"
FT                   /product="signaling modulator of AmpD, AmpE"
FT                   /note="KEGG: sse:Ssed_0429 signaling modulator of AmpD,
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84618"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC1"
FT                   /protein_id="ACA84618.1"
FT                   /translation="MMALFSLLVAILVERLKFLPQSWQLDSILNLYSKTLFGNKQLSSD
FT                   VMMALALILPAIAVQVAMWAVNGIFWGLVSLTLWVAISILCFSHLKQRQLFKRYMQAAC
FT                   RGDSQACYHFADALDPNVSLDAVSEEELGAKVGQSAAWLNYRFYGAVALFLIILGPAGA
FT                   VFYCTVRYFSDQNQEEKLELPLVEDVLMVLDWLPSRIFAFGYVLSGQFSQAFACWMQYA
FT                   LNIRSSAREVVTQVAQAAEPQPETSATPICTQSTLSLLQLSKRNFILLLVCLSMLTIFG
FT                   VVA"
FT   gene            393416..394168
FT                   /locus_tag="Swoo_0318"
FT   CDS             393416..394168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0318"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: sse:Ssed_0430 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84619"
FT                   /db_xref="GOA:B1KNC2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC2"
FT                   /protein_id="ACA84619.1"
FT                   /translation="MAYSKINQPKISDVIMGQLEQMILEGSLQPGQKLPPERELALQFE
FT                   VSRPSLREAIQKLEAKGLLMRRQGGGTYVKEQLWQSLADPIVELMHSDSESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRTIMDVEAAKEIEQQAKAIVCFYRAVAEASHNVAM
FT                   LHLVLSLSPVLHKNVAQNLELLDRREEASTMANDHRRALLAAIVRRDPDAAREASNEHL
FT                   SYIEEVMLSVREEDSRLQRSLRRLKSGV"
FT   gene            394245..396908
FT                   /locus_tag="Swoo_0319"
FT   CDS             394245..396908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0319"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: spl:Spea_0419 2-oxo-acid
FT                   dehydrogenase E1 subunit, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84620"
FT                   /db_xref="GOA:B1KNC3"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC3"
FT                   /protein_id="ACA84620.1"
FT                   /translation="MSEHMLQDVDPLETNEWLSALESVVREEGVERAQYLLEQVLDKAR
FT                   LDGVDMATGITTNYINTIPTSQEPAYPGNTTLERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASFQSAASFYEVCFNHFFRAPNEVDGGDLVYYQGHISPGIYSRAFVEGRLTEEQLD
FT                   NFRQEVDGKGIPSYPHPKLMPEFWQFPTVSMGLGPMSAIYQARFLKYLDGRGLKDTSAQ
FT                   RVYAFLGDGEMDEPESRGAISFASREKLDNLCFLINCNLQRLDGPVMGNGKIIQELEGL
FT                   FRGAGWNVVKVIWGNNWDSLLAKDTTGKLLQLMNETIDGDYQTFKSKDGAYVREHFFGK
FT                   YPETAALVSDMTDAEIFALKRGGHESSKLFAAFKNAQDTKGKPTVILAKTVKGYGMGEA
FT                   AEGKNIAHGVKKMDMTHVLQLRNRLGLDDLLTDEKVSELPYLKLEEGSEEYNYLHARRN
FT                   GLHGYTPQRLPNFTQALDLPSVEEFGPLLTEQKREISTTMAFVRTLNILLKNKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPYGQEYTPEDRSVVSYYKEATSGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHVQANTIPNCISYDPTYAYELAVIMQDGIRRMYGENQENVFYYLTLM
FT                   NENYAMPAMPEGAEEGIRKGIYKLESYKGSNKVQLMSSGTIMNEVRKAAQILSEEYDVA
FT                   SDVYSVTSFNELTREGQDVERFNMLHPEAEQKQAYITQVMGTEPAIAATDYMKNYAEQV
FT                   RAFMPSETFKVLGTDGFGRSDSRENLRRHFEVNAGYVVVAALNELAKRGDIEKSVVAKA
FT                   IAKFNIDADKTNPLYA"
FT   gene            396922..398775
FT                   /locus_tag="Swoo_0320"
FT   CDS             396922..398775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0320"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: spl:Spea_0420 pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase; TIGRFAM: pyruvate
FT                   dehydrogenase complex dihydrolipoamide acetyltransferase;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   catalytic domain of components of various dehydrogenase
FT                   complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84621"
FT                   /db_xref="GOA:B1KNC4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC4"
FT                   /protein_id="ACA84621.1"
FT                   /translation="MTIEINVPDIGADEVEVTEILVSVGDKVEEEQSLISVEGDKAAME
FT                   VPASTAGVVKEIKVAVGDKVSTDSLIMIFESDAAPAAPVAAPAAPAAAELKEVHVPDIG
FT                   DDEVEVTEILVTVGDSISEEQSLLSVEGDKASMEVPAPFDGVLKEIKVAVGDKVSTGSL
FT                   VMVFEVAGSAAVAPAAASAPVAAPVAPAPSVQEVNVPDIGGDEVEVTEIMVQVGDTVTE
FT                   EQSLISVEGDKASMEVPAPFAGKVLEIKISQGDKVSTGSLIMTFEVAGSAPVAAPVATP
FT                   APVQAAPAPVAAPVANSAAPAKEDFVANEAYAHASPVIRRLARELGVNLANVKGTGRKN
FT                   RIIKEDVHNYVKAAVKLVESGNAGKGGNSELDLLPWPKVDFSKFGETEIKPLSRIQKIS
FT                   GANLHRNWVKIPHVTQWDDADITELEAFRKAQNAAEAKKDSGMKITPLVFIMKAVAKAL
FT                   EAFPTFNSSLSEDGASLVLKKYVNVGIAVDTPNGLVVPVFKDVNKKGIHELSDELKEVS
FT                   KKARGGKLTAADMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSDMKPVWNGKEF
FT                   EPRLMLPLSLSYDHRVIDGAEGARFITYLNNCLSDIRTLVL"
FT   gene            398956..400386
FT                   /locus_tag="Swoo_0321"
FT   CDS             398956..400386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0321"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; KEGG: spl:Spea_0421 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84622"
FT                   /db_xref="GOA:B1KNC5"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC5"
FT                   /protein_id="ACA84622.1"
FT                   /translation="MSNEIKTQVVVLGAGPAGYSAAFRAADLGLDTVIIERFSTLGGVC
FT                   LNVGCIPSKALLHVSKVIEEAKTISSHGVVFGEPQIDLDKLREYKKSVIGQLTGGLGGM
FT                   SKMRKVDVVNGLGKFTGPNTIEVAGEDGVKVVHFENAIIAAGSRPIQLPFIPHEDPRVW
FT                   DSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDVVRVF
FT                   TKKIKKKFNLMLETKVTAVEAKDDGIYVTMEGKKAPTEAVRYDAVLVAIGRVPNGKGLD
FT                   AEKAGVNVDERGFINVDKQMRTNVPHIYAIGDIVGQPMLAHKGVHEGHVAAEVISGLKH
FT                   FFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKETHRVIGGAIVGVNGGELLGEIGLAIEMDCDAEDLALTIHAHPTLHESVGLAAEI
FT                   YEGSITDLPNPKAKKKKK"
FT   gene            400531..404976
FT                   /locus_tag="Swoo_0322"
FT   CDS             400531..404976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0322"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: sse:Ssed_0434 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; Two
FT                   component regulator propeller; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84623"
FT                   /db_xref="GOA:B1KNC6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC6"
FT                   /protein_id="ACA84623.1"
FT                   /translation="MIKSIFQLILLITVILVTCLTPTKASDIVQRVFSERDGLVNGTIN
FT                   DISFDSYGFTWVATEEGLYRVSNSKVRRIDKKGFNTRLSDEYIDFVEPLSKRHLLISNY
FT                   TDTYLYDILQDSFIRFGSEELFPNFNGVALNTMTKGEGEDYLFLTKTGELLAFSYQNMT
FT                   LNLINSLPANQDHPWSILVVLDDKRFLVASPSQLQLRDQLGEFKMALDWQEDMGMIKGV
FT                   IQDSSKRLWLSSSDGFYEIMPDDFNLRKVPQLPFYITKVAEDRKGNLWLASREGLIKWH
FT                   PEHQEIKVYKGDIKQAANIDYIFDIAIDSNDITWVGGSGDALAVVAELPDFLKEVYTKA
FT                   PPYIVSNEMIWSIWAKNSGVWLGTDKGLVVINKESQISATVLPEELALNDSIYKVDELD
FT                   SSHVLLSTTNGLFVVHKETLESQRFSQWSQGDNSLENKLIFSSYLDPQIKGRWWFPTGS
FT                   GLFYWEPEQLNPQELLVFEEGGGQYKPDLRTVYRSEDGKLWIAGSELFGYIDDIGVFHS
FT                   MLSIFDGSNRSPTISYIEEVSPGILWLGSSLGLISYDYDKGLSESLTKKWQVDCSSVFF
FT                   LHESPPYRILGCLNSIIRVNMNTDELLVIEHEDGLISQELNDGASFYDSGAGLYLGTPD
FT                   GAMLVNVSEMRNRIKNDGIMLESVSVFYDKSTEISLIPEKNSIIKPGARMINFQLTSLD
FT                   YLDDRPLTLQYRIRLQGEQVDVNYLLLSDQSLVSVSGLKAGKYVLDILSLQNGIWSSEP
FT                   YSYHFEVDEFWWESSWFKSFFIVVLLLIVIIILIGRQRQISAFRVVNEALVESEDRLRQ
FT                   SLKGSDSELWEWRYDTQMFNLENQGAALTGSKNILLTLDDFPVHRDEKKGVLESWESML
FT                   NGDSDRFEVEYRYRREDKSWGWTRVRGRPVDFDPETGRITRVAGIYSDITTQRQLEDDV
FT                   KLLAQAFENTSEGVLILDAKERIKVSNKAAQIILGLDVEAFHSKTFSSLMVAKEGRLDE
FT                   VAKLLGRGDSWTGEREFICANGNNCPVWLNISTMLGGKGDIVHYVAVFSDITERKRSEA
FT                   ELRRLANYDVLTGLPNRSLFSTRLAQSIHRAEHSGEKLALIFLDLDRFKHVNDSFGHSM
FT                   GDALLVEAASRLQSCIHDGHTLCRFGGDEFVILLRDVSDIDMINHICTELLKQIETPFE
FT                   LYGREFFISTSIGVSLWPDDATQAENLIKNADQAMYHAKEEGKGNFQYYSSERNSEALY
FT                   HLHLEAELRRAIERDEFELHYQPQVDILKDDKLIGMEALLRWRHHQDGLIRTDIFIKVA
FT                   ESCGLIIDIDRWVLRQACIQGAQWASVYGESFKLSVNISAVHFRQPDFIEGVKAIIHET
FT                   QIPAKILNFEITEGVLMKELNIAKAHLKELKCLGIDVAIDDFGTGYSSLAYLRHFDVTT
FT                   LKIDRSFLIDIATNEADQAIASSIIELARNLKLSVVAEGVETKAQLEQVFSRGCYIIQG
FT                   YYFSKPLTQPEMERYMKSQN"
FT   sig_peptide     400531..400608
FT                   /locus_tag="Swoo_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.946 at
FT                   residue 26"
FT   gene            405095..407302
FT                   /locus_tag="Swoo_0323"
FT   CDS             405095..407302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0323"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; surface antigen variable number
FT                   repeat protein; KEGG: sse:Ssed_0435 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84624"
FT                   /db_xref="GOA:B1KNC7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC7"
FT                   /protein_id="ACA84624.1"
FT                   /translation="MIRSTALFLLLSLLSSSVFAEVRPKIGLVLSGGGAKGAAHIGVLK
FT                   VLEENRVPVDYIAGTSIGAYVAGMYALGYSAAEIEQIMMNESWSNGYSDTIPRESLSYR
FT                   NKQQRDRFNIPLNIGYSDETVKLPNGLLRGQTMSQLLQRSTGLVHQFGHFDELAIPYRA
FT                   VATDLETSNPVILSTGSIVKAMQASATVPGALQPIEYEGKLLVDGGIANNMPVDVVKAL
FT                   GADIVIAVDIGSSLVKKEALDSTVAVLNQLSTMLTNASTEKQKLLLTEDDILIRPDVGD
FT                   MSTTDFEIMPQAYALGEKAALEHLLSLKGLGVGEAEYVVYQDNKQRLSKRWQDSVERPL
FT                   VEIVFNNNSKVSESLLRETLDLHEGEVVTKEELERAIANVYSLDKFERVNAEFVDTDRG
FT                   RILTLNTRAKSWGPNYFGLGFSWEDDLTEDSSMSLDFSYTMTDLTDTGGEWRNELRLGF
FT                   EKLLSTEFYLPMDYDQAFYARAGLAYELKDFSIYEDNAKFVEFSQTVYRADVGVGYNYT
FT                   LEGLVELGVTNEKGEFEFLKDTYDYDSYGIYLKLGFDNLNSMNFPTSGNRFTFNMYYRR
FT                   DVNELSGEDSYAENSLQIEADWRGALSLGNHAIVGIASLATIDTEEQFSPHLSELGGFL
FT                   NLSGYHKNSLVGSHKIFGAFVYQYDLGRDVLGMTDYPLYLGGSLEAGNVWQNKDNIDLN
FT                   DLIYSGSLFFGTDTSMGPAALGFGWADDGEMTLFLFLGKSW"
FT   sig_peptide     405095..405157
FT                   /locus_tag="Swoo_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            407396..409450
FT                   /locus_tag="Swoo_0324"
FT   CDS             407396..409450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0324"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13 neprilysin; peptidase M13; KEGG:
FT                   sse:Ssed_0436 endothelin-converting enzyme 1"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84625"
FT                   /db_xref="GOA:B1KNC8"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B1KNC8"
FT                   /protein_id="ACA84625.1"
FT                   /translation="MKRVSKLAIGIALSLGLAACSSNEPSAPEVQSKSMVSGVEKANFD
FT                   TSVRHQDDFYYSVNGHWLANTPIPDDKSNYGAFSVLYERSQKALKQIIDDAASKPNKLD
FT                   GSSEQKVGDFYNSYMNTDIVERLGIAPLSEQLSDISLAKDHDDIASLMGGLLLNGVQIP
FT                   FGFYVNNDAKKSTQYAVYLYQSGLSLPDRDYYLKDDAKFVANRAALNTYVTDIMTQAGS
FT                   KDAKRIAASVAKIEHFIAKSQWSRVESRDANKSYNKMNRAELQASMPEFDFVQFAASAD
FT                   IGKVKEVIVRQKSYFEEFGRHFTGFTVTEWQDYLSFHLVDSYAELLSQNFVDLHFNFHS
FT                   KTLMGIEAQKPRWKRAVDAADQVLGELVGKEYVKEHFKPEAKEKMESLIQDLIKGFEVS
FT                   INELEWMTPETKVAAQEKLSKFTYKIGYPDKWRDYTDLQIKPDELVGNYQRYAKFEYNT
FT                   MLDKLGKPIDRTEWHMTPQTVNAYYNPVMNEIVFPAAILQPPFFNLEADDAINFGGIGA
FT                   VIGHEISHGFDDQGAKYDGDGNLRNWWTDADREEFQKRGAQLSAQYSKYEALPGKHVNG
FT                   DLTLGENIGDLGGLTVAARSYHLSLDGQEAPVIDGLTGEQRLFIGWSQVWRRNYRDEEL
FT                   SRRLMTDSHSPSHFRAMGTPRNIPAFYQAFDLKEGDKMFLAPEDRVKIW"
FT   sig_peptide     407396..407461
FT                   /locus_tag="Swoo_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.456 at
FT                   residue 22"
FT   gene            410208..411743
FT                   /locus_tag="Swoo_R0010"
FT   rRNA            410208..411743
FT                   /locus_tag="Swoo_R0010"
FT                   /product="16S ribosomal RNA"
FT   gene            412056..414950
FT                   /locus_tag="Swoo_R0011"
FT   rRNA            412056..414950
FT                   /locus_tag="Swoo_R0011"
FT                   /product="23S ribosomal RNA"
FT   gene            415068..415182
FT                   /locus_tag="Swoo_R0012"
FT   rRNA            415068..415182
FT                   /locus_tag="Swoo_R0012"
FT                   /product="5S ribosomal RNA"
FT   gene            416278..417552
FT                   /locus_tag="Swoo_0325"
FT   CDS             416278..417552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0325"
FT                   /product="competence/damage-inducible protein CinA"
FT                   /note="TIGRFAM: competence/damage-inducible protein CinA;
FT                   PFAM: molybdopterin binding domain; CinA domain protein;
FT                   KEGG: sse:Ssed_4280 competence/damage-inducible protein
FT                   CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84626"
FT                   /db_xref="GOA:B1KNC9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR020817"
FT                   /protein_id="ACA84626.1"
FT                   /translation="MKLEMICTGEEVLAGQIVDTNAAWFANTLIERGVECQRRITVGDR
FT                   LEDLVAVFKERSTEADVIMVNGGLGPTSDDLSTEAMALALGVPLVENKEWRSKLEAWFA
FT                   KNARVMAESNLKQALLPQGAIMIDNPVGTACGFAIKLNQAWLFFTPGVPFEFKRMVKEQ
FT                   FIPFIEEHFPLSEPVSVKKLLTLGHGESALADKLEVIPLPKGVTLGYRSYMPYIEIKLF
FT                   ARGQLAIDSLATIETEVKKILGHSVVAEDITTLDQEIHNSLVNSGFSLSVAESCTGGLI
FT                   ASGLVAFAGSSAYLHQGLVTYSNEAKVKVLGVNPQTLDDYGAVSIATVEEMAKGARGIL
FT                   DSDYALATSGIAGPDGGSDEKPVGTVAIALATKYGVYSQMLKLPSRSRALVRSLGTAIA
FT                   YDMLRRELLGEAVIVDYSSFSRFSK"
FT   gene            complement(417645..418187)
FT                   /locus_tag="Swoo_0326"
FT   CDS             complement(417645..418187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0326"
FT                   /product="protein of unknown function DUF1439"
FT                   /note="PFAM: protein of unknown function DUF1439; KEGG:
FT                   sse:Ssed_4279 protein of unknown function DUF1439"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84627"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:B1KND0"
FT                   /protein_id="ACA84627.1"
FT                   /translation="MKLLSYIMPLTLLLLSGCVSQYSITEKELEGYLSDEIHFEIKEGN
FT                   QLFGIEMRINNIDVSLGHKVDTMSVTADSIVKVRNPLVPFKAKMKTTFEAEPWYDADSH
FT                   SVYLKQLRLVSIESNPKDIEKAVKQVAPQMMGFLTHFLETQPVYILDTSESNQALIAEM
FT                   TKRIEVKPGKLKLIFDE"
FT   sig_peptide     complement(418122..418187)
FT                   /locus_tag="Swoo_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.426 at
FT                   residue 22"
FT   gene            complement(418187..420823)
FT                   /locus_tag="Swoo_0327"
FT   CDS             complement(418187..420823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0327"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   sse:Ssed_4278 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84628"
FT                   /db_xref="GOA:B1KND1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/TrEMBL:B1KND1"
FT                   /protein_id="ACA84628.1"
FT                   /translation="MTDMYASLRSNVGTLGQILGETIRTNLDDPFLDKIEQIRQLAKSS
FT                   RQGDEASREEMLKLLAALPDDELVPFAKAFNQFLNLANIAEQFHTISRNCDELVCVPDP
FT                   VEQLLGRVLSSNIEQDKMLDCLQNLDIDLVLTAHPTEISRRTLIQKYASVVDSLAALEN
FT                   PLLTEREKKQQHLRLRQLIAQIWHTNEIRHERPTPVDEARWGLSTIEVSLWQAIPDFLR
FT                   QLNEQVEERTGKQLPIDIAPVRFSSWMGGDRDGNPFVTAQVTQEVLDRNRHTAARLYLK
FT                   DVVLLVNDLSMEEANDELLALTNNSHEPYRDVLRGIRQKLRNTIDYLNERLEGHQPEVD
FT                   KNSIIWNEDDLKAPLMMLYKSLSDSGMSLIANGLLLDMLRRIACFGIHMLRLDIRQDAQ
FT                   RHCDVVAELTRYLGMGDFNHWDENEKQAFLLRELSSKRPLIPSNWQPSEDVAEVVSTCR
FT                   LIATQPARALGSYVISMASKPSDVLTVLLLLKETGCPHPMRVVPLFETLDDLNNASSCM
FT                   SALFAIDWYRGYTKGHQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVEVSRQADVKLTL
FT                   FHGRGGTIGRGGGPAHEAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTS
FT                   AVMEATLLPPPAPKPEWRACMQRLAEESVAAYRSIVREEPDFVAYFRAATPEVELGKLP
FT                   LGSRPAKRRVDGGIESLRAIPWIFAWSQNRLMLPAWLGAGEALQAASDRGEMELLQEME
FT                   QKWPFFKTRISMLEMVYAKAEPNLAKYYETCLVPENLHHLGDALRGRLATGVKAVLALT
FT                   QSQALMEHTPWNRESVTLRNPYIDPLNFMQAELLARTRKDEVQSTNVELALMLTIAGVA
FT                   AGMRNTG"
FT   gene            complement(420967..422118)
FT                   /locus_tag="Swoo_0328"
FT   CDS             complement(420967..422118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0328"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   sse:Ssed_4277 acetylornithine deacetylase (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84629"
FT                   /db_xref="GOA:B1KND2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:B1KND2"
FT                   /protein_id="ACA84629.1"
FT                   /translation="MASLADLKSNFSQLIASPSISALEVEQDMSNQGVIDLLQTWFSEL
FT                   GFECKAQAVKDSRSKHNLVASLGSGKGGLLLAGHTDTVPFDEGRWSQDPFTLTEKDNRW
FT                   YGLGTCDMKGFFALVLEALKDMPLAQFKRPLHILASADEETTMNGAKAFAQQKSIAPDY
FT                   AIIGEPTSLKPVYMHKGHLTQGIRVIGKSGHSSDPAKGVNAIEIMHLVMGQLLKLKQHL
FT                   ADNYREEAFSVPYPTMNFGHVHGGDAANRICGCCDLHIDIRPLPGLELEILEQMVMNYL
FT                   KPINDQYPGCINVAPLYPGSEPFADSRENSWSKLVAELSANAPEVVNYATEAPYISKLG
FT                   CQTLVLGPGSIEQAHQPDEYLDTQYLNKTVELLKQLIYHACIK"
FT   gene            422392..423372
FT                   /locus_tag="Swoo_0329"
FT   CDS             422392..423372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0329"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: sse:Ssed_4276
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84630"
FT                   /db_xref="GOA:B1KND3"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /protein_id="ACA84630.1"
FT                   /translation="MKSIAIIGASGYTGAQITSLIDADKNLVIQGLYVSENSVDKGKPL
FT                   SELYPTYSHISLPLSPLSDEAKALIAEQADGVVLATDHAVSLHLAAWFFEQGLTVFDLS
FT                   GAYRFSDKSQYPQWYGFEHDYPQVLSHAVYGLAEWNGADIADSKMIAVPGCYPTASLTA
FT                   LKPIHSLMTSSLPVINAVSGVTGAGRKAQLNTSFCEVSLTPYGVLGHRHQPEIATQLGQ
FT                   EVIFTPHLGNFKRGILATITVQLKEGVTQADIEQAYAIYDNAPLVTVKQNQFPKVDDVT
FT                   NTPNCHLGWKFDPKTGYLVVASAIDNLMKGAASQAHQCIKIHFKY"
FT   gene            423395..424180
FT                   /locus_tag="Swoo_0330"
FT   CDS             423395..424180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0330"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: sse:Ssed_4275
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84631"
FT                   /db_xref="GOA:B1KND4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="UniProtKB/TrEMBL:B1KND4"
FT                   /protein_id="ACA84631.1"
FT                   /translation="MTQSNKALVIKVGGALLQCEMGMARLMDTAAKMLAAGQKLILVHG
FT                   GGCLVDEQLSANGMKTEKLDGLRVTPAEQIPVIVGALAGTSNKVLQAAAIKAGVTSIGM
FT                   SLGDGDMVTAQVKDERLGFVGEVAPKSSAYLDFILSQGWLPIVSSIAIDEAGQLLNVNA
FT                   DQAATVLAKLVDAKLVLLSDVSGVLDGKGQLILSLNRAQVDDLTHKGVIEKGMKVKVEA
FT                   ALDVAELMGQAVQVASWRSAEQLLALSNGESVGTQIQPH"
FT   gene            424269..425177
FT                   /locus_tag="Swoo_0331"
FT   CDS             424269..425177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0331"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: sse:Ssed_4274 ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84632"
FT                   /db_xref="GOA:B1KND5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="UniProtKB/TrEMBL:B1KND5"
FT                   /protein_id="ACA84632.1"
FT                   /translation="MDHLLSIKDLSQEQLKELLSLAKKIKANPAEYRHALDGKSVVMLF
FT                   EKPSLRTRVSFDIGINKLGGHCLYLDQQNGALGKREPVSDFAANISCWADAIVARTFLH
FT                   STIETLAEHGSVPVINALSDLYHPCQGLADFLTLSEQFDDVSQVKLAYVGDGNNVTHSL
FT                   MYGAAILGATMTVVCPPGHFPDGQVVVEAQALAAKYGGKLILTSDVEQLAEQDAIYTDT
FT                   WISMGDDTDLSEIKAKFQPYQVNEAMMKQAGASYFMHCLPAYREVEVTAEVVDGEGSLI
FT                   LQQAENRMHAQNAVLVTLLGQ"
FT   gene            425242..426468
FT                   /locus_tag="Swoo_0332"
FT   CDS             425242..426468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0332"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   sse:Ssed_4273 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84633"
FT                   /db_xref="GOA:B1KND6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /protein_id="ACA84633.1"
FT                   /translation="MSAEIKKTGVKKVVLAYSGGLDTSAIIPWLKETYDDCEIVAFCAD
FT                   VGQGEAELEGLHEKAIASGASECYIVDLKEELVADYIYPTIATGAIYEGTYLLGTSMAR
FT                   PIIAKAQVEVARKVGADAVCHGCTGKGNDQVRFEGCFAALAPDLKVIAPWREWEMVSRE
FT                   DLLDYLAERNIETTASATKIYSRDANAWHISHEGGELEDPWNEPTKGVWTMTVAPEDAP
FT                   DKPEYVTIDIEQGKITKVNGELLSPYAALMVLNEIAGAHGVGRIDITENRLVGMKSRGC
FT                   YETPGGTVMFAALRAIEELVLDKSSREWREQVGAQMAHLVYDGRWFTPLCESLLGASQP
FT                   LANLVNGEVVIKLYKGQAQAVQKRSPNSLYSEEFATFGEDDVYNQKDAEGFIRLYSLAS
FT                   RIRALNSKS"
FT   gene            426553..427923
FT                   /locus_tag="Swoo_0333"
FT   CDS             426553..427923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0333"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: sse:Ssed_4272 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84634"
FT                   /db_xref="GOA:B1KP64"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /protein_id="ACA84634.1"
FT                   /translation="MALWGGRFSQESSALFKLFNDSLPVDYRLVEQDIVGSIAWAAAIT
FT                   QVGILSQDECEKLQQALKELLSEVEGNPELILASGAEDIHSFVEQSLIAKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKKEGQQQLVLLAKLREALLALAERELDAVMPGYTHLQRAQPV
FT                   AFGHWCLAYVEMFERDISRLEDALKRADTCPLGTGALAGTAYPMDRYKLAESLGFASPT
FT                   LNSLDTVSDRDHVVEICSDASISMMHLSRMAEDLIFFNSGEAGFIDLDDEVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVYGSLIGILTTMKALPLAYNKDMQEDKEGLFDVMDSWSICLE
FT                   MAALVLSGLKVNRENTLKAAQQGYANSTELADYLVAKGMPFREAHHVVGEVVVHAISEQ
FT                   KPLEDFALEQLQSFASIIEQDVYDCLTIESCLAKREALGGTALPQVQSALAAKKVKK"
FT   gene            complement(428073..430616)
FT                   /locus_tag="Swoo_0334"
FT   CDS             complement(428073..430616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0334"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: sse:Ssed_4271 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein,
FT                   1A family; PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84635"
FT                   /db_xref="GOA:B1KP65"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011816"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP65"
FT                   /protein_id="ACA84635.1"
FT                   /translation="MKWFKRIIIALFSLALLGIAAIAAAYFYVLPELPDVNTLKTVKLQ
FT                   TPLRVYSSDGKLISQFGEKRRIPVAFDDVPPQLINAVLDTEDARFFEHHGIDPIGITRA
FT                   AFILLTTGKKSQGASTITQQVARGFFLTREKTYIRKIKEIFLAIKIEKALSKEEILELY
FT                   LNRSFLGNRAYGVGAAAQVYYGKELEQLTLPEMAMIAGLPQAPSAANPIRNPERATNRR
FT                   NWVLSRMLEKNNITQAQYAAATQAPVTAKYHGAEINLYAPYISEMARDYLVDKSGEEEA
FT                   YTGGYNIYTSIDSRLQIYAQEALRDNVYAYDERHGYRGRTKVLWTDTPLDTDSIIARLK
FT                   KTNAFQGMVPAAVLSVDELSAQVLTSEGEEIKIEWPGLNWARKFITNKRQGKAPKTATQ
FT                   ILTPGEQVWVRNNGEFWQLSQIPKVSSAIVSLDPHDGAIRTLVGGFSFHTSQYNRVTQA
FT                   KRQLGSNIKPFIYTAAMEKGYTLATLINNAPINKPDTRQGTAWRPKNSPDRYTGPTRLK
FT                   MGLAQSINVMAVRAIRYASLDTAIETLIRFGFDPADLPKNESVALGSPSVTPLQVVTAF
FT                   SVFANGGYKVEPYFIERIEDAYGDVIEKSNPTLACTPTPAAIIEETSEVDPFASMADEL
FT                   QAEPATPQPISLCGNSDSRYAPQIISEQTAFLITDALKSVIWGGGNWSKGTGWNGTAWR
FT                   ASRVVKRHDIAGKTGTTNESRDTWFSGFNPSLATTVWVGFDDHSQELGRTSWNANGAKD
FT                   QISAAEAGAKTAGPAWNEFMKNALAGQPEVPSSPPDGIVSVRIDLATGKLSRKTDHTSK
FT                   FEYFISGTEPTEFAPQAEEESNDIFIDESPEDLFQ"
FT   sig_peptide     complement(430545..430616)
FT                   /locus_tag="Swoo_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.508 at
FT                   residue 24"
FT   gene            430802..431881
FT                   /locus_tag="Swoo_0335"
FT   CDS             430802..431881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0335"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   sse:Ssed_4270 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84636"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP66"
FT                   /protein_id="ACA84636.1"
FT                   /translation="MLSNLWKRQAPQMVGIDVGSHEIKAILLSKTADGYKILSHAAVPL
FT                   KKGAVNDHEIRDADAVVESLKQVKRILPKGAKLAAVAVSGSAVMTKVIYMDASLSEEEM
FT                   EAQIEIEADNLIPYSLDEVSIDFETLNVNSTDPTKVDVLLSACRTENIDARVDSLDEVN
FT                   IEVKVVDVEGYALGRSYEVVAAQLPEGTENKIVALVDIGANITTFAVVENGQTSFIREQ
FT                   AFGGEQFTQSILSFYGMSHEQAEKAKLEGDLPRNYMFEVLSPFQTQLLQQIKRTLQIYC
FT                   TSSGKDKVDHIILCGGTSKLEGMANLLTNELGVHTIIADPFQGCLHADEDIKNSLKPDI
FT                   SKYMVACGLALRSYSQWRT"
FT   gene            431869..432450
FT                   /locus_tag="Swoo_0336"
FT   CDS             431869..432450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0336"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   sse:Ssed_4269 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84637"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP67"
FT                   /protein_id="ACA84637.1"
FT                   /translation="MANINLLPWREEAREKQKKDYIGILALVFLLSSFIVYLSLSFVEM
FT                   MTDNQKARNAYLTSEIQLLEKQIAEIKKIRTRKKDIERRTEIILNLQQARNLPTHVLDE
FT                   LVRIVPPGIYLSSIEKKGSLLWIQGRSESNNNVANMMRKVKTSQWLQDPSMQSIVAQNE
FT                   ELRQLQSFSLKVTIQQVEEVTSQAAKGASR"
FT   gene            432447..433064
FT                   /locus_tag="Swoo_0337"
FT   CDS             432447..433064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0337"
FT                   /product="Pilus assembly protein PilO"
FT                   /note="PFAM: Pilus assembly protein PilO; KEGG:
FT                   sse:Ssed_4268 pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84638"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR023218"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP68"
FT                   /protein_id="ACA84638.1"
FT                   /translation="MNLDLNQFNDIDFENVGAWPPLVKIVFAAILSICIFVASYFLFVS
FT                   DAVAQLDKEQRTELQLREDFKSKYQLAANLKLYREQLAVMESQFAELLKMLPSKNEMPG
FT                   LLDDLTFVATDSGLKIDSLDWREVIQRDFYIEFPISMSVTGEYHELGQLVSGVARLPRI
FT                   VSLHDFVIKKSDTGGLGMEIMAKTYRFKEGSELPDKAKKGKK"
FT   gene            433064..433579
FT                   /locus_tag="Swoo_0338"
FT   CDS             433064..433579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0338"
FT                   /product="Pilus assembly protein PilP"
FT                   /note="PFAM: Pilus assembly protein PilP; KEGG:
FT                   sse:Ssed_4267 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84639"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP69"
FT                   /protein_id="ACA84639.1"
FT                   /translation="MKQLLLIIFVFSLVGCVGDRSDLELFVTTTKAQHVAHIPPLKEAP
FT                   KFEHFAYQADLMRSPFVPPSRELTEEVIDTTKDCLQPDLKRRKGRLETYALDNLKMRGT
FT                   LSEVEKIWALVESNDGSVYRLGLGEYLGLYNGRIAKVTPQKVEIIELIPDGSGCWTERV
FT                   SNMELTGE"
FT   gene            433601..435649
FT                   /locus_tag="Swoo_0339"
FT   CDS             433601..435649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0339"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain; KEGG: sse:Ssed_4266 type IV
FT                   pilus secretin PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84640"
FT                   /db_xref="GOA:B1KP70"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP70"
FT                   /protein_id="ACA84640.1"
FT                   /translation="MGSSAATNTVLSVPSLSRLVGCLALFIIGISNAAASNRLVDVKYH
FT                   AVVDHQLELQLVFEDEVDKPEIELNAEPAQIILLFKESISGLEKDKLPIKTVGVESVSI
FT                   NQTNGAMRLVVDLDKVKAYKGKLSGNTYNITINDEVAERDDSSENPFVNSIQNIDFRRT
FT                   AEGGGELIVKLNNNRVAANVEQVGAKLELKLYNTEIGSDFLYVMDVQDFATPVRSFETF
FT                   KEELTSRVLIDISGEYEYNYRQEEDLFKLSINKAERIVVAKEEEKYDGKSLSLNFQSIS
FT                   VRTVLQIIADYNNFNLVTSDTVEGDITLRLDDVPWDQALDLILQTKGLDKRIEGNILMV
FT                   APREELAIRESQMLKDMQEVKELSPLYSEYIQINYAKSADIAELLKSTDSSLLSSRGSV
FT                   AVDERTNTLLIKDTEEIIENIHRLIKILDIPIRQVLIEARMVTVKDDVSEDLGIKWGIS
FT                   DKQGSKGTSGSIGGAQDIANGIIPSVNDRLNVNFPAPEAAASIAFHVAKLADGTILDME
FT                   LSALEQENKGEIIASPRITTSNQKAAYIEQGVEIPYVEASSSGAATVSFKKAVLSLRVT
FT                   PQITPDNRVILDLEISQDSQGKVVATPLGEVVSIDTQRIGTQVLVDHGETIVLGGIYQQ
FT                   NLISRVSKVPVLGDIPFVGFLFRSTSDKNERQELLIFVTPKIISEEI"
FT   sig_peptide     433601..433702
FT                   /locus_tag="Swoo_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.663 at
FT                   residue 34"
FT   gene            435868..436383
FT                   /locus_tag="Swoo_0340"
FT   CDS             435868..436383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0340"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: sse:Ssed_4265
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84641"
FT                   /db_xref="GOA:B1KP71"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="ACA84641.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLEFHDSDQEIESRTGA
FT                   DIAWVFDVEGEEGFRIRETQVVADLTEKQGIVLATGGGSIQSKEIRNNLSARGIVVYLE
FT                   TTIDKQVARTQRDKRRPLLQVEDPREVLENLAATRNPLYEEIADVIVKTDEQSAKVVAN
FT                   QIIEQLGF"
FT   gene            436392..437468
FT                   /locus_tag="Swoo_0341"
FT   CDS             436392..437468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0341"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG: sse:Ssed_4264
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84642"
FT                   /db_xref="GOA:B1KP72"
FT                   /db_xref="InterPro:IPR016037"
FT                   /protein_id="ACA84642.1"
FT                   /translation="MKQIQVDLGVRSYPIVIGRNLMSCGEHFARFLQDKKILIVTNETV
FT                   APLYLEKLELQLSSFDCVEPVILPDGEQYKTLAQMDSIFTSLLQQNSGRDTVLIALGGG
FT                   VIGDMTGFAAASYQRGIDFIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGAFYQPKLVV
FT                   IDTDCLSTLPAKEFSAGMAEVIKYGIIWDSEFFSWLENNVERLKTLDDEALAYAIGRCC
FT                   EIKADVVAEDETEQGVRALLNLGHTFGHAIEAEMGYGVWLHGEAVAAGTVLAASTASRM
FT                   GLIDGSIVCRITKLFEAFDLPVSPPDSMNFEQFIKHMRRDKKVLKGQVRLVLPEAMGQA
FT                   GVYSEVSDELLEDVIRCA"
FT   gene            437485..438879
FT                   /locus_tag="Swoo_0342"
FT   CDS             437485..438879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0342"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   sse:Ssed_4263 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84643"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP73"
FT                   /protein_id="ACA84643.1"
FT                   /translation="MTFKDSILLPSQENLLQRLQHVSLYGQQLLVVTGQNGSGKTRLIT
FT                   SLINELDDFSSALVLCPKHCDNSEIRRKILVQLLTDPVFDDETPLAETLLRFADSLPQS
FT                   CFIVLDDAHHLSIELIAECIVLSQLSIAGKSISITLTSTEEFFYHLVEQLPETQQDNLL
FT                   SINIEPLTAQEKEALYYTLLSRSEQAPFTPREIVRAQLEKQSGTPQEVVNLLELALHGK
FT                   EVEVPKSAKYKWIISIALLLLLSLGAYLLLPKEARDEKISSPAKLVLDSSSEMNWLANY
FT                   GKNLLEADFSAEKKEGKAELISSNTASVDSTLTQQAASTEPQSEPHKGKMVDESTSLVN
FT                   HDEVEVFKGLGEIKSSQLPHKVNVEPKIEPIALKGYTLQLASVKKQESLDNLLKRFSGE
FT                   SDVKVARYGEFWVVLLGEFSDINLARIKSKQMVNKYQLTTPWIRQWKDLSGYKVQDSIP
FT                   ARDIPL"
FT   gene            438929..439768
FT                   /locus_tag="Swoo_0343"
FT   CDS             438929..439768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0343"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: sse:Ssed_4262 site-specific
FT                   DNA-methyltransferase (adenine-specific); TIGRFAM: DNA
FT                   adenine methylase; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84644"
FT                   /db_xref="GOA:B1KP74"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP74"
FT                   /protein_id="ACA84644.1"
FT                   /translation="MSKKQRAFLKWAGGKFKLIEALTEHLPEGQRLVEPFVGAGSVFLN
FT                   TDYPSYLLCDINKDLINLYKIIQKEPEKYIAAAKAMFVPEMNEKEAYYRVRAEFNLSTD
FT                   PFLRSVYFLYMNRHGFNGLCRYNRKGGFNVPFGSYKKPYFPENEIRAFSEKAQKAEFKC
FT                   IGYEDAFELTTSGDVVYCDPPYAPLSTTASFTTYVGTGFSLDDQALLARKSRHTAIDNG
FT                   IPVLISNHDIPLTRELYHGARFDTIQVQRNISQKGSARKKVDELMALYDDRYHSEND"
FT   gene            complement(439781..439966)
FT                   /locus_tag="Swoo_0344"
FT   CDS             complement(439781..439966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_0242 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84645"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP75"
FT                   /protein_id="ACA84645.1"
FT                   /translation="MLFKAWQLFSSTLAAFLGVQSDKNRLRDFQTSSPIPFIIMGIILA
FT                   AIFVITLLLIVNQVLA"
FT   gene            complement(439966..440319)
FT                   /locus_tag="Swoo_0345"
FT   CDS             complement(439966..440319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84646"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP76"
FT                   /protein_id="ACA84646.1"
FT                   /translation="MKSSKKLIVGAKPAAFLATSAIFIALTAVGAQNLSSSDSESACVC
FT                   SKESTTSYNSSLPTSHPGNRCARQSQELNWANWFSGNSRSNQLHFVDLLELLHGHQDSP
FT                   VDEVSLSNQKNKL"
FT   sig_peptide     complement(440227..440319)
FT                   /locus_tag="Swoo_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.754 at
FT                   residue 31"
FT   gene            440529..441203
FT                   /locus_tag="Swoo_0346"
FT   CDS             440529..441203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0346"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   sse:Ssed_4259 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84647"
FT                   /db_xref="GOA:B1KP77"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP77"
FT                   /protein_id="ACA84647.1"
FT                   /translation="MRPFLIAPSILSADFARLGEDVDAVLNAGADVVHFDVMDNHYVPN
FT                   LTIGPMVCQALRDYGVTADIDVHLMVKPVDRIIPDFAKAGASIITFHPEASEHLDRSLQ
FT                   LIKESGCKAGLVFNPATPLHYLDHVMDKLDVILLMSVNPGFGGQSFIPSTLDKLRQVRK
FT                   LIDDSGYDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFNKPDYKAVIDEMRSELASI
FT                   ES"
FT   gene            441207..441914
FT                   /locus_tag="Swoo_0347"
FT   CDS             441207..441914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0347"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   sse:Ssed_4258 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84648"
FT                   /db_xref="GOA:B1KP78"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP78"
FT                   /protein_id="ACA84648.1"
FT                   /translation="MASWDKLKAIAFDLDGTLIDSAPDLAAATQATLTELKLPSCSEEQ
FT                   VRSWIGNGAKVLMQRALTHSLDRPVEADMLEDTMPLFMKHYQENLEQHSQLYPGVLEVL
FT                   NELTSLGYSMAVVTNKPYRFAIPLLKAFKIEHHFTKVLGGDSLEKMKPDPLPLTHLLDK
FT                   WKLKPEALLMVGDSKNDILAAKAAGISSIGLTYGYNYGEDIGLSCPDAVCVQFSEILKF
FT                   VNNSVKVMEHESV"
FT   gene            441911..442918
FT                   /locus_tag="Swoo_0348"
FT   CDS             441911..442918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0348"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: sse:Ssed_4257 tryptophan--tRNA ligase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84649"
FT                   /db_xref="GOA:B1KP79"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP79"
FT                   /protein_id="ACA84649.1"
FT                   /translation="MTNPVKPIVLSGAQPSGELTIGNYMGALRQWVAMQDSHDCLYCVV
FT                   DLHAITVRQDPKLLREACLDTLALYLACGVDPKKSTVFIQSQVPQHTQLGWALNCYTQM
FT                   GELNRMTQFKDKSQKHANNINVGLFGYPVLMAADILLYQANEIPVGQDQKQHLELTRDI
FT                   ATRFNNAYGDTFTIPEPFIPEHGAKVMSLQDPLKKMSKSDDNRNNVIGLLEDPKKIMKK
FT                   IKKAMTDSDEPPVVRFDTENKPGVSNLLSLMSGVSGKSIAGLEAEFEGKMYGHLKVAAG
FT                   EAVVEMIEPLQARYREFREDQTFLNQVMSDGAEKAQTRAEVTVKKVYEKIGLLV"
FT   gene            complement(443065..443634)
FT                   /locus_tag="Swoo_0349"
FT   CDS             complement(443065..443634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0349"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   sse:Ssed_4254 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84650"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP80"
FT                   /protein_id="ACA84650.1"
FT                   /translation="MIKTLSLIAVIFMLQGCAGAVMVGAVGGAMMVNDERSFSTQLDDT
FT                   NADFQIASELAALEDVKNQANITGVVMNGNVLMIGQAPNSMLRDKAIRTVQAIEIGGKI
FT                   HNQIRIGNPTSFTTRSNDTWITTKVKTRMLNTDNLDTTRIKVITENGEVFLLGIVQRDQ
FT                   ADLAVDVARNTAGVRKVIKVFESPDS"
FT   sig_peptide     complement(443572..443634)
FT                   /locus_tag="Swoo_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.315 at
FT                   residue 21"
FT   gene            complement(443750..444337)
FT                   /locus_tag="Swoo_0350"
FT   CDS             complement(443750..444337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0350"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   sse:Ssed_4253 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84651"
FT                   /db_xref="GOA:B1KP81"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /protein_id="ACA84651.1"
FT                   /translation="MLERIKDSFTHSIQTKIDASEALPESIAKAAEMMVHCLLGGNKIL
FT                   ACGNGGSAGDAQHFSAELLNRFEVERPPLPAIALTTDTSTITAIANDYSYDEIFSKQIL
FT                   ALGQPGDILLAISTSGHSGNVIKAIEAALSRDMTIVALTGKDGGPMAGLLSINDVEIRV
FT                   PSNSTARIQEVHLLAIHCLCDNIDRTLFPQDE"
FT   gene            complement(444418..444771)
FT                   /locus_tag="Swoo_0351"
FT   CDS             complement(444418..444771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0351"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   sse:Ssed_4252 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84652"
FT                   /db_xref="GOA:B1KP82"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /protein_id="ACA84652.1"
FT                   /translation="MIDNKHQIPREHGQAGEKLAMNYLAERGLNFVEANVRYKFGEIDL
FT                   IMKDGKEWIFIEVKYRSKAQYGGALNALSPAQIGRLRRAAEHYIQIHKIDAVCRFDLIA
FT                   IDASQIHWLPNAF"
FT   gene            complement(444768..446672)
FT                   /locus_tag="Swoo_0352"
FT   CDS             complement(444768..446672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0352"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: sse:Ssed_4251
FT                   LppC family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84653"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP83"
FT                   /protein_id="ACA84653.1"
FT                   /translation="MLKRLNTTKLISVAVLTTILFGCGTTPTKVEPEQSQISLVSASLQ
FT                   PADYLNKAATTDNPERRTRYLLLASHAFINEGDANAATKTLNSVEKDLGQNVELLAEHK
FT                   YLKARVLELTSTYDDALRELEYPSSWKLADWQMVAYYQFKARLYQHIKQPIEQARQLSL
FT                   LTAYLPTAQANEVNDQIWRILQPLHEQTLLDFSQDSQTPIFAGWLQLAYIAKHYAINPS
FT                   ELVQHLGNWQHANPTHPGAIKLPTDLEKALNAKPYQPKNIAVLLPLSGNRASVANMVKQ
FT                   GIMSRYLSNPDNQVSINFFDTAKGAQSAYQAAVSAGAEFIIGPLFQSEVEQLQQATPIV
FT                   SETQVAQVESSSIEAGQIDAPKPSFTPNMVPQLYLNHVDQFTPNDDTFYFALSPANEAS
FT                   DAADKLYADGIVHPLILASNNGIGKRMAESFNKRWNELTNKDAEVHFYDAGDKMKVTVQ
FT                   KSLGVIDSKERIARIKALIGNKVEADFRSRRDIDAIYMISGNRDLPLLKPFIDVNFSVF
FT                   AEPVPLYASSRSRVEDSSRNTALELNNLNISDIPWLLTDSPEAQQVQSLWPTWSYGQKR
FT                   LYIMGYDALELVGKLAQMRALPGYQFSGRSGMLSVAPDGTVNRQLSWGRYKRGNLRPQ"
FT   sig_peptide     complement(446580..446672)
FT                   /locus_tag="Swoo_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.625 at
FT                   residue 31"
FT   gene            446760..447602
FT                   /locus_tag="Swoo_0353"
FT   CDS             446760..447602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0353"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: sse:Ssed_4250
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84654"
FT                   /db_xref="GOA:B1KP84"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP84"
FT                   /protein_id="ACA84654.1"
FT                   /translation="MDLAAALYIVPTPIGNLGDISSRAIDVLNNVKLIACEDTRHSGIL
FT                   LSHFGIETRKTALHDHNERDRAEWIIQKLSNGEAIALISDAGTPLISDPGYHLVSQVRA
FT                   AGYKVIPLPGACAAITALSASGLPSDRFSFEGFLPSKEKGRLDKLTELKEDPRTLIFYE
FT                   SPHRIVHSLESILTALGEDRIIAMAREVTKTFETFLYGTVKEVLEQVKSDPNQQKGEIV
FT                   LMCHGYRLVEDEGIPAVVINTLKLLCEELPLKKASALAGQIHGMKKNALYKYGLENGL"
FT   gene            447720..448010
FT                   /locus_tag="Swoo_R0013"
FT   ncRNA           447720..448010
FT                   /locus_tag="Swoo_R0013"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 234.72"
FT                   /ncRNA_class="RNase_P_RNA"
FT   mobile_element  448150..448304
FT                   /mobile_element_type="insertion sequence:DUF1568 IS
FT                   element"
FT                   /note="partial"
FT   gene            448393..449190
FT                   /locus_tag="Swoo_0354"
FT   CDS             448393..449190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84655"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP85"
FT                   /protein_id="ACA84655.1"
FT                   /translation="MSDWKCEDKEWMKQRKKEWPQYRFNISDALVEVTDLVKDEMEDLK
FT                   NYFLIGDKSALKTIYKIRSGLLLELWLHPSEDIEVLKQVFNRHREEKTHYCETPAYRVN
FT                   ERNKFYSLAKHRHKVPFKGASRLNGREWVIDQVFMPQTLEEFIAIEGEEQRDFIIGKFC
FT                   IGPCYEWGDFLTRTERFDTDICVNKIDIWKSAVKLSFEQYKDEKGIVWLIEDLDTFLAS
FT                   NDEKHPKQIKLAQDIIDAINDPEMPQALRDRVAEIRASKYATK"
FT   gene            449257..450783
FT                   /locus_tag="Swoo_0355"
FT   CDS             449257..450783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84656"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP86"
FT                   /protein_id="ACA84656.1"
FT                   /translation="MAKFSFHKEVWLLKDTQWLSDRKLAWEPIEYQLLCESAVNKNQIS
FT                   AMRRYFIKGEWTEGSEYAPSLDTRMRWCPAISRAYFGEMVSEAKTQYETQYLRETLVKS
FT                   VMKVVPEEFMSLDDWHRRLTLYQWVVDNEVEYTNKQIEFNSFQVRAFPLETSKANRNDF
FT                   SKLYLHWVADWLHTLNSNQYQGFIILLPFWFTSLRYMDESIFEWDQNVKTLNQLFIYIR
FT                   HFIPEHSCHAASQAKKEFVTEFLKCVEKYGLSLVRMTELWEEAAQNKEDESVGREVRSL
FT                   PLTSDNLETRLEDAFYNTYICDYKSKPDPVFIIHEAMESLGLCEQKYNKSDIKLVDISN
FT                   VLTSEFKSELCHDTVHAYHVCFQLSPFYIGSEKLTVYQNIFVLVDNNNNLKVIMTESSA
FT                   LRNVVCNSRIFSSRRLFLMDTLREEHGLGFKRYLNYTHDDSDPNSIPPEPEEYLTYLKL
FT                   LDIPFEDKDYSIFIYGAYGLQYGVDDQFKVVDGPSYSDFVSKVIKSGHPQ"
FT   mobile_element  450870..451518
FT                   /mobile_element_type="insertion sequence:DUF1568 IS
FT                   element"
FT   gene            450946..451302
FT                   /pseudo
FT                   /locus_tag="Swoo_0356"
FT                   /note="transposase, DUF1568 family, degenerate"
FT   gene            451592..452944
FT                   /locus_tag="Swoo_0357"
FT   CDS             451592..452944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84657"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP87"
FT                   /protein_id="ACA84657.1"
FT                   /translation="MYWKVEDKKWMKARKVLWAELKKCLLEHQYSKKEVKYMEPYFLKG
FT                   IRKQEDIAWAEPVPLIYCLAWHPSDDINVWFAEFQRIKSEARCEESMLSSISTSYILIK
FT                   NRSRLSTPLNATENVKSLFLQREQLLYQFLFLNKQFLDDPYVKQAEKWRLEELRPLNSG
FT                   ALFSIDKLAAIIKKDKEGEPFQPYFNAFSIQHLCHLSQYLSTEMYRRQMRWDDSEEKLG
FT                   RMLATSLKFYQQRLQYSVAFQTIAELWFKQLDSDEIATEWKTIWVNAKSGKYLTRDEFF
FT                   SKDKADEAGIENSKTNVEDELNQLLLDGTNRSEIIDCLADHFEAETIELFDINDLDNIC
FT                   SPYIGFIDPLEQLVKLRGGRDCVSYQDEVKDDVLTISLNEKVIGEINLDEVFSNETADY
FT                   FQHIINLAMEWFPNQALLSVEEGSTSLFILPSNIFKLLKENEIESDLLTQQ"
FT   gene            complement(453116..454633)
FT                   /locus_tag="Swoo_0358"
FT   CDS             complement(453116..454633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_1424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84658"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP88"
FT                   /protein_id="ACA84658.1"
FT                   /translation="MKYPTIALALLLLLPACSQQHEPDIVEFKAQPGDSARYWMKTKSN
FT                   INLKNIEIDQTSLALLHYQIDQVDDKILKFSVIPELMQFSGNRNNFHSARPTQRQQELQ
FT                   QLMSAGFDITLDPNTGELLNMSGKNAKIWQKMLQKSGEGFIDSIKNSLNSPGFVKQIPA
FT                   KVGEKLPVTEVGIHDAVLQVDKVTDEQLTLLINSANEQTKLFGKVILSRDNGWIEKLAL
FT                   ISVMPMESMGIQGTAHHSILMHRLNSNKLPSFIADLEQLIENDYWFELSKPNEIVTQHV
FT                   EPTADELFKFTQGELLDNGNTFYTKLLLTDGEITPAGELWFTNMRASSSLQPVLDIKLM
FT                   PTQPSMIMPAEDGVVVEQGFLPLGWLAKGDLAKIDKITATAHYQPAQLKTYSFPWSPDK
FT                   TVTHKMGSLSLTISPLSGTTDKYAVDIFPTGNEFLMPIFDGIDGEVSYVAPNVGPDWLT
FT                   YDDKFTASLNQSRILLKVTNAADTVTFYINQLAAEPAFEQQVEWTLK"
FT   sig_peptide     complement(454571..454633)
FT                   /locus_tag="Swoo_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.796 at
FT                   residue 21"
FT   gene            complement(454782..456290)
FT                   /locus_tag="Swoo_0359"
FT   CDS             complement(454782..456290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84659"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP89"
FT                   /protein_id="ACA84659.1"
FT                   /translation="MKLSVTLFAVILILSACSDNHNKDAVEFKANVGDSAKYWVQHVSR
FT                   IDLATATIGESTTLSLLRYRIEQTDATTLRFSVIPEYFQNTPYCENQFRRLQTKVAKYC
FT                   ALVWEGFKLDLNPADGSLINLQRTSASGWQTMLDKGTSLLVKSLRNTVNAPGFIQTIPK
FT                   IIGSKITLHDFSGFTLTMIVDKVTSQTIELSFTRDDPQFRQYGKVIVNQSNGWLQHATL
FT                   IAEKPLGSYQTAYRRTVMQKTNEYDAPGLITVIKDHRRVESNWTDISQTAKYHAAQDAP
FT                   IDKSFFQFSQARMQQWGEIIDTDLKISDEKQQPQGEVRFENLRGQSTIDPELNIKFSPR
FT                   FNPMISSTEQGVYANMRLMALTSARLSSLNLIDSITAEMVYYPAKIESHTLPWPSNKPK
FT                   TYSLGQAQLEITPVPNKSNIYEVTYISANDDYLLPVFGGVEGQFSRLPPKVGPQWLGLG
FT                   DRPLVPTNQMSWQLKVDNPPEHVTVYIKNVSKKATQKHSVVWYR"
FT   sig_peptide     complement(456234..456290)
FT                   /locus_tag="Swoo_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.287 at
FT                   residue 19"
FT   gene            complement(456518..457171)
FT                   /locus_tag="Swoo_0360"
FT   CDS             complement(456518..457171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0360"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="KEGG: spl:Spea_0134 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: peptidase S24 and S26 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84660"
FT                   /db_xref="GOA:B1KP90"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP90"
FT                   /protein_id="ACA84660.1"
FT                   /translation="MSKIKTFWKNNRQLFIFIILMSVFRSAVADWYTVPTGSMQPTIKE
FT                   GDRIVVDKMAYDLRVPFTQISLLETGEPQRGEIIVFESKAAKNRLIKRVIGLPGDKISL
FT                   SNEILSINGRPLNYTVLDNNSQELIAEEELTGLRHKIRIEKSASNNLSHFATITVPENH
FT                   YMVMGDNRRNSVDSRVYGFVPRAELKGKATQIAFSLNYDNYYIPREDRFFSDLY"
FT   sig_peptide     complement(457082..457171)
FT                   /locus_tag="Swoo_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            complement(457284..458021)
FT                   /locus_tag="Swoo_0361"
FT   CDS             complement(457284..458021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0361"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; PAS fold-4 domain protein; KEGG: pat:Patl_1157
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84661"
FT                   /db_xref="GOA:B1KP91"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP91"
FT                   /protein_id="ACA84661.1"
FT                   /translation="MSWDKENTFLNLVEVEQVISMFDLLPGVLFWIKDKNHNFVHANQA
FT                   FIEHKEVRGLNQILGKNDYDFSPPHLAKQFIRDDKKILAGQTVTERLEMNMTQAGDPAW
FT                   YATSKRPLSNQAGEIIGSYGITRHLQKQAMALSGVDAIKAPVDFVREHYSRHLAIEELA
FT                   EVAHLSVSALERRFKKYLTKTPKQFINEVRLENARRLLVETDMPISQVGDATGFTDHSY
FT                   FSKQFRLFFGELPSEFRKNYRLS"
FT   gene            458151..459341
FT                   /locus_tag="Swoo_0362"
FT   CDS             458151..459341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0362"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: sde:Sde_1708 oxidoreductase, Gfo/Idh/MocA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84662"
FT                   /db_xref="GOA:B1KP92"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP92"
FT                   /protein_id="ACA84662.1"
FT                   /translation="MFITMKKIRMGMVGGGQGAFIGAVHRIAAFLDGEIELVCGAFSSN
FT                   PQRSIESGKALYLPEHRCYDSYQEMILCEEKLPEEMRMEFVVIVTPNHLHFPVAKMAIE
FT                   HGFHVLSDKPATISLDEALRLKQLLEKHDQLYGLTQTYTGYPLIKQARHLIATGELGNI
FT                   VKVVVEYSQGWLASKEDETSKQASWRLDEKQSGISCCMGDIGVHAANLAEYVSGLNMAE
FT                   LCADITSTVAGRTLDDDGTVLLKFSNGAKGVLLASQVALGDENNLKLRVYGDRKSVEWS
FT                   QLESNTLWLKSNTEATQMIRAGVGDLCAAAKQAMRTPAGHPEGYLEAFANIYSNFAKQI
FT                   RAKNAGEVCDNQLFDVPGIEQAVRGMAFIENVVQASASNEKWHPFSLKSDSNMGEE"
FT   gene            459342..460394
FT                   /locus_tag="Swoo_0363"
FT   CDS             459342..460394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0363"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: AP endonuclease 2 domain protein; Xylose
FT                   isomerase domain protein TIM barrel; KEGG: sde:Sde_1707
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84663"
FT                   /db_xref="GOA:B1KP93"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP93"
FT                   /protein_id="ACA84663.1"
FT                   /translation="MSQIKGPGIFLAQFCQDDAPFNNLTSICQWVADLGYKAVQIPTWD
FT                   KRLFDLKLAYQSQTYCDDVKGIIADTGLSISELSTHLQGQLVAVHPAYDKQFDAFAPEE
FT                   VKNKPQARAQWAVEQVSMAAKVSQTLGLNAHATFSGALLWQTAYPWPQRPAGLVEEGFK
FT                   ELGKRWLPLLNKFEDAGVDLCYELHPGEDLHDGVTFERFLAATGDHARANILYDPSHFV
FT                   LQQLDYLAFIDIYHERIKAFHVKDAEFRPNGRSGVYGGYQDWQQRPGRFRSLGDGQIDF
FT                   KQIFSKLTQYGFDGWAVLEWECCLKHPADGAKEGAPFIEQHLIRTPEYAFDDFASSGVD
FT                   ESLNRSILGL"
FT   gene            460404..461651
FT                   /locus_tag="Swoo_0364"
FT   CDS             460404..461651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0364"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sde:Sde_1706 conserved hypothetical protein-signal peptide
FT                   and transmembrane prediction"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84664"
FT                   /db_xref="GOA:B1KP94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP94"
FT                   /protein_id="ACA84664.1"
FT                   /translation="MSADIDRNRIFTASCLALTVTAMTFAIRAGILGQLSQDFGLSDAE
FT                   LGWINAMAFLGFPVATILGGLLYNFLGAKKLVLIAFVGHILGLLLTMSADGFWLLLISS
FT                   FCIGFANGAVEAGCNPLIADIYHKKQTVMLNRFHVWFPGGIVVGALISKAMTDMSFGWQ
FT                   AQIAVMLVPTLIYGYLIISQTFPKTDNINTSTSANLKGLFSPLFLFMAFCMTLTATSEL
FT                   GTQQWIERILGASGASPMLIMAMVTGVMAVGRFFAGPLVHKLNPYGVLLYSAIVTTIGI
FT                   YSMSLATGNMVYVSALIFALGVTYFWPTMIGFVAENIPQTGALGMSVMGGVGMFAVSMW
FT                   NPVIGHWIDKGREQAVAAHTTPEIVELAAGQSTLANLSVFPLVLIFAFAGLALYMRQQK
FT                   QKVSQAQDSAQAESSF"
FT   sig_peptide     460404..460493
FT                   /locus_tag="Swoo_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.788 at
FT                   residue 30"
FT   gene            461743..462597
FT                   /locus_tag="Swoo_0365"
FT   CDS             461743..462597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0365"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: cps:CPS_3701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84665"
FT                   /db_xref="GOA:B1KP95"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP95"
FT                   /protein_id="ACA84665.1"
FT                   /translation="MKAVLTSLIGFLMVISTTSMAHEAYSLTPPKVSVQLWSVKDQLKD
FT                   DFEATVEALAQMGFDGVEFAGDFGPFNEDANGLRLYLDSLGMVASGAHVSFEQLNDENF
FT                   TETVAFYQALGAKVLIVGWDKRAWDPKGIDFVVNELNRISLKLKPLGIKFGFHNHEHEF
FT                   NGFKGTTFWDYLAKNTMQDVVLQQDVGWTTYAGRDPIEYVKRYPGRTITTHYKVKLPEG
FT                   VEGKLPIIGQDTIDWLALTKANIAVGGTQWLVVEQEEYPNGLTPLQAVEKSKLGLDNIL
FT                   KQL"
FT   sig_peptide     461743..461808
FT                   /locus_tag="Swoo_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            462650..463369
FT                   /locus_tag="Swoo_0366"
FT   CDS             462650..463369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0366"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="PFAM: protein of unknown function DUF1080; KEGG:
FT                   pdi:BDI_1827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84666"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP96"
FT                   /protein_id="ACA84666.1"
FT                   /translation="MTKWGVSIKSRSQQVIAALLLSTVATAGVAADNQLSKKEKEAGWQ
FT                   LLFNGKDMSQWRNFKQQGVNPKWVIDQDSIHLSGGGGGDLLTKQAYKNFELTLDWKISR
FT                   AGNSGIFVLADELGSKIYSHAIEVQILDNQRHADNKIDSHLSGSIYDIQASPPASHRVA
FT                   GEWNKVRIRMHNNSLSVWQNGILTADLIVGSEKWNSLVAESKFRTWTGFAQTSQGHIGL
FT                   QDHSDPVWFKNIKLREL"
FT   sig_peptide     462650..462742
FT                   /locus_tag="Swoo_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.650 at
FT                   residue 31"
FT   gene            463369..465066
FT                   /locus_tag="Swoo_0367"
FT   CDS             463369..465066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0367"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; KEGG:
FT                   sus:Acid_7382 glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84667"
FT                   /db_xref="GOA:B1KP97"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP97"
FT                   /protein_id="ACA84667.1"
FT                   /translation="MMEGQINGHDYDVIVVGSGAGGAMAAYTLTKSGRKVLMLEAGRDY
FT                   DPKTETPMFKSNFDAPLLGAGNSDKDFGFYDATVDGGWEVPGEPYTKGEGSEFLWWRAR
FT                   MLGGRTNHWGRYSLRFSEHDFKGFSRDGLGADWPFEYWDLAPWYDETEALVGICGTNTG
FT                   LDDMPDSPEGVLQPPPKPRVPELLVSAAAKKLGIPTAPMHRAVLTRPKDDRQACFYATP
FT                   CGRGCSIGAAFQTTTSLIPMAQATGLLTVITDAMVKEVNVDEKGKVNALTYIDKKTKQA
FT                   HRLDAKVIILAASACESARILLNSKSESHPNGLANSSGHVGRNIMDSTGVSYGAHIPAL
FT                   EGRPKYNEDGHTANHLFIPWWGHKVQEKKAMAFPRGYHFEIGSGFRAPSSWVSGDLDGY
FT                   GKPLKEIAKQAYGSYVGLALRGEMLPNDDCYMEIDEDVKDKWGIPVVKFHWKWSQHELK
FT                   QVEHGLKTARQILETMGAKFDKPLPKAEDAILKGGQIIHEVGSTRMGDSPTESVTNQWG
FT                   QTWDCSNLFVMDAGVFASNPHKNCTLTIMTLAMRNSTWLARQLDKGEL"
FT   gene            465068..465811
FT                   /locus_tag="Swoo_0368"
FT   CDS             465068..465811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_2528 Tat (twin-arginine translocation)
FT                   pathway signal sequence domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84668"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP98"
FT                   /protein_id="ACA84668.1"
FT                   /translation="MSLVKRYSSKKPYLASLSRRDAIKWIGALSVTAAFPGLTACSSQA
FT                   LAPQSELAKGHWPQLELPVINATGYGKDPNLIIAPRASWPRTLTAAQLTFIAIFADIVA
FT                   PREGSVPSASEVKVPDLLDEWVSAPYERQQQDRVSFLHLLAWLDEEARRRFDNLFVDVT
FT                   ASQQLAIIDDIAYKKAMQSEEFVRPAKAFADFRRLVLACFFCSPAGVKDIGYLGNVPIV
FT                   GDYPGPSDEAMTHLQGVLDELGLTL"
FT   sig_peptide     465068..465205
FT                   /locus_tag="Swoo_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.907 at
FT                   residue 46"
FT   gene            complement(465907..467115)
FT                   /locus_tag="Swoo_0369"
FT   CDS             complement(465907..467115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0369"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sse:Ssed_4234 NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84669"
FT                   /db_xref="GOA:B1KP99"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:B1KP99"
FT                   /protein_id="ACA84669.1"
FT                   /translation="MSRVVIVGGGAAGLELASLLGRSVNKQDEVILVEGETHHYWKPRF
FT                   HEIAAGTFDNDLDSLCYFSHGAKNGYRHYQGRMTNINREEKQLVVYKTNGETDTLAYDY
FT                   LVIAVGAISNDFATKGALEHSLFLDTPEQARESWQQISALLRSGEQRTINIVGAGATGL
FT                   ELAAELAKVSGKLERNPHAARLTINLIEAADRVLPNSPLKMSQQAQSRLEKFNVNLLLN
FT                   TRIASVDKQGMTTSEGITLDADLQFWAAGIKAPDWLKNIGGLESNNANQLVVQQTLATT
FT                   QDPSIFSLGDCAAIPQADGSTVPPKAQAANRAAVHLAKSLLGLMQGKTLTPFVYKDGGM
FT                   VVAIGHNYAISTMMNDRLILKGRLVRRLYDTIFRLHQKTVSGFLTMSRLIIAKRLKCIF
FT                   QPN"
FT   gene            467561..468072
FT                   /pseudo
FT                   /locus_tag="Swoo_0370"
FT   gene            468075..468692
FT                   /locus_tag="Swoo_0371"
FT   CDS             468075..468692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0371"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: sbn:Sbal195_0574 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84670"
FT                   /db_xref="GOA:B1KPA0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA0"
FT                   /protein_id="ACA84670.1"
FT                   /translation="MSIRVNTHFDFSHIQGVIFDLDGTLADSNPDFEGLRRELGLKSGT
FT                   DILAHMESIIDPVLASKTKEIVTRYELESSSRATWVTGAEQLVALFRRLKLPQAILTRN
FT                   IPQAAGITLANLGLEMDLVLTRFDAKAKPHPEGVELICEQWQLEPANILFIGDYLYDLQ
FT                   TARNAGTKSVLYSPDLIPDYASQADIVCQCYTALIQHFNTQI"
FT   gene            complement(468772..469650)
FT                   /locus_tag="Swoo_0372"
FT   CDS             complement(468772..469650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0372"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_4232 carbonate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84671"
FT                   /db_xref="GOA:B1KPA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA1"
FT                   /protein_id="ACA84671.1"
FT                   /translation="MFNWEGISEFVAVAEAESFTKASQRLGISTAQVSRQVSALETRLA
FT                   TKLFHRTTRKVSTTEVGRVYYQHCRQVLDGLDEAERAITNLQSSPRGLLKITAPVTYGE
FT                   MTIAPLINDFAAKYPELEVKINLTNQKLDLIDEGYDLAIRLGQLEDSSMMAKRLSSRTQ
FT                   YVCASPSYLSTFGIPHSLSELEQHNCLLGTMDYWRFEDNGKTRNVRVKGNLSCNSGHAL
FT                   VDAAIKGIGIIQLPDYYLQSFIEDGQLVPLLEQNRSPEEGIWALYPHNRHLSPKVRMLL
FT                   DHLTQALASHK"
FT   gene            470042..470599
FT                   /locus_tag="Swoo_0373"
FT   CDS             470042..470599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0373"
FT                   /product="S-(hydroxymethyl)glutathione synthase"
FT                   /EC_number="4.4.1.22"
FT                   /note="KEGG: spl:Spea_0267 S-(hydroxymethyl)glutathione
FT                   synthase; TIGRFAM: S-(hydroxymethyl)glutathione synthase;
FT                   PFAM: glutathione-dependent formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84672"
FT                   /db_xref="GOA:B1KPA2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA2"
FT                   /protein_id="ACA84672.1"
FT                   /translation="MKVLIHPQVDNGVTQSQEGFSGGTLGCQCQAQRVEVSVTAQTAHN
FT                   HVCGCSKCWKPEGALFAQIAVVSRDNVQVINNADKLMVVDESAAIQRHACKECGTHMYG
FT                   RIENAAHPFYGLDFVHTELSSEEGWSQPEFAAFVSSIIESGASADSMADVRQTLKDLGL
FT                   EPYDCLSPALMDAIAVHLAKSA"
FT   gene            470919..471185
FT                   /locus_tag="Swoo_0374"
FT   CDS             470919..471185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0374"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="PFAM: zinc finger DksA/TraR C4-type; KEGG:
FT                   sfr:Sfri_3428 transcriptional regulators, TraR/DksA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84673"
FT                   /db_xref="GOA:B1KPA3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA3"
FT                   /protein_id="ACA84673.1"
FT                   /translation="MAGGWSRDGAVQDQIDNSVDDGVAQARSRLPVGQSLLYCEECDSP
FT                   IPQARREAVIGVRLCVSCQQEADKQFKSFSNFNRRAGKDSQLR"
FT   gene            471384..472514
FT                   /locus_tag="Swoo_0375"
FT   CDS             471384..472514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0375"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: sse:Ssed_4227
FT                   alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84674"
FT                   /db_xref="GOA:B1KPA4"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA4"
FT                   /protein_id="ACA84674.1"
FT                   /translation="MTAQTIKSKAAVAWAVGEPLSMEIVDVMPPQKGEVRIKMIATGVC
FT                   HTDAFTLSGDDPEGIFPCILGHEGGGIVESIGEGVTSVQVGDHVIPLYTPECGECKFCK
FT                   SGKTNLCQKIRETQGKGLMPDGTTRFSKDGVDIFHYMGTSTFSEYTVLPEISLAKVNPE
FT                   APLEEVCLLGCGVTTGMGAVMNTAKVEEGSTVAIFGMGGIGLSAVIGATMAKAARIIVI
FT                   DINESKFELARKLGATDCINPKDYDKPIQDVIVELTDGGVDYSFECIGNVHVMRSALEC
FT                   CHKGWGESVVIGVAGAGQEISTRPFQLVTGRVWKGSAFGGVKGRSELPEYVERYMAGEF
FT                   KLNDFITHTMGLEQVNEAFDLMHEGKSIRTVIHFDK"
FT   gene            472574..473443
FT                   /locus_tag="Swoo_0376"
FT   CDS             472574..473443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0376"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: sfr:Sfri_3426 carboxylesterase; TIGRFAM:
FT                   S-formylglutathione hydrolase; PFAM: putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84675"
FT                   /db_xref="GOA:B1KPA5"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA5"
FT                   /protein_id="ACA84675.1"
FT                   /translation="MIANSVGDPSVTIENVSVNKSFDGWHKQYSHRSSVLNCEMRFAIY
FT                   LPPQASNGEKVPVLYWLSGLTCTDENFMQKAGAQALAAELGIAIVAPDTSPRGDDVADD
FT                   EGYDLGKGAGFYVNATQVPWSRHYQMYDYVVDELPKLIESMFPVSDKRSIAGHSMGGHG
FT                   ALVIALRNSDTYQSVSAFSPISNPINCPWGKKAFTAYLGRDTKTWSDYDASVLMRQATS
FT                   FVPALVDQGDGDNFMVEQLKPEMLEAAASVSGYPLTLNIREGYDHSYYFISSYIENHLR
FT                   FHAEHLKK"
FT   gene            473632..473958
FT                   /locus_tag="Swoo_0377"
FT   CDS             473632..473958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0377"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   sfr:Sfri_3425 small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84676"
FT                   /db_xref="GOA:B1KPA6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA6"
FT                   /protein_id="ACA84676.1"
FT                   /translation="MSWIFLILGVVAEALSHVALKATDGFTRPLPAALVILGHLTAFIF
FT                   LGQAMKGMPVGIVHALWAGLAIVTVTLMSTLLYRQHLDTTAWIGMLLVAGGVMMINLSQ
FT                   GHSH"
FT   gene            complement(473968..474684)
FT                   /locus_tag="Swoo_0378"
FT   CDS             complement(473968..474684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0378"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sse:Ssed_4223 short chain dehydrogenase/reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84677"
FT                   /db_xref="GOA:B1KPA7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA7"
FT                   /protein_id="ACA84677.1"
FT                   /translation="MMKTVVITGASRRLGLFLAEQFIARGDRVFAVSRSTSNEFTSIDS
FT                   ANFHAVQIHGYDKLGVEQAVTAIKPQVSHIDLLINNASVFEADPKDNQEIESKLTLFFQ
FT                   IHMLFPSLLTHELAPLLFDEKTPGLVVNMTDIYADNPSHQHSLYCSTKAGLENLTRSFA
FT                   KKFAPGIRCNSIMPGPLKFLPEHSQAQKEQVLNATLLPFEAGFNPVFQTIEFILANPFV
FT                   TGTAIKVDGGRSICRG"
FT   gene            complement(474743..476374)
FT                   /locus_tag="Swoo_0379"
FT   CDS             complement(474743..476374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84678"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA8"
FT                   /protein_id="ACA84678.1"
FT                   /translation="MTYKTSLVFISISFLAAQTGLAEESAEKTEAFTEKKSLHKIIITS
FT                   HPIFDESAPDSFFIHDWANYLHINTRESTILNKLTFDEQSQVSQKDIEEAQRNLRYEPY
FT                   IRDAKITFVERAPDADAPDEGEVVLVETWDNWSLLPTVSLSRSGGDTKYSVGLKEDNLL
FT                   GYGIRTRIKYKSDSERTGYKLSVQAPLDNLIKHSTIAASYHDNSDGQATQFRFIKPFYT
FT                   LDANNMYGLSYSDDLRTDTIKQNGMDINEFEHKQDFFNLQYGWRINKTANSRTRVITGI
FT                   TRNKSEFANQDKFPDTELPQNRDFLYPWAAYEYLQDDYKVLQNIHLINYNEDINLGWHH
FT                   FLKLGLETQDLGESSLGYHINWKTTRGYQDNGDLLLLSFDGAGVFATNQKDFYQINMKA
FT                   EYFYRISPKWTAYAKTRLSTSKNNYLDKTFALGDETGIRGYPNDYQHGDNQWLFTAELR
FT                   NYPNINLYQLAELGWAAFVDVGQASGGPDDNNEVSKPIGSIGIGARIYSSRSSYGNVAH
FT                   IDISVPFTSGEEVNSWEWSFQVRNRF"
FT   sig_peptide     complement(476306..476374)
FT                   /locus_tag="Swoo_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            complement(476846..478066)
FT                   /locus_tag="Swoo_0380"
FT   CDS             complement(476846..478066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0380"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   sse:Ssed_4220 protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84679"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPA9"
FT                   /protein_id="ACA84679.1"
FT                   /translation="MDTQDFLVKRRFIIKLGKYLHKFGTPAYRLEAHLQAVSNFLGLEG
FT                   YFLISPTAMTFVLQRDDEQEYNHVARVKPGELDLGSLARTDELVEELVSGKRTLDEALD
FT                   RLDEIANKPNPYGSLLTLLAFGSSAGAFAMLMGTSWNDVFWSATLGFMVYGLVYRAERS
FT                   KRMAEMLEPLAAILAAIITCGISQFDPSINIPVVILSGIIVFVPGLALTLGLAELAARD
FT                   LISGTARIMDACMLLFKLYFGAIFGMVVGTAIFGEAIYFEPEPLPQIAVWSAVPILSMA
FT                   LVIIFKARMKDSPWGILAGIVAFCSSMLGAIYLGESIGIFFGAFAVGVYSNLFARWMKA
FT                   PASIALLQGIVILVPGSKTYIGLNTLILGETMLNQSHIGTQIFLIFMSLVAGLIFANVA
FT                   VSPRRTL"
FT   gene            478251..478652
FT                   /locus_tag="Swoo_0381"
FT   CDS             478251..478652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84680"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB0"
FT                   /protein_id="ACA84680.1"
FT                   /translation="MPVAISGLYISITAILVVMFAMRVVKLRRKHKIGIGSSDNKELRI
FT                   AGRVHANLIENAPIAMALLLVAELNGLTPLALHLLGIMWVIGRVLHAIGLTKGQGGYHI
FT                   GRFWGGLLSWLMILILAGINLGYFVYSQI"
FT   gene            478899..481190
FT                   /locus_tag="Swoo_0382"
FT   CDS             478899..481190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0382"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   sse:Ssed_4218 radical SAM N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84681"
FT                   /db_xref="GOA:B1KPB1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB1"
FT                   /protein_id="ACA84681.1"
FT                   /translation="MQVESTLFTYPKYRAEMKRPAPFLPMSRKEMDRLGWDSCDIIIVT
FT                   GDAYVDHPSFGMAVIGRMLESQGFRVGIISQPDWSNKNDFMKLGKPNLYFGVTAGNMDS
FT                   MINRYTAERRMRHDDAYTAGNIGGKRPDRAVTVYTQRCKEAYKQVPVVIGGIEASLRRI
FT                   AHYDYWSDKIRRSVILDAKADILVYGNAERPLVELSHRLADGEPISELHNIRGTTVIRK
FT                   EPLSGWKGMDSRKIDQLHKIDPIPHPYGADDVGCKNLSGPSDVKIFDNDAPKAISVQPA
FT                   RPKPWEKTYVLLPSFEKVSGDKYLYAHASRILHQEQNPGCARALFQKHAERAIWVNPPA
FT                   WPLNTDEMDGVFGLAYARVPHPSYGKEVIPAYDMIKTSINIMRGCFGGCSFCSITEHEG
FT                   RIIQSRSQESIVNEIKDIQDKVPGFTGVISDLGGPTANMYHLGCKSEKAEKTCRRISCI
FT                   FPDICGHMDTDHQPTIDLYRAARDVPGIKKILIASGVRYDLASEDPRYVKELATHHVGG
FT                   YLKIAPEHTEEGPLNKMMKPGMGTYDKFKELFDKYSKEAGKKQYLIPYFISAHPGTTNE
FT                   DMVNLALWLKGEKFKLDQVQNFYPSPMANATTIYHTELNSLKNVKHTSEQVTVPKKGRQ
FT                   RKLHKALLRYHDEAGWPMIREALIEMGKEKLIGSGANCLVPAESRQEREARRNKGKGGN
FT                   KSSKSNGGQKALTRFSEDQFSDRKPKGGKSGSAGKQGSGKGGNGQAKNSAGSKRPPKKN
FT                   AWGTTPKHQR"
FT   gene            481255..481602
FT                   /locus_tag="Swoo_0383"
FT   CDS             481255..481602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0383"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   slo:Shew_0234 protein of unknown function DUF1232"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84682"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB2"
FT                   /protein_id="ACA84682.1"
FT                   /translation="MSDNSDNAATDGYSEEGFWLKVKQFAVKAGREVIDNALCLYYAAK
FT                   RPDTPKWAKTIIFGALAYFITPLDAIPDLTPMVGFTDDLGALAAALAMVAMYVDDTVKN
FT                   QAAEKSAAWFD"
FT   gene            complement(481638..482579)
FT                   /locus_tag="Swoo_0384"
FT   CDS             complement(481638..482579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0384"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cps:CPS_0771
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84683"
FT                   /db_xref="GOA:B1KPB3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB3"
FT                   /protein_id="ACA84683.1"
FT                   /translation="MSQSVRQSVMQASREWIANFNQGNVQACTERYQKEATMQVSPFGR
FT                   FNGMEAIAGFWNEFAKSGPTKLVYRNVEIKVLNDKQAILSANWSMNIASGFISKELWTL
FT                   NDDGQWYLEEDDFSVLTQHPAPLDDDKRTALVLVDLQNDYFSGGRFPLDNTDIATQHAK
FT                   TLLSHFRKNALPVIHIQHIFEDDNAPFFTANTTGIEIETSVAPLAEEPVVIKHQIDSFI
FT                   DTSLEQSLVELGVDKLVIVGAMAQACVQTITRSAVNKGYSCEVISDAIAAPSLPYGEHK
FT                   FSGDQLVAANLLSLSFGGAKATTSTQWLKDNA"
FT   gene            482709..483581
FT                   /locus_tag="Swoo_0385"
FT   CDS             482709..483581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0385"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cps:CPS_0770 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84684"
FT                   /db_xref="GOA:B1KPB4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB4"
FT                   /protein_id="ACA84684.1"
FT                   /translation="MLVFDEVIKRGSFTAAAESLGHTKSAVSQYVSQLEGDLGVRLLNR
FT                   STRQLNLTVVGEQLAKRSEQLLDLLSTAVEEVRSQEQAPSGRVAITAPHAFESSLVTPI
FT                   VAQLCQEYPKLVPELNFSDERLDLLQANLDMAISVGPQKDSAYHAILIGRLDSILVASP
FT                   TYLAKNRVNDRELHLQNIVALPWQQQAVLENHQGKRILFSSDKQFRVNTSTSAINSVKC
FT                   GVGIGLMPSIFVREALNAGVLQRVLPDYQGEVRDVFALHSYQQQLPLALRRFVEQLKLA
FT                   FSRVSAGKI"
FT   gene            483654..484232
FT                   /locus_tag="Swoo_0386"
FT   CDS             483654..484232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_0282 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84685"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB5"
FT                   /protein_id="ACA84685.1"
FT                   /translation="MKKYPQILALSATCIALPAAAITAEQSAFFDSIAAHCGKAYEGTV
FT                   IGATSADSSFSGKKLVMHVRECSDNELKVPFHVGDDHSRTWVITKTQHGLHLAHDHRHK
FT                   DGSEDKVTMYGGMTAMMGSATEQSFPVDAYSINNFRENGLDVSVTNVWHMYIKPTEFTY
FT                   RLTRENRDFRVDFDLTKPVDLPPVPWGHK"
FT   sig_peptide     483654..483725
FT                   /locus_tag="Swoo_0386"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.448 at
FT                   residue 24"
FT   gene            485202..485612
FT                   /locus_tag="Swoo_0387"
FT   CDS             485202..485612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbn:Sbal195_2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84686"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB6"
FT                   /protein_id="ACA84686.1"
FT                   /translation="MKYGYLLLVILLLSGCLNIPPPQRGYTAPANNVCSVIAGATIVAS
FT                   DGQYLGKITNQYDSDSVLNDYGSYGGSYSATSIWNQYGSYGGEYSANSPFNEFSSSPPR
FT                   IVKGGSVIGYLSVNQSLANSLNPYVIKSCKFY"
FT   sig_peptide     485202..485279
FT                   /locus_tag="Swoo_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.532 at
FT                   residue 26"
FT   mobile_element  complement(485625..486824)
FT                   /mobile_element_type="insertion sequence:IS492-like IS
FT                   element"
FT   gene            complement(485643..486599)
FT                   /locus_tag="Swoo_0388"
FT   CDS             complement(485643..486599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0388"
FT                   /product="transposase IS111A/IS1328/IS1533"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: pat:Patl_3756
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84687"
FT                   /db_xref="GOA:B1KEJ0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B1KEJ0"
FT                   /protein_id="ACA84687.1"
FT                   /translation="MNSKTNQNISVGVDTGKFQLDIYIRPLDIFFTVKNDEKGIKDAVN
FT                   SIKQYTPKRIVIEATGRLEMPFIMACAEANLPFVIANPIHIKRFAGAIGQRAKTDKLDA
FT                   KLIAHYGEAIKPKLSTLKPSIMQAMSDLVSRRNQILAMQTMEKNRLQILPKDLAMTIKP
FT                   ILTAFKNQIEKIEAKIIKLIESCPDYQAKNIILQSMKGIGKIAAASIISNLPELGYINN
FT                   KEASSLVGVAPMNKESGRFKGQRKIQGGRHQVRTVLYMAMMSAIQSNPVFKQTYQRLVA
FT                   AGKPKKVAIIACIRKMVVTLNSMLRDGVMWEAPKAQI"
FT   gene            486933..487352
FT                   /locus_tag="Swoo_0389"
FT   CDS             486933..487352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fps:FP2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84688"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB8"
FT                   /protein_id="ACA84688.1"
FT                   /translation="MNIELYGYSLEVDVKKTKRTYESIQSSGCEECGCLYCQNFQKSIP
FT                   ECFPKELLDFFEKSCIDLIKDAEVYHYTDVSDDILNYGGEFYLWGKVLKHPSGEPELAN
FT                   NFTFSFTEPSPLAQEAFKGSGAICFSFSGDIKWLM"
FT   gene            487479..487925
FT                   /locus_tag="Swoo_0390"
FT   CDS             487479..487925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_3680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84689"
FT                   /db_xref="InterPro:IPR025334"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPB9"
FT                   /protein_id="ACA84689.1"
FT                   /translation="MNEIEFWKLISKLNWDETGDDEAVIEPVVNALAKMDNEDIFHFEE
FT                   ILAQKLFALDTMAHAKEIGDDAYVSDEKYFSPDSFLYSRCVVVANGKAFFEEILANPSE
FT                   FPKDMEFEAILEISSSAYEEKNDDEWDYVSPTDYESFKNVAGWK"
FT   gene            complement(488468..488815)
FT                   /locus_tag="Swoo_0391"
FT   CDS             complement(488468..488815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84690"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC0"
FT                   /protein_id="ACA84690.1"
FT                   /translation="MKLSHTYLSGLAVLLSIIATPSQADTMQSRCDIYDKPQGELLTST
FT                   PCTFSQRQGYISINRDDGISYNLAPVDEAYIGTFEDQNGNWVYRKSGLSPDGVIFKMPT
FT                   EYLYLYWGKGE"
FT   sig_peptide     complement(488741..488815)
FT                   /locus_tag="Swoo_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(488829..489392)
FT                   /locus_tag="Swoo_0392"
FT   CDS             complement(488829..489392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84691"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC1"
FT                   /protein_id="ACA84691.1"
FT                   /translation="MKKLIRLISTLSLAASLMFTQAALADSEYSDTIAKFKQASDTHRF
FT                   FDNAYGYAIFPTVGKGGLGIGAAYGKGQVFRNQSYTGDTSLTQISLGFQIGGQAYSEII
FT                   FFKNAKAYEEFTSGSFEFGAQASAVAINIGANAQAGTTGNSSGAGGKAAKAAYINGMAV
FT                   YTMAKGGLMFEAALAGQSFTFEEK"
FT   sig_peptide     complement(489315..489392)
FT                   /locus_tag="Swoo_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            complement(489494..491572)
FT                   /locus_tag="Swoo_0393"
FT   CDS             complement(489494..491572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0393"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; WD40 domain protein beta Propeller; KEGG:
FT                   spl:Spea_0284 peptidase S9 prolyl oligopeptidase active
FT                   site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84692"
FT                   /db_xref="GOA:B1KPC2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC2"
FT                   /protein_id="ACA84692.1"
FT                   /translation="MGKLSSFSMLAVITASTFVSSASIAATQRTHDITTDDFFDIGGMS
FT                   NVQLSPNGKQAVWLESRWDKELNKSQRDLWLIDTKTRQSKRMTFTNESESSPQWSPDGQ
FT                   YIYYLGKIKQDKAKAPYNGKAQVFRLSVNTGDSQPMTKEVEGVNRFQLSHDGNSLYFLT
FT                   SKTVKDKDEWASMRSSHSAPKYGHGERKTNPLYQLDLQHFKQKILIDDDKVVWEFKVNS
FT                   DESKIARITTDDNELVRLEGWSNIEIFDTQTATNSTLVDTQWRDDAPSPYGWLLGLSWQ
FT                   ENNTELAFRIDFDGHPGKLFIANARKMDAPSLELKRSGDVTLNSSDIKWRPNSDEICYR
FT                   GADHGRVKLLCTEIDDGEQGKTRNVIQGDMVIGSYSFSQNGKTVAFSHNGLDHFSDMFI
FT                   ADANRKRAKAKRLSNINPQVDSWKLPQISIVKWTAPDGAVVEGILDLPAGYKREDGPLP
FT                   LIVQIHGGPTSATPYALQHRSYGRSTFTANGWALLSPNYRGSTGYGDKFLTQLVGREHD
FT                   IEVKDIMAGVDHLINEGIVDADKMAVMGWSNGGYLTNALISTNNRFKAASSGAGVFDQR
FT                   LQWMLEDTPGHVVNFMQGLPWEKPEAYNHGSSLTYADKIKTPTLIHIGENDQRVPLGHA
FT                   QGLYRSLKHYLNVPVELVVYPGEGHGLSKYQHRKAKMEWDQKWFNHYVLGQKISGKE"
FT   sig_peptide     complement(491495..491572)
FT                   /locus_tag="Swoo_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 26"
FT   gene            complement(491950..492855)
FT                   /locus_tag="Swoo_0394"
FT   CDS             complement(491950..492855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84693"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC3"
FT                   /protein_id="ACA84693.1"
FT                   /translation="MNEFNSFFSQGYWWLSLLGGLHCIGLGLYIRYIYRESNGNHKLLG
FT                   SIFSLMGLYFFTGMLNRDNSPAPIHLVFTLIIPVYFLLMPLLYLYCYRSLNNIKRDIKL
FT                   SKHFYPALIIAILVLIASIINQHFTVQLSNIPESGRLTFTHIGALGTLLPGILSIQTSI
FT                   YFVLIIQMLKRYRGRSHKAHQESLQDIKFRWLLVLTFAMVCNWLVRTLLVILPFYLGDQ
FT                   ISEMTQAMTRLQLLLTVYVLAIYGLKQITKAAYLRGKLTYANDRVSTPIKASSQLLNSE
FT                   ELNYLHQLMKDDKKESHKPD"
FT   gene            complement(493014..493397)
FT                   /locus_tag="Swoo_0395"
FT   CDS             complement(493014..493397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spl:Spea_0303 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84694"
FT                   /db_xref="InterPro:IPR020483"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC4"
FT                   /protein_id="ACA84694.1"
FT                   /translation="MTEQALLDGKLLYEYKTISAMVQIYCKAHHHAACVDQCEDCQAFL
FT                   EYAHTRLDRCPYGQDKPTCNKCPVHCYKPHMKAKAREIMIFAGPRMLLPHPIMAIRHLL
FT                   AERKAAPGKPPVHASNRHLRKAK"
FT   gene            493872..494693
FT                   /locus_tag="Swoo_0396"
FT   CDS             493872..494693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84695"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC5"
FT                   /protein_id="ACA84695.1"
FT                   /translation="MKVILILLLVFLGVYLYMRAKRLAEKEQEVAKPVEKEIHESTAVE
FT                   QKAAEEVSIVDVVDTSVADKVETVETVKADVSDEQKLDTANSEATQDEVAIAVALPDVD
FT                   PAEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPVSVATDESWANAKLAGSLKEY
FT                   RSSSDSAIQHSALLAAIGECYKQRKQAEYANYGAGLTPEYIEVFASLKSPTNEKGVGFM
FT                   HLSTLLNDTGMFDKAIEVCQKAITYGLSDGTVTGFEGRISRIEKAKAKANK"
FT   gene            494778..495077
FT                   /locus_tag="Swoo_0397"
FT   CDS             494778..495077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84696"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC6"
FT                   /protein_id="ACA84696.1"
FT                   /translation="MRLVLLGFLLSLLTACTQNPEWTLFYYPDEPQIPADAELGEHISG
FT                   YYGTSEQCLLKGAGMVKLSDSGIGSYQCGHLCVAKEQNDLSCQTYLDSLIPTSD"
FT   sig_peptide     494778..494831
FT                   /locus_tag="Swoo_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.454 at
FT                   residue 18"
FT   gene            495136..495429
FT                   /locus_tag="Swoo_0398"
FT   CDS             495136..495429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84697"
FT                   /db_xref="InterPro:IPR022080"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC7"
FT                   /protein_id="ACA84697.1"
FT                   /translation="MKLQSISLDPTSKSLSIVADIDFEAFELFAEPLSRAIDARVIERQ
FT                   WGADRHQWLLDFEGTQIQLNYEFYGDICWLSVERDDEFEVLEFLASLLERQR"
FT   gene            495426..496430
FT                   /locus_tag="Swoo_0399"
FT   CDS             495426..496430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0399"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   sse:Ssed_4194 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84698"
FT                   /db_xref="GOA:B1KPC8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC8"
FT                   /protein_id="ACA84698.1"
FT                   /translation="MNQEQQGAGFHYQALTPDLILDAIESLEIYPETGLLPLNSYENRV
FT                   YQFRCDNGVRYVVKFYRPERWSNEQIQEEHDFSQALFDEEVPVATPVIIGGRSLHEYQG
FT                   FRFALFPSIGGRSFEVDNLEQLEATGRFIGRIHQFSRQGSFQHRDLVNPQVLGDESLLW
FT                   LKESGHVPSSLVLPYFTIVEQVLDKSKEIWSQQNPKQIRLHGDLHPGNILWTPDGPGFV
FT                   DLDDARTGPAIQDLWMMIIGDKPQKLLQLEILLEAYEEFCEFDSKELKLIEPLRAMRML
FT                   HYNAWLSRRWEDPAFPMNFPWYGEEKYWEQQILSFKEQLAVLDEPALSLIPGY"
FT   gene            496579..497190
FT                   /locus_tag="Swoo_0400"
FT   CDS             496579..497190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0400"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: sse:Ssed_4193 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84699"
FT                   /db_xref="GOA:B1KPC9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPC9"
FT                   /protein_id="ACA84699.1"
FT                   /translation="MKKALLIALALLTAPMAALAVDYKEGVHYTVINQGPATAKPEITE
FT                   FFSFYCGHCYNFSKVQVPQIKANLPEGVVFKQNHVEFIGREMGTEMSRAFAVAHQLKVE
FT                   DKIEKAIFAAIHDKKQHFTNRDDVRKLFIANGVDGKAFDAAADSFMVSAQMSQMKRATE
FT                   NAQISGVPSLVVNGKYRVETGAIKSYDELLDIAYYLTSMK"
FT   sig_peptide     496579..496641
FT                   /locus_tag="Swoo_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            497935..498147
FT                   /locus_tag="Swoo_0401"
FT   CDS             497935..498147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0401"
FT                   /product="protein of unknown function DUF1107"
FT                   /note="PFAM: protein of unknown function DUF1107; KEGG:
FT                   sse:Ssed_4192 protein of unknown function DUF1107"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84700"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD0"
FT                   /protein_id="ACA84700.1"
FT                   /translation="MRVFPVYAPKLIVKHARIFLSGVIWVKDLGRLEFDKGRFLLPRKS
FT                   LPEVKQAVIELNDLIEAQSSEAKIA"
FT   gene            complement(498178..498381)
FT                   /locus_tag="Swoo_0402"
FT   CDS             complement(498178..498381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0402"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   sse:Ssed_4191 protein of unknown function DUF904"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84701"
FT                   /db_xref="GOA:B1KPD1"
FT                   /db_xref="InterPro:IPR009252"
FT                   /protein_id="ACA84701.1"
FT                   /translation="MSLELLSKLETKIQTALETIELLKMELEEEKQKSIGLAEQNQQLS
FT                   QDLNSWNEKVTGLVGLLNEEVN"
FT   gene            498661..499431
FT                   /locus_tag="Swoo_0403"
FT   CDS             498661..499431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0403"
FT                   /product="protein of unknown function DUF1223"
FT                   /note="PFAM: protein of unknown function DUF1223; KEGG:
FT                   shm:Shewmr7_0309 protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84702"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD2"
FT                   /protein_id="ACA84702.1"
FT                   /translation="MRFLVFLLIIFSWDSYGEQSLVDFKKQSKTTQPYIIELYTSQGCS
FT                   SCPPAESWLSGFVERDTLWQEYFPLAFHVTYWDYIGWKDPFGQRGFSQRQYDHLNAKNT
FT                   GQVYTPQFVINGEEWRGWFARDLLLGFNRQEQEVGVLKVAVNDKKLKASFLAAKKVKSD
FT                   SLKLHMALVGIGLNTYVRKGENRNVRLLHNFTVLEHQIFEPSGLTAGGDELLFSGDVAN
FT                   FNMQKGSPESLALVAWVEQEGKAIQAVGDWLSAK"
FT   gene            complement(499480..500055)
FT                   /locus_tag="Swoo_0404"
FT   CDS             complement(499480..500055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84703"
FT                   /db_xref="GOA:B1KPD3"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD3"
FT                   /protein_id="ACA84703.1"
FT                   /translation="MKKQSLAVAAVLATAISAPSMAADWFVGGAVGYQQDTYKIKETEN
FT                   GATESDKAKEKDMSYQLRVGTYLNDNNRVYGTYSYNSDDFAKQQSFLASYDYLVPLGAG
FT                   KKLNWFVGATAGMNHTSPDFDELSSKNTFVWGGQTGLMYKINDKLSTEIGYRYLKQDYD
FT                   VSASDTDYSAKFSLNDTQQVYLGVDYRF"
FT   sig_peptide     complement(499987..500055)
FT                   /locus_tag="Swoo_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(500325..500951)
FT                   /locus_tag="Swoo_0405"
FT   CDS             complement(500325..500951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84704"
FT                   /db_xref="GOA:B1KPD4"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR017690"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD4"
FT                   /protein_id="ACA84704.1"
FT                   /translation="MKKQSLALAALLATAMSAPTMAADWFVGGAVGAQKNVYKSSSTAA
FT                   DSVDPGFNAQADYWKNNDTNAIYEVRAGAYLNDNNRVYGTYSYNSDDYTKQQSVLMSYD
FT                   YLVGLGESNKLNWFIGATAGVNHTSPSTDHIGSSNNFVWGGQTGLMYKINDNLSTEIGY
FT                   RYLRQDVNETNQFSISNGVEAVTNVTVNNSLNDSQQVYLGLDYRF"
FT   sig_peptide     complement(500883..500951)
FT                   /locus_tag="Swoo_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            501352..502440
FT                   /locus_tag="Swoo_0406"
FT   CDS             501352..502440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0406"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: sse:Ssed_4176 branched-chain-amino-acid
FT                   transaminase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84705"
FT                   /db_xref="GOA:B1KPD5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD5"
FT                   /protein_id="ACA84705.1"
FT                   /translation="MQINYNLKPALERRTEQFEPETNVGFGNLRTDHMFLMDYRDGEWC
FT                   DPRVVPYGPFEVAPGAIALHYGQSVFEGAKAFQHDDGEIYTFRLNKNAERLNRSADILC
FT                   IPSLPESMQLAGINALIDVDRLWFPMQEGACLYIRPFIFATEDRLSVSPSQAYTFCVML
FT                   SPSGPYYADGFDKAIRLLISERFHRAVSGGTGASKAAGNYAASLKAGKAAAEYGAAQVL
FT                   YLDATNKQIEEVGAMNHFHILKDGTVIIPSFTDTILKSITSQSILELGDILGCEVRQET
FT                   VMLDKFISDIESGEIIEAGGFGTAAVVSPVGSYIFEDNRVVTVGDGQVGEHTRRLYQVL
FT                   TDIQKGKVQGPDGWMQHVARTV"
FT   gene            complement(502518..502958)
FT                   /locus_tag="Swoo_0407"
FT   CDS             complement(502518..502958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84706"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD6"
FT                   /protein_id="ACA84706.1"
FT                   /translation="MLLVFSLLKNIKIIIMIKSSFKGRSIRKAITISGLSLVLCGCANL
FT                   VHTQKDTQSNIDVTELGLYWVVKDGVLDWSVFSDDEVQHSFTAQFTINPEGKIEALKLS
FT                   ENQAGFNPSESQIAEFPKQEFNATTANYEKQAVTVSMFIGQD"
FT   sig_peptide     complement(502812..502958)
FT                   /locus_tag="Swoo_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.929 at
FT                   residue 49"
FT   gene            complement(503146..504069)
FT                   /locus_tag="Swoo_0408"
FT   CDS             complement(503146..504069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0408"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   sse:Ssed_4174 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84707"
FT                   /db_xref="GOA:B1KPD7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD7"
FT                   /protein_id="ACA84707.1"
FT                   /translation="MLNFLPASLLYLMSSLLLVINTTVWAGLISIGGIIKLFVPFTAGR
FT                   NLLTKIMNRFMWAWATCNGGILYLLADIEWDIQGLENLDKNSWYLLISNHLSGFDIAVQ
FT                   TYVLRNNIPMLKFFLKRELMFVPFLGLGCWALDMPFMSRTSPAKLKKNPKLKGKDLIST
FT                   RRACEKFKTMPTSIINYVEGSRFTEEKRVRQDSPYRYLLRPKAGGIAFTLSAMGEQFTH
FT                   LLNCTLVYPEAQSDPLSEVMHGKIKKIIVKIEVLPVPQVDNKRYFSEAPYRVEFQRWLN
FT                   QLWEEKDEQIHQVMLEHGVAKEDKPE"
FT   sig_peptide     complement(503989..504069)
FT                   /locus_tag="Swoo_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.988 at
FT                   residue 27"
FT   gene            complement(504077..504982)
FT                   /locus_tag="Swoo_0409"
FT   CDS             complement(504077..504982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0409"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   sse:Ssed_4173 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84708"
FT                   /db_xref="GOA:B1KPD8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD8"
FT                   /protein_id="ACA84708.1"
FT                   /translation="MGGILSLIRGSLAFVCWVVNTLFWVLPIVLLSPIKLIPIPALRTA
FT                   ISSLLDNCATAWISINGVIERIFHPVKIDLHSNAELTPKEWYMVIANHQSWVDILILQR
FT                   VLNRKIPFLKFFLKKELIFVPFLGLAWWALDFPFMRRYSTAQLRRNPKLKGKDIEITRR
FT                   ACAKFKSKPVSVMNFVEGTRFKAEKHQQQNSQFKHLLKPKAGGLAFALSAMGEHINKLV
FT                   NVSIYYPEKVPSYWEYISGQVKEVRVHITVTEIPDEMRGDYMKDRDFKIAFQEQLNLIW
FT                   QEKDQMLDLLAQDNQVKQKV"
FT   gene            complement(505100..506623)
FT                   /locus_tag="Swoo_0410"
FT   CDS             complement(505100..506623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0410"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: sse:Ssed_4171 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84709"
FT                   /db_xref="GOA:B1KPD9"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPD9"
FT                   /protein_id="ACA84709.1"
FT                   /translation="MAIACVATRASKGVDAPSVTVEVHLSNGLPAFNLVGLPETSVKEA
FT                   KERVRSAIINAGFEFPMRRITVNLAPADLPKQGGRYDLPIAIGILVASKQIPEKAIKDH
FT                   EFVGELALSGHIRQSQGLLPVIVEARQQGINLVLPLENRADAELVGYNRVYFASHLQGL
FT                   SEYLHGQSRLPGIESGLEWIEHEKEESQSCFSEVIGQYHAKHGLEIAAAGNHNILLLGP
FT                   PGTGKSMLASRMMQLLPPLGYDEALEVATLHSVAGHQIHPNAFYTRPFRNPHHTSSAIS
FT                   LVGGGSVPRPGEISLAHRGVLFLDEVVEFPRKVLDCLREPMETGEVVISRAAAKLTFSS
FT                   RFQLIAAMNPSPCGDLDNARATPDQIQRYLSRLSGPFLDRFDLTIEVPRLPAGALTQEN
FT                   KNAETSSTIAQRVKLARERQLNRAGVLNSELSGKQLKDLGRFKQADLLFLEQSVNKLNL
FT                   SIRSFHRLQRVSRTIADLQQSENVERNHIAQALGYRAMDRLLNSLKTSY"
FT   gene            complement(507312..508232)
FT                   /locus_tag="Swoo_0411"
FT   CDS             complement(507312..508232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0645 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84710"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE0"
FT                   /protein_id="ACA84710.1"
FT                   /translation="MEFIKTISDTFQSLAQNFNDRIKSPIGGAFFFSWIIFNWKLVYYI
FT                   LMQTESPSKKIAYVETHFLDIWPLLISPALASIAYVIFYPVIYNGSNLIWTFIDKNLKT
FT                   KVAVAIEKKVLLTTEDSQQLYNLIREQKTRHEEEVKKLRGQIEALSKITPSPQQIEPSF
FT                   IETVDTHLKPTDNAVGRHNKQTELPINQHDYDAEIKAKLTTEKGKKGLTALIMEMIDTN
FT                   ANSSANSANLSMYHLIIRTIFKSEPNGLSTQEIVQRVKNIDYVDVETLISDLENYKMVV
FT                   MDTNTREYTLTNRTINKIYSMLDQF"
FT   gene            complement(508245..508937)
FT                   /locus_tag="Swoo_0412"
FT   CDS             complement(508245..508937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84711"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE1"
FT                   /protein_id="ACA84711.1"
FT                   /translation="MNVEEGEKVSDIQKLWEFFLNHSLLVLTTFGLLASTIGYATQYTL
FT                   LKQFGVNFVNYAELDDFLLAAWKVPASSIYIIFMCLMVGFLYSITVAFKKSDDEFSKLN
FT                   PEKANQKKNKLGRYGIFFLSILGITFIFILAYSIFKMTIDSQLRVIQGQTSVAIVHLRS
FT                   GGCIPYKQDTSLSLISATSKFMFFYQQSDISGKIKTIAIPIASISNVEYMNNPKAMLNP
FT                   EPLTDNAE"
FT   gene            complement(508984..509715)
FT                   /pseudo
FT                   /locus_tag="Swoo_0413"
FT   gene            509886..511583
FT                   /locus_tag="Swoo_0414"
FT   CDS             509886..511583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0414"
FT                   /product="KAP P-loop domain protein"
FT                   /note="PFAM: KAP P-loop domain protein; KEGG: spl:Spea_0333
FT                   kap P-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84712"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE2"
FT                   /protein_id="ACA84712.1"
FT                   /translation="MTSEAKLDWSEPKKIDLGDGQFETLPADKLQRQEYADFIADFLAN
FT                   QGFEEASGERKNYVLNLNAEWGSGKTYFLRRLSEDLKQHHPVVYLDAWKQDYSEDPLMT
FT                   VVSSMISQLKSQARLTDVDEGTFEAPKKLLGLLKAAAPSIAGAFVKRYGGFDPLELWKN
FT                   SETEGVPPKTTGDTDSNEVDISATASQMVKELLCQHEDKSEAIESIKLNVKGWVEAVVG
FT                   LDTARDDYHRKFPAFVFIDELDRCRPSYAVEMLEVIKHIFDIEGVVFIVATDTAQLQHA
FT                   VKAIYGEGFDARTYLSRFFNSRFTLRQPSIDSLIYAHCDCDKLSGKYLKEKHIVVWPEC
FT                   ESYEHNISNINSVISCFGLPARTIIQITDRIIAILGHMKSGSKVDLLMLTALMSLREKN
FT                   EDVYEAVISNKFGLSEWSRGNQVKLNRYLTENYDFKNRAIMLNVDSNVPFDSQLEESLT
FT                   RYPDAVYKANLSHYMKDIFSIYLNSVESGYYSSGNIGRRLSAHIPLKEKLAQRICTYPA
FT                   NSDSHEDENTSNAWLDFYHSLHKLEDVEIAYYQNLIELASALEWDDQP"
FT   gene            complement(511965..513350)
FT                   /locus_tag="Swoo_0415"
FT   CDS             complement(511965..513350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_05630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84713"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE3"
FT                   /protein_id="ACA84713.1"
FT                   /translation="MGSIEIELEPEVSHLSAEQIEELYQKYLSGVKNSELIEEFSIETN
FT                   PNKLIKLLPPLLRDDCQCDYCDLPMLQKRKSKSGYSSAHPIECSACGHEVYENSYSNQQ
FT                   CRCKQCAQKRLEAKRVKELEDREKIESHYSVESKQPLPYSSLNFLEKLILLTLFRDHTD
FT                   GEFDCILSLNDSVRVDPLCPTESMTNEFIAHLYEAKVIVVDPKSRFSAFNEEEDFESFY
FT                   PLRVQWISNISIDAGTRADLKTLHLAIYRDLRENDKQSWGEELYGLLYLIATEEVLQYL
FT                   YYKADELDVQFGADKKAREVIQVLLENFSVSQIYYFVRKAVDNAHLFYSKGYSTGKKHA
FT                   GNTIPNKMMSLGERALKGEWSMYPSSRVSACPRSALSKVLFDLLLEDEDAGFTKSPELY
FT                   WMDELHPLFNSSEVGEFKPKPADEHGLACLECSSKAVKADMSNDRVALICHDCGAVHEF
FT                   KAL"
FT   gene            complement(514052..514168)
FT                   /locus_tag="Swoo_0416"
FT   CDS             complement(514052..514168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0416"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: sse:Ssed_4171 Mg chelatase, subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84714"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE4"
FT                   /protein_id="ACA84714.1"
FT                   /translation="MAIACVATRASKGVDAPSVTVEVHLSNGLPAFSKDWHL"
FT   gene            514392..515360
FT                   /locus_tag="Swoo_0417"
FT   CDS             514392..515360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0417"
FT                   /product="BAX protein"
FT                   /note="KEGG: vfi:VF1097 BAX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84715"
FT                   /db_xref="GOA:B1KPE5"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE5"
FT                   /protein_id="ACA84715.1"
FT                   /translation="MTPIRTLKAMLFIGVVAATEVMAASSGHTFETEFGAPLMPERIGQ
FT                   PYADVKEESTLSGAAQLSKMFAQSGYNLETVRQDNRAPELYVINLPDDLNQQPVESKIN
FT                   DFVRLLLPNVLAVNQQIFKVRQSLMSMAKRPTESLTAKETVWLQGLANDYGLKERDVKS
FT                   GKSKAVDIKLLLQHIDVIPTGMVLAQGIDESGWGTSHFAIQGNALYGEHLPQSGGKYLT
FT                   TPGGHVKVAAFDSLYQGTAAYIYNLNSSRAYHGLWQLRQQLRLQGKPVTGYELVGALVD
FT                   YSVRGQAYVDNLRSLIEHHQLDSYDNVELTPELGRKRIKFN"
FT   sig_peptide     514392..514463
FT                   /locus_tag="Swoo_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            complement(515370..516665)
FT                   /locus_tag="Swoo_0418"
FT   CDS             complement(515370..516665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0418"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   shn:Shewana3_3560 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84716"
FT                   /db_xref="GOA:B1KPE6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023867"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE6"
FT                   /protein_id="ACA84716.1"
FT                   /translation="MVQYSMKQSTYMDAAPLLSAEKDLNPHPAYVRRFHAMAKPTGSRC
FT                   NIDCQYCFYLHKKDLLGQPQQSHMSDETLSLFIQNYIDSQDGDEIIFSWQGGEPTLMGL
FT                   DFFKKVIQLQQRYCPLGVTIKNDLQTNGVLLNKEWAIFLKQHDFLVGLSIDGPQELHDM
FT                   YRVTRSGKPTFVLVMAAARILKKYGVQFNALAVINRKNVLYPKEVYRFLTQELGATYIQ
FT                   FTPCVEGNNFTQTAPQFWNEQMIPIIGSELSKPGHPMSVVTSWSVDPDDWGRFLISVFD
FT                   EWVNNDLGRVLVNLFETAVAQTMGLPAQICVMAEFCGKGIAVEHDGKVYSCDHYVYPEY
FT                   ELGNIHQSSLNNLVFSTRQETFGMAKRDSLPNYCKSCPHLNLCWGECPKNRLIRTPDGE
FT                   LGLNYLCSGLSQFFEHAKPILNGIAAILERKE"
FT   gene            complement(516720..518261)
FT                   /locus_tag="Swoo_0419"
FT   CDS             complement(516720..518261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0419"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: vvy:VVA0661 arylsulfatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84717"
FT                   /db_xref="GOA:B1KPE7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE7"
FT                   /protein_id="ACA84717.1"
FT                   /translation="MQIIKKNLMTTAITTALSSCAIHAYAADKPNILVIMGDDIGYWNL
FT                   STYNQGMLGYSTPNIDRIAKEGAKFTSYYAQQSSTAGRSAFITGQMPIRTGLTKVGFPG
FT                   AKQGISKQDPTMATLLKNLGYATGQFGKNHLGDLNEYLPTNHGFDEFMGNLYHLNSEEE
FT                   PEHSDYPKDPNFLKHFAPRGVLKSTAKSVEKDNPQGNISPSQGDVIDTGPLTRKRMETI
FT                   DNEFMSAASDFMERQVQSDTPFFIWVNPSRMHNFTHVPPQYKGKTGLNEYADGMLQHDD
FT                   QVGKLLDKVEKMGIDDNTIIIYTTDNGPMLSTWPDAGMAPFRGEKNTGWEGGFRVPTLI
FT                   KWPGQVQPGSVIREMFASEDWLPTLLAAAGETEIKNKLLNGYTVNELTYKVHLDGFDQR
FT                   KLIMGTGPTARQNFFYWSDDGDLLAMRYGRWKLHFNIQESSGIDVWRDPFTKLRAPLLF
FT                   DMETDPFERGDTGFGYDKWWYEHSFIMMPALAEIGKMKATLAAYPPRQKPASFVK"
FT   sig_peptide     complement(518181..518261)
FT                   /locus_tag="Swoo_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.944 at
FT                   residue 27"
FT   gene            complement(518348..520087)
FT                   /locus_tag="Swoo_0420"
FT   CDS             complement(518348..520087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_2796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84718"
FT                   /db_xref="GOA:B1KPE8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE8"
FT                   /protein_id="ACA84718.1"
FT                   /translation="MAEFDIIIKNGLYFDGTGKHATVKNIGIKAGKITQVCNEPLNEDH
FT                   CEKVITADKMWVMPGFIDTHTHYDAELIASPSLSESVRHGVTTVMVGSCSLSMICSEYE
FT                   DASDIFTRVETVPRERVLPIIKQHKTWNTPKQWVDFVKQHPLGPNVISMLGHSDLRAGV
FT                   MGLMRSTDADATPTESEMLQMEALLKESLEIGFLGLSTMRLKWDKIDGDRAWSKSLPST
FT                   YARWREVSRLNKLVRQYDRVHQGAPNAAAILQINQYMRECMGIFRKPLKTTLISRMDLK
FT                   GSVYLSKITNLAARVTNFFKGDFRWQVLPTPFTVYADGIDVVFFEEFGAGEMALDLKDQ
FT                   ISRNALLKDEKYRRDFRKFYGEKLSPRVWQRDFGDAIILDCPDASIIGKNFSDVAQNRD
FT                   VHVVDLFLDLVVEFGTSLRWYTTVANHRKHILKHMVKDDKSLITFSDAGAHIRNMAFYN
FT                   LPLRMLKLVKESIDEGQPMMSMEKAVWKMTGDQADWFGIDAGRIQIGDRADVTIINPQH
FT                   FKQNLEEVCWQEMENFNLQRLVNRNPDLVNTVLINGKLAFENNTLAPELGIDKGFGTFL
FT                   PAK"
FT   gene            520287..521339
FT                   /locus_tag="Swoo_0421"
FT   CDS             520287..521339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0421"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: reu:Reut_B3849 helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84719"
FT                   /db_xref="GOA:B1KPE9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPE9"
FT                   /protein_id="ACA84719.1"
FT                   /translation="MNETYLIRSAALQGFSDLVKSYDGEPAELLEAVGLSFEELNSKET
FT                   LISFLAVQQLLELSANKLNVPGFGLALSQGQNIDMLGQLGLLMASCKTLKDVMLSVQRY
FT                   MSLHSPAENWVFSEVNNLVYITRFEYEANTVPLKQIKELSLGVCFKFLQLFIGLSFTAT
FT                   RVELSHSPVSELKAYRKIFKVDVQFNQEYDQIIFDKKYLQQVVHLDDQNRNEFLEKYID
FT                   NAVSATDYNNLERQIMGLLIQYIGSENASLDNISRKLGMNKRTLQRQLKTQQINFKGIL
FT                   ANIRGRKACWYLSASEMSITLISEALGYKDVSAFSRAFKLLYGTSPSQWRKARGEFDCE
FT                   GDCVATGVGE"
FT   gene            521329..521853
FT                   /locus_tag="Swoo_0422"
FT   CDS             521329..521853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0422"
FT                   /product="BAX protein"
FT                   /note="KEGG: spl:Spea_3268 BAX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84720"
FT                   /db_xref="GOA:B1KPF0"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPF0"
FT                   /protein_id="ACA84720.1"
FT                   /translation="MANDYGLKERDVKSGKSKAVDIKLLLQNIDVIPTGMVLAQGIDES
FT                   GWGTGHFAIQGNALYGEHLPQSGGKYLTTPGGHVKVAAFDSLYQGTAAYIYNLNSSRAY
FT                   HGLWQLRQQLRVQGKSVTGYELVGALVDYSVRGQAYVDNLRSLIEHHHLDSYDNAKFNS
FT                   AEGRHLIRFKH"
FT   gene            522059..524488
FT                   /locus_tag="Swoo_0423"
FT   CDS             522059..524488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_1180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84721"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPF1"
FT                   /protein_id="ACA84721.1"
FT                   /translation="MLKKSLVSLCVTSALVSGCGSSDDNEPQVEVKNTAPTLSANFTPV
FT                   IEKSESTLSVSASDSDGSIASYLWEQTAGPELELTGIDSEQISFTAPMVSVDTPISFKV
FT                   TVTDNEGATTSVTEDTNIERIESIYKLAGKVVGEQYIGAKVTAAVGEESVEGLVDDAGS
FT                   FTLDLAVDDDVALNSSVKLSANGETLLGLSSLLPSLEQLGGLIIDAQASQKRQSVASQA
FT                   AQALENTPTISVSAVSTALYSLLVAANGGEEPSNIEVFELVESQVDPDALIEAAAVVQI
FT                   LINSDDAILEDGADLIAVLADPVQYNALVETIEEATPGAIEDAVDAVVADPELTPPVEA
FT                   ADIPSLYYRTSPVAPTFIARGGNRYEFAEDSTGEVATSYGVSSFTWSLNEGDIMLTYLE
FT                   DQGSVSYPSVDSIAGLTQEQIDKIHDVGIFQVEVTDERLTERMTRLTTGSALDTYRIEV
FT                   VTRVTMAPIELDTEVITIPAWGDTYSSDTLMRKSASGGVEFVDADIAGLWGFEVYNNEG
FT                   VNSLGSAATNHFEVLEFLTDGSGTSKDSGVEFDWSVSNGVLTIVFADFSQTYSVIDSNE
FT                   GDLAIYSEASDHDGKLLASLFGYGTQLDADTSFTAETAVTGSEQYWQSMINQWTASSWD
FT                   GDKLNFCYDTDNLDCTSWGSVFFGFQILDDSSGTRFYDVEGTPPNLTNYFGNELSWTVE
FT                   ANGKLKHTYVDWKCWDKDESCRNRQWRLLKTVDGRLGQRIYVQEFDQLKINSTDDWEYF
FT                   IAPRWNMYELIDLEYFNDVNTAQSNAATKRQSSSKQAITSVERTILEPTKAAQLHH"
FT   sig_peptide     522059..522127
FT                   /locus_tag="Swoo_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.896 at
FT                   residue 23"
FT   gene            complement(524713..525372)
FT                   /locus_tag="Swoo_0424"
FT   CDS             complement(524713..525372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0424"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   shn:Shewana3_0013 glutathione S-transferase, N-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84722"
FT                   /db_xref="GOA:B1KPF2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPF2"
FT                   /protein_id="ACA84722.1"
FT                   /translation="MELYIGNKNYSSWSLRAWLMLEKSGIEFNEIKLKLFTDSFYQQLK
FT                   EISPNLKVPALIDNDIKVWDSLAICEYINDAYMSGSAWPENLSQKAKARSFACEMHSGF
FT                   NALRNELPMNIRATRCIQLSEAAKKDIQRIDTIWSQQMDEFDTGKTGSWLFGTWSITDM
FT                   MFAPVVMRFHTYGVAVSDSSRRYMKHLTQSPEMQKWIAAALEETEIVNEDEAGVEL"
FT   gene            525487..526332
FT                   /locus_tag="Swoo_0425"
FT   CDS             525487..526332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0425"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: she:Shewmr4_0006 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84723"
FT                   /db_xref="GOA:B1KPF3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KPF3"
FT                   /protein_id="ACA84723.1"
FT                   /translation="MDIDALRSFIAFVETGSFTRAAKQTHKTQSAVSMQMKRLEGELGK
FT                   GLFEKEGRNLVLSVQGRRLALYAKPLLQLHDETVATLKSPDVRPRLHLGCPDDYADSIL
FT                   PSIVKLLHRYLPKLELQITCASSYLIRVMLDSGELDAAIVTRLPDSEEGYLLTTDVGVW
FT                   IGSEEMDITAQNPLPIVLFQKDCKFHLAAIDGLMKQGREYRLMASSSSATAIKGMVKQG
FT                   IGLGAMAKLSAGQDCFVIESESLPPLPSIGIALVISSRAHSPLSAELAQQLVKGFTEMT
FT                   "
FT   gene            complement(526371..527918)
FT                   /locus_tag="Swoo_0426"
FT   CDS             complement(526371..527918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0426"
FT                   /product="Protein-disulfide isomerase-like protein"
FT                   /note="KEGG: mgm:Mmc1_0444 DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84724"
FT                   /db_xref="GOA:B1KQ69"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ69"
FT                   /protein_id="ACA84724.1"
FT                   /translation="MQRSTLNLSLILALLLVACSDSEQPQLSSTELNERKVSKQLDIDS
FT                   GNRHQQIVATIDNEPVLMTQIDSSIQLKLFDLEWHKYQLRKAALETAVASKVEQQLTKS
FT                   TAPHVEILLTPPAAPRFFLPDTDKPIKGDPDAVVKLSLFCSFQSSHCARLQPELRTLET
FT                   RYGELINLVFYDLPQTFHRYGKAAANANLCAAESGSQWAYQEALYSNINQLNRERYLII
FT                   ANQLGLDSKSFSQCIDHNQYQDKLDSDQELAQRLGLGNVPVLFVNGLYTKGANTADGYG
FT                   YYINQELIRLGLPIPTTLPLRLVSTSVKDPTEDSRAKLQDLNNQTLTEYKHGDGLNLVS
FT                   RRGVNLDVTLTAIESQRVLLNNNGQKEFLRLSQGQDKPATVSMTPASNSSRDSSVSREP
FT                   SSAQVQRIEQLPTTAKMQLSRNWLSKHLQNKQQLAQHFQATEHQIEGVHLLKLTDIDRN
FT                   EFYKTLGLQSGDVVLQANNQWVHEGSNPLWDALGQNEITLLVMREGLPLRFDYKTKQ"
FT   sig_peptide     complement(527850..527918)
FT                   /locus_tag="Swoo_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.441 at
FT                   residue 23"
FT   gene            complement(528315..529976)
FT                   /locus_tag="Swoo_0427"
FT   CDS             complement(528315..529976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0427"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; KEGG: pha:PSHAa2649
FT                   serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84725"
FT                   /db_xref="GOA:B1KQ70"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ70"
FT                   /protein_id="ACA84725.1"
FT                   /translation="MKRLIKNQKLKNILALNMLMLSGNALAATALENATPASGLSGTSG
FT                   SETFFTLTVPEGATNLNFNTAGGSGDADLYVKFGSAPTSSSYDCRPYNSGNSESCDIAN
FT                   VQNGEYHVMLKAYSAYSALTLTASYDEPGTTPPPGSNTGVLENSVALNNLTGSSGEQLL
FT                   FTFEVPAGAQDLSIAMSGGTGDADLYVRFGAEATTGTYDCRPYKSGNNETCTISNIQAG
FT                   TYHVMMNGYSSFSGVSLVGNYNEGGTPPPPGPVAGVANIAVVGDSITRAFGADCTYNSS
FT                   WWSLLCLAGGDQPEHSWFDGSSSSVTSVHDRYKVLDNSINSNNSAATGAELTGIREDGS
FT                   EPSFAAQANTIVAQTPTPDHVELLFGGNDLCSRDCVDPSNCSDPIYSDDEWRQAIRTGL
FT                   NTLVSGMPEGSSILLGSVPRVQDIRQAGLDKQAGDEYINCESIWSSYDVCSIVTQSGTL
FT                   NGESLASRIAGVAAAQKRYNAILAEEATAYNSNNNGQNPNGIEVVAEYVDESTPSGGTF
FT                   QFGASHINGGDCFHPNVATQTLISELMWNSNTDKPE"
FT   sig_peptide     complement(529893..529976)
FT                   /locus_tag="Swoo_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            530232..531257
FT                   /locus_tag="Swoo_0428"
FT   CDS             530232..531257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0428"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: abo:ABO_1250 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84726"
FT                   /db_xref="GOA:B1KQ71"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ71"
FT                   /protein_id="ACA84726.1"
FT                   /translation="MKNLIVSHNYFTLISGYLNRVRQQHSGTDRSSNQRESDPLEERSV
FT                   YLIEDIEKLIEQILSVSDDLSFGLVLGENIHPSDYGLVGYALMNCPDLNTALSLSSKYK
FT                   PVMNQAFESFFIQGERESSYQVRPKFDEVYLTSLVELDFASGIQLAKLLVDKQDLPKLK
FT                   LQQVNFQHGPLSCPSHYQRVFNCPVNFHQERSEIIIANSVLALPVRSANPAILDMLLRK
FT                   IDKAVKSYSLGQSFSSKVICYVSKHQQDIPSAKQAASDFNISLSTLKKHLMSEGRNYSE
FT                   ICDSIRKNMAIKMVADPKTQIKAIYSSLNFSSSSAFNRAFKRWTSMTPTEYRHKMSLSL
FT                   K"
FT   gene            complement(531361..532293)
FT                   /locus_tag="Swoo_0429"
FT   CDS             complement(531361..532293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0429"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: sfr:Sfri_0220 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84727"
FT                   /db_xref="GOA:B1KQ72"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /protein_id="ACA84727.1"
FT                   /translation="MNIQGRFMSKQWLSRLKGYVQVIKPGIIMGNLISVTGGFLLAAKG
FT                   SVDLTLMLMTILGLSLVVASGCGLNNCIDRDIDAKMQRTRNRVTVTGEISVYSVLVFSL
FT                   ALGLIGFGLLAIFTNKIALLFAVIGYLVYVGIYSLYMKRHSVYGTLIGSFSGAVPPVVG
FT                   YCAVTGEIDTGAVILLLMFSLWQMPHSYAIAIFRYKDYAAAKIPVLPVAKGMTRAKLHI
FT                   VLYIAVFSLVSALLPLAGYTGIAFMAVTCATSLWWLGMALKGYQRDINLNQWARQVFGC
FT                   SIVTITALSIAMAMDFQLVVQTPLLTLSN"
FT   gene            complement(532306..532641)
FT                   /locus_tag="Swoo_0430"
FT   CDS             complement(532306..532641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0430"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG:
FT                   shw:Sputw3181_0092 cytochrome c oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84728"
FT                   /db_xref="GOA:B1KQ73"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ73"
FT                   /protein_id="ACA84728.1"
FT                   /translation="MNQVETVESNSSANFMGSVKSYLMGFMLSVVLTAIPFWAVITHHF
FT                   DKPVTLGLVLVTAVVQIVVHLKYFLHLDFSKEGKLNTFSFLFTALIIVMVVGLSVWIIY
FT                   AANDLMM"
FT   gene            complement(532641..533288)
FT                   /locus_tag="Swoo_0431"
FT   CDS             complement(532641..533288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0431"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase, subunit
FT                   III; PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   sfr:Sfri_0222 cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84729"
FT                   /db_xref="GOA:B1KQ74"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ74"
FT                   /protein_id="ACA84729.1"
FT                   /translation="MSIAIRANLGVADANKHYDVSHATSHDEHHDTSENTLFGFWLYLM
FT                   TDCILFASVFATYAVLYMNTDGGVSGKDIFELNFVLIETAALLVSSITFGFALICAKHQ
FT                   KKAATLGWLLITFALGCAFIGMEIYEFHHLIEHGNGPQRSAFLSSFFALVGMHGLHVTA
FT                   GLVWMAIMMFEVLKTGLNKRSITRLGCLSLFWHFLDIVWICVFTVVYLLGAM"
FT   gene            complement(533285..535270)
FT                   /locus_tag="Swoo_0432"
FT   CDS             complement(533285..535270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0432"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: shm:Shewmr7_3915 cytochrome-c oxidase;
FT                   TIGRFAM: cytochrome o ubiquinol oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84730"
FT                   /db_xref="GOA:B1KQ75"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ75"
FT                   /protein_id="ACA84730.1"
FT                   /translation="MSFLGKLTLESIPYHEPIIMVTLAVVALIGVIIAALITKHKKWAV
FT                   LWNDWFTSVDHKRLGIMYIILALVMLIRGFSDAIMMRTQQALATNGAAGYLPPEHYDQI
FT                   FTAHGVIMIIFMAMPFMIGLMNLIVPLQIGARDVAFPFLNNLSFWLTASGAVLINISLG
FT                   LGEFAKTGWVAYPPLSELSFSPGVGVDYYIWALQISGIGTTLTGVNFIATVLKMRAPGM
FT                   KLMQMPIFTWTCTWANILIVASFPILTAVLAMLTLDRYLGFHFFTNAGGGNAMMYINLF
FT                   WAWGHPEVYILILPAFGIFSEIISTFTSKRLFGYKSMVWASGAISILGFIVWLHHFFTM
FT                   GSSANVNAFFGVMTMVIAVPTGVKLFNWLFTIYRGRLRLTVPVLWTLGFMTTFTIGGMT
FT                   GVLLAVPGADYVLHNSLFLIAHFHNTIIGGAVFGYLAGFAYWFPKAMGFKLNERLGKAA
FT                   FWCWQVGFYVAFMPLYVLGFLGMTRRIGHTDNPDWNFWIYLAAIGAFIILAGIILQFVQ
FT                   LYVSFRDREQNLDTTGDPWNGHTLEWSTSSPPQFYNFAKDPHVSDIDCFTDMKEKGEAY
FT                   QRHDAYEPIHMPKNTASGILMALGITAAGFAAIWHILWLAIAGILGAFVVFLCRAYSND
FT                   HDYYVQPDEVARIENAHLDKVARGLI"
FT   gene            complement(535273..536193)
FT                   /locus_tag="Swoo_0433"
FT   CDS             complement(535273..536193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0433"
FT                   /product="ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: ubiquinol oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; COX aromatic rich domain
FT                   protein; KEGG: shn:Shewana3_4031 ubiquinol oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84731"
FT                   /db_xref="GOA:B1KQ76"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR012141"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ76"
FT                   /protein_id="ACA84731.1"
FT                   /translation="MLIRNLSKAALTASVIMMSGCEGGVLDPKGQIGIDEKHLIVVATL
FT                   LMLIVVIPVIFMTLYFAWKYRDGRDHEIFAPKWAHSKSIEIIVWLVPVVIVIILGVITW
FT                   GSTHDLDPYKPLEHEAKPITVEVVSLNWKWLFIYPELGIASVNELAFPANVPVNFKITS
FT                   DTAMNSFFIPQLGSQIYSMAGMATQLHLIANEPGTFDGISANYSGAGFAGMKFKAIATA
FT                   NTQEFDTWVAKVKQQKYKLDRQSYQALAKPSENNPVEYYGEVSQGMFDHIVMQYMYMGD
FT                   PMPMDKKIDMSSPSGHSSSNHLEME"
FT   sig_peptide     complement(536122..536193)
FT                   /locus_tag="Swoo_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.836 at
FT                   residue 24"
FT   gene            complement(536372..536761)
FT                   /locus_tag="Swoo_0434"
FT   CDS             complement(536372..536761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84732"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ77"
FT                   /protein_id="ACA84732.1"
FT                   /translation="MKLTPNLSLIEKLPSLVKLSSTGKANFSLFLGGLFLLCLSDAAPA
FT                   TLGGYLDISELIAVSDGLIIECLGVSLFGLFLVNPQIINQFWRLISYIFKLINGLNLVS
FT                   RFPRFSSPVFKSCEQTAHGCRAPPL"
FT   sig_peptide     complement(536633..536761)
FT                   /locus_tag="Swoo_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.881 at
FT                   residue 43"
FT   gene            537215..537751
FT                   /locus_tag="Swoo_0435"
FT   CDS             537215..537751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0435"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   reh:H16_A1912 MIP-(macrophage infectivity potentiator)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84733"
FT                   /db_xref="GOA:B1KQ78"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ78"
FT                   /protein_id="ACA84733.1"
FT                   /translation="MANLHPVEIASASDAQQLLFKKVEGAFGAVPNMFRTIGHSSAALE
FT                   SMWTSFGALGKGSISPALGEQIAVLVADINRCEYCLSAHTVLGKNAGVTKEEMELAQRG
FT                   VSNDLKVQAALDFAKKLVTQHGQVSRDDIGLVKGAGFSDAELTEILAHVALNIFTNYTN
FT                   VAFDVEVDFPKVSLS"
FT   gene            537833..538087
FT                   /locus_tag="Swoo_0436"
FT   CDS             537833..538087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_4903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84734"
FT                   /db_xref="InterPro:IPR018592"
FT                   /db_xref="InterPro:IPR023122"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ79"
FT                   /protein_id="ACA84734.1"
FT                   /translation="MQVHVFDTHVTTLAKQYVHFDVLVDDKNRERVKEYAKVYLDSLGI
FT                   NVESISQSRCDFCHSEMANPEVIASIEQHGFCIIPLKVA"
FT   gene            538113..538358
FT                   /locus_tag="Swoo_0437"
FT   CDS             538113..538358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0437"
FT                   /product="transcriptional antiterminator, Rof"
FT                   /note="PFAM: Modulator of Rho-dependent transcription
FT                   termination; KEGG: vvy:VVA1468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84735"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ80"
FT                   /protein_id="ACA84735.1"
FT                   /translation="MIKCDIYDYIEVACLYKIEVLLTLHSGEEVKGVADTTSINGDKQE
FT                   FLVIKQGTETLNIELVSIKNMKALTPNPHFSSLDIY"
FT   gene            538527..539327
FT                   /locus_tag="Swoo_0438"
FT   CDS             538527..539327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0438"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: sse:Ssed_4170 serine O-acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase; PFAM: transferase
FT                   hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84736"
FT                   /db_xref="GOA:B1KQ81"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ81"
FT                   /protein_id="ACA84736.1"
FT                   /translation="MRYEVWEQLRVEAETLVQKEPLLASHVYSSVLNHECLGSALSFIV
FT                   ANKLSDGVVSPFTFRELFDKAFIHCEQMLTNVATDIKAVKERDPAVESYLTVLLNLKGF
FT                   QAIQVHRLASCLWHQGRTELAQFIQSRNSEVFGVDIHPACKMGTGIMFDHATGIVIGET
FT                   AVIENNVSLLQGVTLGGTGNQQGDRHPKIRAGVLIGAGAKVLGNIEVGEGAKVGAGSVV
FT                   LADVDAHTTVVGVPAKVVGKPVSACPAETMDQTFYESDDCQRQS"
FT   gene            complement(539345..540148)
FT                   /locus_tag="Swoo_0439"
FT   CDS             complement(539345..540148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0439"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: sse:Ssed_4169 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84737"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ82"
FT                   /protein_id="ACA84737.1"
FT                   /translation="MSNIAIALVTTGLLGLISAVMPTHQICNIPDHQHKGWVLLLTMIF
FT                   MFIFGYLGYIWMLIDRDIGTLELIVATIFCGGGGFVFVISRMSKETIFKLQQTIHEKHY
FT                   QAHHDLLTNLANRHQFYEELDSLISNEHHVFSCLMMDLNDFKMVNDTLGHAEGDHVLQV
FT                   VAKRIQRILPKRGVAARLGGDEFAVVLPGMTLQGAIEISKTIQDTLSKDIQCENHALVI
FT                   GISIGIAEYPKHGTNKKEIMKHADIAMYKAKATDGNYRVYSSHLD"
FT   sig_peptide     complement(540089..540148)
FT                   /locus_tag="Swoo_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.481 at
FT                   residue 20"
FT   gene            complement(540337..541209)
FT                   /locus_tag="Swoo_0440"
FT   CDS             complement(540337..541209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0440"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_4167 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84738"
FT                   /db_xref="GOA:B1KQ83"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ83"
FT                   /protein_id="ACA84738.1"
FT                   /translation="MDIKTIKLYLHLSESLHFSRTAQAMHVSPSTLSRAMQRLEDEVGA
FT                   KLFQRDNRSVSLTSAGVEYRHFAEQTLDHWSKLKTKIDPKQDLLRGRLNLYCSVTAAYS
FT                   HLPGLLDSFRREHPLVEIALTTGDAANAVNEVKNNRADVAIAALPDPFPDSLHFVKIDD
FT                   VPLVIIAPTYRCQVQELLSESYIPWDRLPFIVPEHGPGRRRVDNWFKQLGLSPNIYAQV
FT                   SGQEAIASMVALGCGVSITPDVVINNSPVRDRIQIIPSPIEIPPFELGCCCKTKSQKDP
FT                   IISAFLKVL"
FT   gene            541388..542869
FT                   /locus_tag="Swoo_0441"
FT   CDS             541388..542869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0441"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: sse:Ssed_4166 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84739"
FT                   /db_xref="GOA:B1KQ84"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ84"
FT                   /protein_id="ACA84739.1"
FT                   /translation="MANYFNSLNLRQQLEQLAQCRFMDRSEFSEGCDFIKGWNIVILGC
FT                   GAQGLNQGLNMRDSGLNIAYALRAEAIEEKRASYQKATGNGFRVGTIEELIPEADLVLN
FT                   LTPDKQHTDAVTRVMPLMKQGSTLSYSHGFNIVEEGMQVREDITVIMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGQGFDIAKAYASATGGDRAGVLHSSFIAEVKSDLMGEQ
FT                   TILCGMLQTGAILGYEKMVADGVEPGYAAKLIQQGWETTTEALKHGGITNMMDRLSNPA
FT                   KIKAFEMAEELKGILAPLFEKHMDDIIGGEFSKTMMADWANDDANLLKWRKETGETAFE
FT                   NAPQSDESIDEQTYFDKGIFLVAMIKAGVELAFDTMVSAGIIEESAYYESLHETPLIAN
FT                   TIARKRLYEMNVVISDTAEYGCYLFNHAAVPMLREYVQNMSPEFLGRGLSDGSNGVDNQ
FT                   RLIEVNAAIRGTGVEKIGAELRGYMTAMQRIVEEK"
FT   gene            543383..545071
FT                   /locus_tag="Swoo_0442"
FT   CDS             543383..545071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0442"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: sse:Ssed_4165 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84740"
FT                   /db_xref="GOA:B1KQ85"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ85"
FT                   /protein_id="ACA84740.1"
FT                   /translation="MEQGQNKQGQMMRGADAVIKVLTAHGVTNIFGYPGGAIMPIYDAL
FT                   YGAPVEHLLSRHEQGAAFAALGYARASGKTGVCFATSGPGATNLVTSLADALLDSVPVV
FT                   AITGQVSTAVIGTDAFQEIDVLGMSLSCTKHSFMVTEMDELVPTLYKAFEIAASGRPGP
FT                   VLVDIPKDIQIGMLEYKTPLQDRVEEPELDTAKLDDAVTLLTQAKKPMLYVGGGVGMAS
FT                   AVEPLRKFIRVTGVPSVATLKGLGSIAHDTPGYLGMLGMHGSKAANIAVQECDLLIVVG
FT                   ARFDDRVTGRLATFAEHAKVIHLDIDAAELGKLRLPEVAIDGDLRQILPALATPLDITP
FT                   WQEEIASLKVEHQWNYDRPGELIFAPAMLNRLADKLPDDSVVCCDVGQHQMWVAQHMWF
FT                   RKPEDHLSSAGLGTMGFGLPAAIGAKVSRPDATVVAVSGDGSFMMNVQELTTIKRRKLA
FT                   VKILLIDNQKLGMVKQWQQLFFEERYSETDLSDNPDFVTMASAFDIPGRTITTSDEVEA
FT                   ALEHLVNCDGPYLLHVRIDDAHNVWPLVPPGACNRDMMEEMDKST"
FT   gene            545129..545383
FT                   /locus_tag="Swoo_0443"
FT   CDS             545129..545383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0443"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   sse:Ssed_4164 acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84741"
FT                   /db_xref="GOA:B1KQ86"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ86"
FT                   /protein_id="ACA84741.1"
FT                   /translation="MKHTVNLTLEQRPEVLERVLRVVRHRGFKVTKMNMSLESEKVADL
FT                   DMTVESERAIELLTKQLDKLVDVLSCNASEHRVPERLVS"
FT   gene            545475..546398
FT                   /locus_tag="Swoo_0444"
FT   CDS             545475..546398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0444"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: sse:Ssed_4163
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84742"
FT                   /db_xref="GOA:B1KQ87"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ87"
FT                   /protein_id="ACA84742.1"
FT                   /translation="MTAKRAEYIWFNGEIMPWGDAKVHVMSHGLHYGSSVFEGIRVYDT
FT                   HLGPAGFRLTPHVERLYDSAKIYRMPIPYSFDELMQSCTDIVKKNDLKSAYIRPLAFYG
FT                   DVGMGITPPKDAVCDVMVAAFPWGAYLGEDSMEAGVDVAVTSWNRLAPNTIPTGAKAGG
FT                   NYLSSIQISTEAKRNGFDEGIALDVNGLVSEGAGANLFVVKKGKIYTPPATAAILMGLT
FT                   RDSIMVLARDLGYEVVEEAMSREFLYLADEIFMTGTAAEIVPVRSVDRIEVGEGKRGAI
FT                   TKQIQQSFFGLFDGSTEDKWGWLEVL"
FT   gene            546946..548796
FT                   /locus_tag="Swoo_0445"
FT   CDS             546946..548796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0445"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: sse:Ssed_4162 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84743"
FT                   /db_xref="GOA:B1KQ88"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /protein_id="ACA84743.1"
FT                   /translation="MPKLRSATSTQGRNMAGARALWRATGVKDSDFGKPIIAISNSFTQ
FT                   FVPGHVHLKDMGSLVAGAIEEAGGIAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADALVCISNCDKITPGMMMAALRLNIPVIFVSGGPMEAGKTKLSGDIIKLD
FT                   LVDAMVAGADERVSDEDSEKIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADRRELFLEAGRRIMDLATRYYKHDDESALPRNIANFNAFENAMTLDIAMGGSSNT
FT                   VLHLLAGAQEAKVDFTMDDIDRLSRKVPHLCKVAPSTPKYHMEDVHRAGGVMGILGELD
FT                   RAGLIHNDAYHVAGKNLKEVLAKWDIAQSQDEAVRKFFSAGPAGIPTTKAFSQDCRWDS
FT                   VDDDREGGCIRKREFAFSQEGGLAVLSGNIALDGCIVKTAGVEEENHTFIGSARVYESQ
FT                   DDAVAGILGGEVVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSRGLGKACALITDGRFS
FT                   GGTSGLSIGHVSPEAAAGGTIGLVETGDRIEIDIPARSIKLAISDVELAARRSAMESRG
FT                   KQAWKPVDRIREVSLALKAYALLATSADKGAVRDVSKLED"
FT   gene            548798..550348
FT                   /locus_tag="Swoo_0446"
FT   CDS             548798..550348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0446"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: sse:Ssed_4161 threonine dehydratase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84744"
FT                   /db_xref="GOA:B1KQ89"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ89"
FT                   /protein_id="ACA84744.1"
FT                   /translation="MLALASKSKLDLAHYYLQKTLLSSVYDVAKVTPLSSLNKLSARLG
FT                   CQVFLKREDMQPVHSFKLRGAYNKMSELTAQECECGVVCASAGNHAQGVAMSAAARGIS
FT                   AVIVMPETTPDIKVDAVRRLGGEVVLHGQAFDQANAYAQNLAKTEGRVYVAPFDDEAVI
FT                   AGQGTVAQEMLQQQRDLEVVFVPVGGGGLIAGIAAYYKAVMPQVKIIGVEPEDSACLKA
FT                   ALEADERVVLAQVGLFADGVAVKQIGAEPFRLAREYVDSVVTVTSDEICASVKDIFEDT
FT                   RAIAEPAGALALAGLKKYMGSEGRGEKVAAILSGANVNFHSLRYVSERCELGEKKEAIL
FT                   AVKVPERPGIFLRFCELLEKRVMTEFNYRFSSRDKAVVFAGIRLSQGQEELDEIVARLE
FT                   SDGFEVQDLSHDETAKLHVRYMVGGHPPEALEERLFSFEFPEHPGALFKFLTTLQSKWN
FT                   ISLFHYRNHGAAYGRVLAGFEVPESDSLAFQQFLTELGFVYQEETQSPAYKLFLDNRD"
FT   gene            550632..551774
FT                   /locus_tag="Swoo_0447"
FT   CDS             550632..551774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0447"
FT                   /product="Serine--pyruvate transaminase"
FT                   /EC_number="2.6.1.51"
FT                   /note="PFAM: aminotransferase class V; KEGG: sse:Ssed_4160
FT                   serine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84745"
FT                   /db_xref="GOA:B1KQ90"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ90"
FT                   /protein_id="ACA84745.1"
FT                   /translation="MLVAPKIDAFNPPRRTLMGPGPSDVYPEVLAAQARPTIGHLDPLF
FT                   VAMMDELKSLIQYAFQTKNEMTLAVSAPGSAGMETCFVNLVEAGEKVIVCRNGVFGERM
FT                   RQNVERVGATAVMVDNEWGEPVSVSDVEATLKANPDAKFLAFVHAETSTGALSDAKSLC
FT                   ALAKQHGCLSIVDAVTSVGGVELRVDEWGIDAIYAGSQKCLSCVPGLSPVSFSPAAVEK
FT                   IKARKTPVQSWFLDQTLVMGYWSGNAAAGGKRSYHHTAPVNALYALHESLRLLANEGLE
FT                   SAWQRHADMHQVLRQGLEGLGLKFVVDETSRLPQLNAVYIPEGVDDAAVRNQLLQNYNL
FT                   EIGAGLGALAGKAWRIGLMGFGARRENVALCLKALEDVLK"
FT   gene            complement(551850..553784)
FT                   /locus_tag="Swoo_0448"
FT   CDS             complement(551850..553784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84746"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ91"
FT                   /protein_id="ACA84746.1"
FT                   /translation="MKRIHIELIFIITLVVAITSYFLWPSPQIAPTHIEHVNTEANLNT
FT                   ANITETVILNYSNKPVFSYQKCKQLIKNNYVKSNDFGRKQNWSKYLDEGYSVDEITSAI
FT                   DHFSNSNFAASWRAEQLKKQSTLNLNILKINELLKVEIPDLPEDFSFTVAVPNPALENI
FT                   TNLTEKAALQLIKTTELSIDDVAWLIEQEEVSQHILTEAINRLDDINQLLGYETISDEQ
FT                   LLLIDVAAFEGRNNIVNQLLQRHSNISNDPYLGSTMEHALAKLTYVLGKNIESDAVIRQ
FT                   VNIIEQLQSLNAPAFFETQTDQLVSGGYPRNYYKFTEEQLASLSAHYQLDLTQVQTREK
FT                   LAFDPDAKLIVKLSQERALLLEKEVTQEQLHTCKAKVSAVDKRWQPKNLSHYTVQLKNE
FT                   NREVNAANLNSIDPVLADCFMATQTSYLRYSRPKNKELESEVFALHLRKNNILEAIKAI
FT                   ESANLTEEQLRWFFYQIIPWDTAYYQPLQSSQLKQEQIDFNLLMMFGRSNSAYFEELRI
FT                   NGIDITGMDHTGKSLIYLSVEKRNLELLSYLVSQRADYHLNPIGIDPLYLIIDSSYHFN
FT                   PNTVLDYLESLMQLSPPVHSYHKRALALLRLKYPELYQQISARFEELTITEDTPLPQAS
FT                   CYGNNLNSR"
FT   gene            complement(553934..555064)
FT                   /locus_tag="Swoo_0449"
FT   CDS             complement(553934..555064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0449"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold"
FT                   /note="KEGG: slo:Shew_0298 Zn-dependent hydrolase of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84747"
FT                   /db_xref="GOA:B1KQ92"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ92"
FT                   /protein_id="ACA84747.1"
FT                   /translation="MKPLIAITLTLIFGGAMLTMTTSSIEPSINNAKGTHHSDKGGYIN
FT                   TAADFTEETAILPLLMRYATEKRVDAEPEQMQPIIELTSKQLMELPSDQDMVIRLGHSS
FT                   IFMQLDGKKWLIDPVFSERASPFSFIGPKRFHPTPISLKDLPEIDGVLISHDHYDHLDK
FT                   ATIKHLASTSTQFIVPLGVDKHLLRWGVAANKVQSLDWWESFNLGSTKITAMPTQHFSG
FT                   RGIFDKNETLWASYVIESQQNKIYFSGDSGYFAGFKEIGDRFGPFTLTMVETGAYDADW
FT                   PTIHMTPEQSLQAHIDLRGETMMPIHNGTFDLAFHSWYEPLERIVKLANDTDVKLATPM
FT                   MGQGLTLKNNQLNTSQLSTTEYWWRTETQREMALAL"
FT   sig_peptide     complement(554990..555064)
FT                   /locus_tag="Swoo_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.482 at
FT                   residue 25"
FT   gene            555196..555801
FT                   /locus_tag="Swoo_0450"
FT   CDS             555196..555801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0450"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: slo:Shew_0299
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84748"
FT                   /db_xref="GOA:B1KQ93"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ93"
FT                   /protein_id="ACA84748.1"
FT                   /translation="MDKKISRSELKRRAIIGAAMSEFQTKGFKATSMDDVAKRAEVSKR
FT                   TVYNHFSSKEALFSAIILEMMALLCAFEYFTFSDDIALEVQLEKLVDIEVEQLKSQAFM
FT                   DMARVIIAEAVHSPELIQGAMDEFNKQETPLNTWFQAALEAGALKGQSHEIIVTQFVGV
FT                   IKAFCFWPQLLQGAAFPSDEEVVAIKKTVVEMVLKQYS"
FT   gene            complement(555916..559374)
FT                   /locus_tag="Swoo_0451"
FT   CDS             complement(555916..559374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0451"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="PFAM: protein of unknown function DUF1566; KEGG:
FT                   shw:Sputw3181_0674 protein of unknown function DUF1566"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84749"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ94"
FT                   /protein_id="ACA84749.1"
FT                   /translation="MNVLTRLSILLIMITGLGACGGSDKSTTPEPEKPNPVIEPKTELK
FT                   GIPDSFQVKACIDEDADFTCDATPVAITEVYKGIDIDKLAPDARVLIELAPPEATGIGS
FT                   FIAFEGKRFMSFPVGEEEASPFNLLALGVVQYAQELGEDWCCGHAIPLNLKEAKSYLAQ
FT                   NFKLDGSGQQNEAILQAFNSNLEQLGGNGLSLKQAYDADIKAMAESLVDLTLHSQSICD
FT                   RVPEYCEGNPDDPYPPIDLSNIVPCITAYDGGSCVAQIPKLQVESTVTDEMFRLTQKEA
FT                   GNIAYNIRSREKEPLPFEKAFEQLTCKDDEEKQVFMYGVGDNFATTNIENTSPSAALTA
FT                   WLGTVPNNLVHPYDFDASISPANPNIFADTLSNLPSDLTNGLLVMGLKERGFTLSDTPN
FT                   YFDIFAIGDATNISSNANVSGTVSDIRSSWQSVSPNVYFENLQNIQNQAGTQSLLDKLH
FT                   AGQTDLDLVMMPTTNVDFVAVAACRVKAPQKPIETPVKEVISVLTEKFTCNAEQGETYY
FT                   EIVGGEPDDFTPGSDQNTPSTALSSLTGTLVTYDQIEAKDSTFIDTLALPSGSSITKAQ
FT                   FMINARATSPSAANDKVFLANTPLNNMVTGFTTTAPGALVTQWPNGTLNGGAAYIIDGL
FT                   FNIPSLPTTPNLLTILNSANASGSGLDILVSENTEVDTTLLQLCINTGDQPCVDTDGDG
FT                   YCDEEEKDAGSDPTNPDSTPIDLDGDGALNDDDCDPNDPTVTDQCNEVIYTDVLPESCS
FT                   EYVTVDLSLANSWANSAGNPPVVNNVFDGTQYQGIVWDGALSWFDFGSASNVTHKLNQD
FT                   FCSCGGGKVVIDEFKSDNMGYIDLNNLTNQTANRIVSRTQYSQSTMASWGPSESGSNTF
FT                   SGTGNGVDFNLELGVQNVSGPSGGAVKGRLEFIGHLGACTTQDVVDNSGGTGTVGGVGP
FT                   AINVGSIAVTHELLSNLPVIQETTAPFIKLDDNGNPLAEQTLPWSDTGSESEGTQWSCV
FT                   KDVATNLIWEVKRNSNGIKKESLHDADDVYAWFDPDPTTNGGFSGANTSGNFCFGFDAN
FT                   DSSTFCNSQRFEDSVNNADFCGSADGWRLPTIEELEGLVDTNYATPMINGAYFPNTPLQ
FT                   SAFWSSTTNPNDSNKAEHLFFYNGQSYNSTSKTYTAASVRLVRDQ"
FT   sig_peptide     complement(559297..559374)
FT                   /locus_tag="Swoo_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.459 at
FT                   residue 26"
FT   gene            complement(559892..561880)
FT                   /locus_tag="Swoo_0452"
FT   CDS             complement(559892..561880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0452"
FT                   /product="TonB-dependent copper receptor"
FT                   /note="TIGRFAM: TonB-dependent copper receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: sse:Ssed_4157 TonB-dependent copper receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84750"
FT                   /db_xref="GOA:B1KQ95"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ95"
FT                   /protein_id="ACA84750.1"
FT                   /translation="MNRHKQILTSLFTASSCILSPFSTFADTQGCEQDSCDEHIVVTGE
FT                   LMREPAKVFTDPKKPRLPLPAYDGAGFLKTIPGFSIGRKGGAGGDPSLRGLGGSRLSIV
FT                   DDGQHVYGTCGGRMDPPTAYIYPEAYDNITVIKGPQTVKYGPVGSAGTVLFEKDRHSFS
FT                   EQDMEGRASITGGSADRRDYLVELKAGDEKHYLDLDINQSSSDHYQDGSGNSVQSSYDR
FT                   NNYNLALGWTPTDSSVIELAYGQSSGEAEYADRANKAREISNENLTLLAQFEFDSELIN
FT                   GLEFQAYTNENNHIMDQFDQGVNSGSNVRRSTYGGHLWLDLTLGDNWQATVGVDYMSSA
FT                   HEGRAITANVDFGLDDLLSKPFNDNMRYENSGLFIEASVDMGKGTLLSGLRFDHWQTKL
FT                   FVAQQGKRTDELYSGFLRYELLSGNSQYYLGAGHAQRIPDYWEIMKSSSANSAEKAFDL
FT                   EPEKTTQMDIGWIYQADVELSSSLFYGQIDDYILIDANTKSASAYNIDATVWGGEFGIS
FT                   YPFSDNLSAQTTLSYSRGQNDSQDVPLGQIPPLEGRLSLDYQDGNWTAGLLWRVVAAQD
FT                   RVSIGQGNISGQDLGESSGFGTLAVNGTWKHGDAILVSLGIENLFDITYAEHISRSGAG
FT                   NDVPGSEPMFQVHEPGRTAWVKLDYTF"
FT   sig_peptide     complement(561800..561880)
FT                   /locus_tag="Swoo_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            562213..562866
FT                   /locus_tag="Swoo_0453"
FT   CDS             562213..562866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0453"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: sse:Ssed_3757
FT                   oxidoreductase, 2OG-Fe(II) oxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84751"
FT                   /db_xref="GOA:B1KQ96"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ96"
FT                   /protein_id="ACA84751.1"
FT                   /translation="MALHTGLEIDPSMDQYTSLFESIVQDVADNGYSIKTNALPVELAQ
FT                   KLSARAQAISDTHFKAAGIGRSNELMLDTQIRSDEICWIVGDSELGASWLNWVEGLKQY
FT                   VNRTLFLGLDEFESHFAHYSEGDFYQKHKDAFRGESNRILTLVAYLNEDWSEECGGELL
FT                   VYPDDSDEVIAKVAPHFGTIVVFMSEEFPHEVLPAKCDRYSIATWFRRKSDKLS"
FT   gene            564229..566049
FT                   /locus_tag="Swoo_0454"
FT   CDS             564229..566049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0454"
FT                   /product="AAA ATPase"
FT                   /note="KEGG: fjo:Fjoh_4877 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84752"
FT                   /db_xref="GOA:B1KQ97"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ97"
FT                   /protein_id="ACA84752.1"
FT                   /translation="MKIKIRNKHKSIPAGLEFELPQFTVLTGENGSGKTHLFEAISDKK
FT                   NGQVTLEEGGLNSISYIPFGGLNPQVDQQCDPAQISQKVKQVWQEVANAKLQIERRSRG
FT                   VEYTGAPEGDPILNHVGNAQHKEAILSISQQLSILPSQLTEDIISDRISMMSLSGSNLF
FT                   NSQFALIFKSYHVRYLDNKLNKVYEDEGTSDANPYLKDEEFKEQYGEAPWDFVNGILAK
FT                   LCLPYTVNNPINSKRDSTFVFKLIHNQSGIEIGTNDLSTGEKTLMSLALAIYNSIGTGD
FT                   RADCLILDEPDAPLHPSMSKLMLEIVEEEIVQKHGIPVLLSTHSPTTIACTPANALYKI
FT                   TAAEKIPTQCDLHDSMRILTYGIPNLRVSTEHRRQIFVEHTYDVEYYESLFDIISRKIE
FT                   FVTIPQFLPPHTNNGSNCDAVLEITRKLRDMGNSQVYGLIDWDLKNEPEQQVVILGLGR
FT                   RYAIENYIFEPHFLGLYLIHKKFASPEELGLEGCNSYLDVITLISNNSDAIQIIVDSVQ
FT                   EKLLPEEETSSYFESFLIDESSIRIDQRILDIKGHTLEDLARESWPQLNCVRSNNGGDS
FT                   VLKKDVISTVINDFPGLISIDIADTFRELR"
FT   gene            566160..567080
FT                   /locus_tag="Swoo_0455"
FT   CDS             566160..567080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP2995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84753"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ98"
FT                   /protein_id="ACA84753.1"
FT                   /translation="MSKIYKYFGSSVFELVFDKEGFCGVKCSLPKDYNDPYELFLAMDL
FT                   NVPTEYLAFYNDVIQEMPQFPTSCFSKSPIVSPMWAHYANNHTGFAIEFDLEKLQQHFD
FT                   GNPFWGVDYREEPHKSLGDIVQRAAELKKPRYTYDLQRFAFSEAYFSKYAQWSYEEELR
FT                   FVDTTGVTEKAAGNDILYIPMDCLVSVIVGPKSDEQLITSSQKAVEECGLNWYQLVIGK
FT                   SHPQPYFRSIDGTICTFKDGDVLAHDELCDRCEEPINSGSEMCPLCSITEAHAIEAAAG
FT                   NPFRLISEAGQLEGYMRSMDAIHRK"
FT   gene            568008..569195
FT                   /locus_tag="Swoo_0456"
FT   CDS             568008..569195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0456"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: hch:HCH_01586
FT                   putative Zn-dependent protease, contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84754"
FT                   /db_xref="GOA:B1KQ99"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQ99"
FT                   /protein_id="ACA84754.1"
FT                   /translation="MSEVRSEYLYPCHGIHSALPKGRASGQLTICKTHLMFTVNDKTVQ
FT                   LGFAELEISQGGASDRLIFFNHPACADWRFYCSDRSVLKNPYLKQAPHLNSVMAKATRK
FT                   RQFNWLVLTVVVLLCVLVPVGLLANLGTGSKMIAKQVPVEWEESLGSSSFDQYSLQSEL
FT                   MDEQRGELLLAPLVQPLLEVLPNKRYQYQFYISDDSELNAFALPGGVVVINSGLILAAD
FT                   SPEELLGVLSHEIVHVREQHGIRNLISSAGTYLILSAILGDVSGLMAVVVDSAPLLINQ
FT                   GYSRQFETQADEQGFDMLVTANIDPKGLPLFFNKLLDKEAKMLESIEDEDQRGLIETGL
FT                   GFLSSHPATKDRIENLEARAASIDAEFIVLDEAFFKLQDAVAEFVVKHEEPESGL"
FT   gene            569224..569886
FT                   /locus_tag="Swoo_0457"
FT   CDS             569224..569886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0457"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hch:HCH_01585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84755"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA0"
FT                   /protein_id="ACA84755.1"
FT                   /translation="MEAKIMGSQAFSYIDIDLEPGETVIAESDAMSSMDADLDLTATFN
FT                   GGFFKGLLKKFFGGETLFISRYSNNTSAPKRVTLVQPVPGELRCHELNGDEFNLQPGAY
FT                   LASTEGVKLGLRWAGFVSFIAREGLFKLTVTGEGKVWYGAYGALLEKEIDGEYIVDTSH
FT                   LVAYEPGIKLKLQLAGGIFSSFFGGEGLVTRVEGKGKIIVQSRSVSGLAGWLNPKFR"
FT   gene            569915..570598
FT                   /locus_tag="Swoo_0458"
FT   CDS             569915..570598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0458"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hch:HCH_01584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84756"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA1"
FT                   /protein_id="ACA84756.1"
FT                   /translation="MEIELLYRPGNTAAKVTLEEGQTITTESGAMIAMSGNMDITTTTH
FT                   KKKSGGFLKAAKRMLAGESLFLNHFEPKQGSGELFLGSSLAGDMMTMDLDNESLIVQNS
FT                   SYMASSEGIDVDMGWQGFKSLFSGESVIWLNLKGQGKILISSFGAIYPVEVDGEYIVDS
FT                   GHIVAFDETLDFSITKAGKSWWHSYLGGEGLVCKFKGKGTVWCQSHNPSSFGGALSSSL
FT                   RARKA"
FT   gene            570610..571659
FT                   /locus_tag="Swoo_0459"
FT   CDS             570610..571659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0459"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hch:HCH_01583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84757"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA2"
FT                   /protein_id="ACA84757.1"
FT                   /translation="MNQTYNITLTGELIGEIERSDAIAVFAKLFKLPLDKAHDFFHKAP
FT                   LVVKKSVDGDTANKIQQILEKSGLHCEINPVEVVETEQSTQVGVMNESAVEAQDEQSAQ
FT                   EREEMLDSESQTTTDPEQPSASFKGLKFEMAGQPDYGFVTVHVPAGEMLKVEASAMATM
FT                   DTNMQMKTKMRGGLGRMVTGENIFVNEFTAANMEGEVGIAPGAPGDLCHQYLDNETIYL
FT                   QNSAFVACSSGIEVESKWQGLVKGFFSGESLFLIRAQGKGDLWFNSYGAIIEIDVNDDY
FT                   VVDTGNIVGFTDGLEYQITKVGGYKSFFFSGEGLVCRFSGKGKVWIQTRSSAAFVGWAH
FT                   WFRPVKSKG"
FT   gene            complement(571736..573046)
FT                   /locus_tag="Swoo_0460"
FT   CDS             complement(571736..573046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0460"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   sse:Ssed_4156 sodium:neurotransmitter symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84758"
FT                   /db_xref="GOA:B1KQA3"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA3"
FT                   /protein_id="ACA84758.1"
FT                   /translation="MAAAGSAVGVGNIWGFPTQAATHGGGAFLLVYLVLILILGYPMLV
FT                   AELMIGRHGQTNPADAMAKIGSGPVSKKIGKAIGFISIATATLICTFYTILSGWFVSFA
FT                   LAPIAELFGFVKVSSWLMEFSLSRNLVFTTLFILMVVFVIRQGVQQGIELWSKRLMPLL
FT                   LLILVMGVIYILTQTGAMTGLEVLLVPDFSRVWEPDVLIGALGQTFFSLTIGTGAMMVY
FT                   GAYLSRKEDLGKLTAYVTLTDTSVAFLAALMIIPAMYVAQHNGVQIFAEDGSLLNSDTL
FT                   VFTVLPALFETLGGNLQYLLAFVFFILMTIAGLTSAISIVEVPTSYLMEKKSISRNKAT
FT                   YLIGALVVVLSLTVVLNFEQLFSFMITLTTERAQPLIALGIAIYLGWVWQRNDLLKDIQ
FT                   AQEGADSNSIFWRIWPVYVKFVCPALITLIIIQLFNS"
FT   gene            complement(573366..573851)
FT                   /locus_tag="Swoo_0461"
FT   CDS             complement(573366..573851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0461"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   sse:Ssed_4155 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84759"
FT                   /db_xref="GOA:B1KQA4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA4"
FT                   /protein_id="ACA84759.1"
FT                   /translation="MAELQLDKIDLAILKLLQGQGKLSNQELAEKVGLSASPCSRRVKA
FT                   MEESGYIAGYATLLSAEHFNLSLTAYVQVRLEKHSQAILDSFEDKITQYDEVQECCLLT
FT                   GSDADYQLKVLIADMKEFKTFLLEKLTTDPHISGVKSSFVLKQVKSKTSIPLPTQLP"
FT   gene            complement(573865..574638)
FT                   /locus_tag="Swoo_0462"
FT   CDS             complement(573865..574638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0462"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   sse:Ssed_4154 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84760"
FT                   /db_xref="GOA:B1KQA5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA5"
FT                   /protein_id="ACA84760.1"
FT                   /translation="MIFGWAILAIIPAILLLLNTSLFPLIELDSTFANLLFWLTSTGTA
FT                   PYGVATVLLVLLLGYRRLSKPQFMSFFLTISLGMCTSLGLNSYLKPYFNESRPNAVWLE
FT                   SQYLLNTDNFYSLTKAERKSEMSSTLDRLNYANSDITLSPLIKQHWKHEVGFAFPSGHT
FT                   LFALTLTMIASYYLLLAGNLVLPGLLFVWSIGMGFSRMLLGMHWSQDVLASTILGGIIG
FT                   LLSILVIHKTFPYLSLIYSSLMEKRKKLTGTQYNE"
FT   gene            complement(574916..576262)
FT                   /locus_tag="Swoo_0463"
FT   CDS             complement(574916..576262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0463"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   sse:Ssed_4153 inner membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84761"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA6"
FT                   /protein_id="ACA84761.1"
FT                   /translation="MLNLFTTAASNITHKIIILVGISLLSSIPLGIVMNMTSDRQYLYN
FT                   DVVNEIGQSWGPQQRISGPALVIPYRYHMVHEKINDAGELVKYKSEYQSELVILPKKLK
FT                   LNMDLKHDFRSRGIYQSLVYNAAVSGKAKFVMTELDIPNLIELKTDNARLIFGISANQA
FT                   IEKIERLTLLNSDGKVLLTQAEAGVMPGTGLDRQLGLERGFHQPLSINLQQDDFEVDFA
FT                   IALRGSQSISALPLGEHTDIAITTDWPHPSFNGILPTNREISDTGFSADWKISHLTRNY
FT                   PQVFSSHQDINLTEVQASSQLFEPVTHYGKIERSVKYGMLFIALTFIVLLIFEFGQNTR
FT                   LNLVQYLLVGCAVTLFYLLLLSLSEHLEFNYAYTIAASIPVLSVSAYVASATASYKKGA
FT                   IIATMLTSLYGVLYSILKLEDYALLMGTGLLLTVLLILMFITRHKSMET"
FT   gene            complement(576463..576729)
FT                   /locus_tag="Swoo_0464"
FT   CDS             complement(576463..576729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0464"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   sse:Ssed_4151 protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84762"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA7"
FT                   /protein_id="ACA84762.1"
FT                   /translation="MINPKKLEEVAKQLSDNLPNGLKQFAGEFEEKSKQILQNQLMKLD
FT                   VVSHEEFEVQQHVLLKTREKLEALQAQVDALEKKLSEREESAE"
FT   gene            complement(577233..580310)
FT                   /locus_tag="Swoo_0465"
FT   CDS             complement(577233..580310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0465"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   sse:Ssed_4150 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84763"
FT                   /db_xref="GOA:B1KQA8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA8"
FT                   /protein_id="ACA84763.1"
FT                   /translation="MRFTDIFIRRPVLAASISFLLLLLGFNSMSSMQVREYPEMTNTVV
FT                   TVSTSYYGADANLIQGFITQPLEQALAQADNVDFMTSDSSLGTSKITVYMKLNTDPNGA
FT                   LADILAKVNSVRSQLPKEAEDSTVDMSTGSQTSVLYISFYSDQINSSQITDYLERVVKP
FT                   QLFTINGVAKVNLYGGIKYAMRIWLDPARMGAFNLSSSEVMQVLQANNYQSAVGQANGT
FT                   FTLFNGTADTQVATVEELKKLVIASKDGLVVRLGDIAEVSLDKSHDVYRALADGQEAVV
FT                   VGLDVTPTANPLIVAEDARELMPDIQRNLPVSMKARILYDSSLAIDESISEVIKTIGEA
FT                   ALIVIVVITLFLGSLRAVIIPIVTIPLSLIGVAVIMQMFGFTLNLMTLLAMVLAIGLVV
FT                   DDAIVVVENVDRHIKLGETPFRAAIIGTREIAVPVISMTITLAAVYAPIALMGGITGSL
FT                   FKEFALTLAGAVFISGIVALTLSPMMCSKILKPHSTPNRFEQGVERFLEGMTNRYQSML
FT                   NAVMERRPVVIAFAFIVFATLPVMFSFIPSELAPNEDKSVVMMMGTAPSTANLDYIQSN
FT                   MTLVTDIIKSHPESDASLAFVGIPSSNQAFGIAPLVPWSERDKSQKEMQKILGDEVKQI
FT                   PGMAVTTFQMPELPGASGGLPIQFVITTSNSFESLFQIGSSVLEKVQNSPLFVYSEINL
FT                   KFDSGTMKIHIKRDLAGSYGITMQDIGVTLTTMMSDGYVNRINLDGRSYEVIPQVERQF
FT                   RDNPEALNGFYVKAADGRSIPLASLVDIEMVAEPRSLPHFNQMNALTVGGVATPGVAIG
FT                   DAIDFLKNIGDNDLPKGYDYDFLGEARQYVTEGSALFATFGLALAIIFLVLASQFESIR
FT                   DPLVILVSVPLAISGALIALAWTHVFGLSSMNIYTQVGLITLVGLITKHGILMCEVAKE
FT                   EQLHNGLSKMDAIKLAATVRLRPILMTTAAMIAGLIPLLFAVGAGAVARFNIGLVIVSG
FT                   LAIGTVFTLFVLPVIYTYLAERHEPLPEFDEKLTLS"
FT   sig_peptide     complement(580218..580310)
FT                   /locus_tag="Swoo_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.912 at
FT                   residue 31"
FT   gene            complement(580324..581442)
FT                   /locus_tag="Swoo_0466"
FT   CDS             complement(580324..581442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0466"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   sse:Ssed_4149 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84764"
FT                   /db_xref="GOA:B1KQA9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQA9"
FT                   /protein_id="ACA84764.1"
FT                   /translation="MKKWTLMMLIIALLAFGSVIGFNIMVKGKIADAIANMPEPESPVT
FT                   ALALTPQSWQPTIDAIGFVEPNQGVTIANELSGVISNINFENGSEVQDGQSLIVLDSAV
FT                   EQANLKSKMVQLPAAEADYQRLTRLYKKNSVSKQDLDNSQSKYLALKADIESLKATIDR
FT                   RQIDAPFAGLVGIRSVNLGEYLQAGTDIVRLEDISTMKIRFTVPQTQLPRISNGQTIHV
FT                   YVDAYPDHPFEGKISAIEPAVFYQSGLIQIQATIPNIDAKLRSGMFARVAVLLPEMTEQ
FT                   FVLPQTAINFTLYGNSIYLIHESQEEGETVKRVQQINVEVLERNGNNALVKGHLAANDL
FT                   VVTSGQVRLSNNSKVKVTEDDALTPPATMPQL"
FT   sig_peptide     complement(581377..581442)
FT                   /locus_tag="Swoo_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.739 at
FT                   residue 22"
FT   gene            complement(581439..582035)
FT                   /locus_tag="Swoo_0467"
FT   CDS             complement(581439..582035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0467"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sse:Ssed_4148
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84765"
FT                   /db_xref="GOA:B1KQB0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB0"
FT                   /protein_id="ACA84765.1"
FT                   /translation="MDNKRELIFTATEKIIATKGIQGLSMQQIATEAGVAAGTIYRYFK
FT                   DKEELISELRKHVLREVASNILVDCHEGDLEQRFKRIWFNIVEFGRQRTPANLSYEQYI
FT                   HLPGIDSDPHQTYEKQTFQGLHMLFEAGRVSGQFHNLQNKVLFAISLEPSMALGRSIRR
FT                   GQIEYNRDELEITCDLCWKALLTTPESTQKELSGK"
FT   gene            582259..584271
FT                   /locus_tag="Swoo_0468"
FT   CDS             582259..584271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0468"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: sse:Ssed_4147 ATP-dependent DNA
FT                   helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84766"
FT                   /db_xref="GOA:B1KQB1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB1"
FT                   /protein_id="ACA84766.1"
FT                   /translation="MKLNPGQNDAVHYVSGPCLVLAGAGSGKTRVIINKIAYLVEKCGY
FT                   KARTIAAVTFTNKAAREMKERVAQSMGRKQARGLWISTFHTLGLEVIKREHKVIGLKPG
FT                   FSLFDDQDSLALLKELTEDEFDGDKDLLKNLMTAISNWKGDLVVPEQAIKLAKDEQSKL
FT                   HAVLYQRYAKHMKAYNALDFDDLILIPTLLLRHNKEVRERWQQRIQYMLVDEYQDTNTS
FT                   QYELVKLIVGERARFTVVGDDDQSIYSWRGAKPQNLVLLGKDFPKLKLIKLEQNYRSSQ
FT                   RILRAANILIANNPHVYDKALFSELAYGEPLRVLIAANEEQEAERVIAEMIRHKFMGKT
FT                   QFGDYAILYRGNHQSRLLERSLMTNRIPYKLSGGTSFFGRAEIKDIMAYLRLVVNPDDD
FT                   NAFLRVVNLPKRGIGPSTLERLGNYANERHISMFEAIFQAELNHHLTPAAMGSLYKFGQ
FT                   FVVDTGEKATRGDPVDAVKHLIRNINYEDYLYETSTSAKAAEMRMKNISELYRWVTEML
FT                   EGDELDEGMTLPEVVTRLTLRDMMERNSEDEGGDQVQLMTLHASKGLEFPYVFMVGTEE
FT                   RILPHQTSIDEDNVEEERRLAYVGITRAQKELWFVLCRERRQFGETMRCEPSRFLMELP
FT                   QDDLIWENRKQVQSEEQRQQSGRSNIANLRDMFKK"
FT   gene            complement(584334..586958)
FT                   /locus_tag="Swoo_0469"
FT   CDS             complement(584334..586958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0469"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: sse:Ssed_4146 diguanylate cyclase/phosphodiesterase
FT                   with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84767"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB2"
FT                   /protein_id="ACA84767.1"
FT                   /translation="MFRDEQTQHSQREFELMQKRISRLKSLALKYKRAEVTQNMLLELS
FT                   NLAASVSSPAEFYSGVHGYLSTLLPADNFFVALLDPLNNVLEIPFFLDEKDKHPLELFS
FT                   KENISAKLLSGLTGYVLKTGRSLLCNQDKFEQLILDKQIESLGAPCHLWLGVPITVHHS
FT                   VVGVLVIQSYSEQVNFTEVDIELLGFVSHQISNIMERVQHQEQLEQAIAQRTRELSVAY
FT                   DKLKQEVNEKRRAELLQKSLFEIADLATSNIDTHAFYSELHRVISHLIPVSNCYIALLN
FT                   DQCNQLNFPFYVSQTNGRVPDSRIICDGLTEYVIKNRRPLLLQNSDIQSLVNSGQIYAK
FT                   TPELNNTKDIYQWIGIPLFIHDQVRGALTIYSTNKTRRYQENDLDLLTFVSQHIASAIE
FT                   RKLSAESLIASYEQLEDKVIERTQALALLNQDLEKEIAQRRKMEQQLVHDANHDTLTGL
FT                   PNRGMFMEKLSQAIKHTRRHKLDRFALLFIDLDRFKLINDTLGHIEGDRFLVETSRRLK
FT                   LCIRENDSLGRIGGDEFVILLDRINGSQDAKEVAERVLTGLSEPYKLANQQFKSGASIG
FT                   IAFNQHKTDTSESLLRDADAAMYRAKANGKGCYVIFDDKSHKQLDKDIELELELRNAIS
FT                   SRSLLVSYLPIEDLQTGETLALEPRLYWNHPSLGKIKQAKLLNIAEHCSLTTELDIFLL
FT                   ETLNSEYAQLQKMSLAHLPLHINISGHHLKHKHALRRLKNKLKQSYFSREQLWLFFDEQ
FT                   GFIFDTDNHINAFDLLTKLEVNLALSGYGSAHSALSSLTFLPLKGLKLDPSYPCHLDSK
FT                   QHKKLLNAHFLTAQALELTVFVDGISTKQQKESMLEIGFEQGQGQALGEVLRLQEVQAS
FT                   VCA"
FT   gene            587209..587285
FT                   /locus_tag="Swoo_R0014"
FT                   /note="tRNA-Arg1"
FT   tRNA            587209..587285
FT                   /locus_tag="Swoo_R0014"
FT                   /product="tRNA-Arg"
FT   gene            587334..587409
FT                   /locus_tag="Swoo_R0015"
FT                   /note="tRNA-His1"
FT   tRNA            587334..587409
FT                   /locus_tag="Swoo_R0015"
FT                   /product="tRNA-His"
FT   gene            587467..587543
FT                   /locus_tag="Swoo_R0016"
FT                   /note="tRNA-Pro1"
FT   tRNA            587467..587543
FT                   /locus_tag="Swoo_R0016"
FT                   /product="tRNA-Pro"
FT   gene            587707..587783
FT                   /locus_tag="Swoo_R0017"
FT                   /note="tRNA-Pro2"
FT   tRNA            587707..587783
FT                   /locus_tag="Swoo_R0017"
FT                   /product="tRNA-Pro"
FT   mobile_element  588035..588653
FT                   /mobile_element_type="insertion sequence:ISSod23-like IS
FT                   element"
FT   gene            588157..588591
FT                   /locus_tag="Swoo_0470"
FT   CDS             588157..588591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0470"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   she:Shewmr4_2466 transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84768"
FT                   /db_xref="GOA:B1KEE0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:B1KEE0"
FT                   /protein_id="ACA84768.1"
FT                   /translation="MSRYEKASHVYWRCQYHIVWTPKYRFRILKNKLGKDVYRCIHVYS
FT                   EQLGCVVVELNVQIDHVHLVIKVPPKLSISKLMGALKGKIALKMFSKYPYLRKNKLWGN
FT                   HFWQRGYFVDTVGINEEVIRRYVRHQEKVEKQEQPQLDLK"
FT   gene            complement(589005..590927)
FT                   /locus_tag="Swoo_0471"
FT   CDS             complement(589005..590927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0471"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: sse:Ssed_4145 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84769"
FT                   /db_xref="GOA:B1KQB4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB4"
FT                   /protein_id="ACA84769.1"
FT                   /translation="MTLFRQIYSLLFGLFLLVVASLGYVQFTETQSFLTKQMESDLNNT
FT                   SNSLGIMLVPDLEAGDIVGAETLINVIFEGGYYQQVKLTWLVDGKQQTWENPINIQGVP
FT                   QWFIDLDFFQTIKKESIITSGWIQLAKLELTAHPGFGYNELWRTMTNAIIVFSILFLIA
FT                   IVVARVGLTMILKPLHEIAVHAKEIAQRKFGPDMRVPKTAELKSVVLAFNSMSDQLKQL
FT                   FNSLDEEVGELRKKNLVDQVSGLPNRQYMMGRLNSWLNEPASGALVMAKFDWLEEVHSK
FT                   YGYQVRDETIKLLAEKMQDHLDEVASSVIARIAAYEFAFLITSSEHDQTSRYLQALIRT
FT                   INQEMSKAGCKPNENFAIGVAERIGHMSVSDILAQTDNALQKAIKEDKVFHWFETNEKQ
FT                   LFTREQWREHLSAAIQDCNFKFKWQPVHINDSDNILQRELYCQLNMGDKIIHAGQFMPY
FT                   VELLSLGSMLDKHLIQDVHEKHLLNKNQEPIAINLTFQSLSDPKFHEWLNTFLRSTNLS
FT                   ERICFDIPEAAVYSDPDSCHAICTVIRDNGAQFGIDHFGRQFGSMSYLQSLRPSYVKLD
FT                   QSFAYYDDSEHSGELCRAIINVARGLDIKVIVTGIEEMPQLERFVPLKTNAFMGYIFPP
FT                   TDIED"
FT   sig_peptide     complement(590856..590927)
FT                   /locus_tag="Swoo_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.570 at
FT                   residue 24"
FT   gene            complement(590936..591643)
FT                   /locus_tag="Swoo_0472"
FT   CDS             complement(590936..591643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84770"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB5"
FT                   /protein_id="ACA84770.1"
FT                   /translation="MKDRLTHNLTYIKVCRFTLIAMVLVASCLYASPTQKLNKGHITST
FT                   LESRYGERAGKRVRAWFKVLDEAKNLSEREKITKVNTFFNLFRFVDDIKLWGESNYWAT
FT                   PMEFIGVNGGDCEDFSIAKYFTLLQLGVEEDKLRITMVKATTVNQYHMVLAYYETPGSI
FT                   PLVLDNLDRKIKPATQRKDLLPVYSFNGRQLWLNKEKGRGVLAGSSKKLAKWNDLKHRL
FT                   GVERLRKPKLRLE"
FT   sig_peptide     complement(591548..591643)
FT                   /locus_tag="Swoo_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.964 at
FT                   residue 32"
FT   gene            complement(591662..592267)
FT                   /locus_tag="Swoo_0473"
FT   CDS             complement(591662..592267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0473"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: sse:Ssed_4143
FT                   OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84771"
FT                   /db_xref="GOA:B1KQB6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB6"
FT                   /protein_id="ACA84771.1"
FT                   /translation="MRTFILILSVTLLAGCSMRDIATMDGATTQVHDLNDNDRDGVIVA
FT                   RERCTETVGGATIDNYGCGKIKPINERQELKILFPNDSYYIDPMYYDQVEIIATFMRQF
FT                   PNTKVTIEGHCSKTGSYEHNLALSQNRANAVTTALSERFGIEPDRLTAIGYSFDRPIDL
FT                   SETAMAHTRNRRVIAEVTGEDTTADMKWNIYTVDEEVK"
FT   sig_peptide     complement(592199..592267)
FT                   /locus_tag="Swoo_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.650 at
FT                   residue 23"
FT   gene            complement(592267..593679)
FT                   /locus_tag="Swoo_0474"
FT   CDS             complement(592267..593679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0474"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   sse:Ssed_4142 type I secretion outer membrane protein, TolC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84772"
FT                   /db_xref="GOA:B1KQB7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB7"
FT                   /protein_id="ACA84772.1"
FT                   /translation="MNTSSIRQLKRSALALAVSALIIPASAYSQTLEQAVAHTLDTNPE
FT                   IRIAFNRFKAREEQVNQAIAGYMPTVDLTGGYGWEQTNSPSTRRKKNQGDVDSDGVIEL
FT                   ERGEAGFSIKQMLFDGFYTSSEVDRFSFEASADQWALFSAAEDMALDVAKVYINYIRTE
FT                   QVMTLAEKNLLSHQDIYEQIKQRTDSGLGSTADLSQITGRLARANANLISAKNNFYDAK
FT                   AQFIKVVESQPENLIVPVPDDDMMPEDLNTSIQLAQENHPILKSASSDIEAAKNEKSSA
FT                   QSNYYPKLSLDLAGNWNNDVDGEDGFSNIASSSVGGHSNDLVAMVRIKYNLFSGGKDLA
FT                   REKEAAYKIGEAKEIRQRAHRQVVEGVNLAWNAYELLEPQKLYIRDHVIAAKDTQVAYS
FT                   QQFNLGQRTLLDLLDTENELFEARKDYLEAEYDQVISEYRVLNATGRLLESLRVTPPDV
FT                   WQGERNYEGGVN"
FT   sig_peptide     complement(593590..593679)
FT                   /locus_tag="Swoo_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.824 at
FT                   residue 30"
FT   gene            complement(593710..595092)
FT                   /locus_tag="Swoo_0475"
FT   CDS             complement(593710..595092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0475"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: sse:Ssed_4141 type I secretion membrane fusion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84773"
FT                   /db_xref="GOA:B1KQB8"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB8"
FT                   /protein_id="ACA84773.1"
FT                   /translation="MSKKLTTHDLEMIDDVYGAMMTDAPSSHRLIIWTLVALATCFLIW
FT                   AFFAELDQVTTGMGKVIPSSQVQIIQSLDGGIMQELYVQEGMIVTKGQALVRIDDTRFR
FT                   SDFAQQEQEVYSLQANVKRLETELNSIVITDMAADWREQVRITKLPLQFSAELAELEPE
FT                   LIERQKDEYSGRLDSLSNQLEILARQIQQRQQETQELASKIRTLTKSYQLVSRELSLTR
FT                   PLADKGIVPEVELLKLERTVNDIQGELATLRLLRPKVKASQDEAILKRREAVFAFSTET
FT                   RTQLSDLQTKLSRMSEAQVGAQDKVNKAEIVSPVNGTIKSIYINTLGGVVQPGIDILEI
FT                   VPSEDQLLIETKITPKDIAFLHPGLPAVVKVTAYDFTRYGGLNGTVEHISADTSQDEEG
FT                   NSFYLVKVRTELSSLTRDDGTEMPIIPGMLTSVDVITGQRSILEYILNPILRAKDTALR
FT                   ER"
FT   gene            complement(595085..597265)
FT                   /locus_tag="Swoo_0476"
FT   CDS             complement(595085..597265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0476"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: sse:Ssed_4140 ABC transporter-related protein;
FT                   TIGRFAM: type I secretion system ATPase; PFAM: ABC
FT                   transporter transmembrane region; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84774"
FT                   /db_xref="GOA:B1KQB9"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQB9"
FT                   /protein_id="ACA84774.1"
FT                   /translation="MSTSVPKKTEQWTVSASQRVTVDPLLDSLVLLTEYFGSPCSSESM
FT                   AAGLPLSGSVLTPDLVPQAAGRAGLAAKLTQKGLNQISPIFLPCILLLKDKKACLLREL
FT                   DVEKDKAVIQLPETGGEQVLTLEDLEAIYVGYLFLVKQQYRGDMGFDVHQHDSTTHWLV
FT                   QTLRDSAPIYRDALLASVLVNLFALVSPLFIMNVYDKVVPNLAFSSLWVLAIGASVAYI
FT                   FDLILRQLRSYLIDVAGKKVDIIVSSRLFAKAIGIPLEKRSPSVGGMARQLGEFDSIRE
FT                   ILTSATITTLVDLPFAIFFMIIIYVVAGDLAVIPLIGSMIIIGYTLVMQPKLKAAIEES
FT                   NKFSSLKHGHLIESLASLESIKSSGAEGLVQKSWQQMIGHTANWQLKSKKISTAVTNLA
FT                   NFVVQLSVVCVVILGVYRVADNEISMGGIIAAVILSSRAISPMAQLAGLMTRGNHTASA
FT                   LRQLNEIMTQEDEFENKGHLVSRQRLQGKISADHISFAYPGSEKPVLHPMSINIEPGER
FT                   IAIIGRNGSGKSTLAKMLVGLYQPTKGSLRYDGLDSAQIHPTDLRRNFGYLPQDITLFH
FT                   GTIRDNILFGTRQVTEHQLIRAVQLSGISQFTDLDSEGLDQQVGEGGQSLSRGQRQTVA
FT                   LARATLNDPPVLLMDEPSASLDARAEKQFIHAMQNVTRDRTLLLITHKMHLLKLVDRIV
FT                   VLDRGHVVIDGPKAEVLDKLSKGLLAGGQTNE"
FT   gene            complement(597372..646340)
FT                   /locus_tag="Swoo_0477"
FT   CDS             complement(597372..646340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0477"
FT                   /product="outer membrane adhesin like proteiin"
FT                   /note="TIGRFAM: outer membrane adhesin like proteiin; PFAM:
FT                   Hemolysin-type calcium-binding region; transferase
FT                   hexapeptide repeat containing protein; Two component
FT                   regulator propeller; KEGG: saz:Sama_3258 putative outer
FT                   membrane adhesin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84775"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR028059"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC0"
FT                   /protein_id="ACA84775.1"
FT                   /translation="MKTLVTTQPGTVLLVKGDIKLQLENTLENVSKGEQLLAGATLIIE
FT                   DNADIEIAYSDGTYFSNLESTDRTVEEGVTATSVADAREIQTIQDAILDGDDPTTELPD
FT                   TAAGGTLGNQGGSDFVSLDRTASETIAATGFNTDSAPQDEFLVTDTLNEALSENQSNLA
FT                   NDFITIDEDGVATGNVLDNDSDVDDELAVLSFEVNGTTYGAGTTVELEGGTLVINQDGS
FT                   YTFTPNENWNGTVPVITYTTNTGVTATLSIEVTPVADGAPQVTINTDANNDGLISNDEL
FT                   NDSNEVNVTISLEGTGAQVGDVLIVNGIEIVLTADDIFIGSINVNLPAPAEGETITVVA
FT                   TVTDSAGNTSPEGTDTATVDTIAPTITVDAPDTTNDTTPTITGTTDAEPGSTITVVITD
FT                   STGTEQTVTTTVNPDGTFTVDVTDPVAEGPITVVATVTDPAGNTGTATDTGGVDTTPPT
FT                   ITVDVPDTTNDTTPTITGTTDAEPGSTITVVITDSTGTEQTVTTTVNPDGTYTVDVTTP
FT                   TAEGPITVVATVTDPSGNTGTATDTGDIDTTPPTITVDVPDTTNDTTPTITGTTDAEPG
FT                   STITVVITDSTGTEQTVTTTVDPDGTYTVDVTDPVTEGPITVVATVTDPAGNTGTTTDT
FT                   GDIDTTEPTITVDVPDATNDTTPTITGTTDAEPGSTITVVVTDSTGSEQTVTTTVDPDG
FT                   TYTVDVIDPTAEGPITVVATVTDPAGNTGTATDTGEIDTTDPIITVDLPDTTNDTTPTI
FT                   TGTTDAEPGSTITVVVTDSSGTEQTVTTTVDPDGTYTVDVTDPVTEGPITVVATVTDPA
FT                   GNTGTSTDTGTIDITIGTPVVQITEDTNNDGYLNDPELNGQVDISITLGEGTELGDTFT
FT                   VTDQDGNVIFDGPVTQGMIDNGLNLAIDPPATGTDLVITATVTDPSGNIATGSDSATLD
FT                   YGVGTGAPAGPSVTIDEDTNGDGYISDTELDGQINITVELGTGTVVGDTLVITDQDGNE
FT                   LFNGTVTQEMLDNGQAVVMDAPVTGTDIVVTATVTDPAGNTATGSDAATLDYGTGTGAP
FT                   VSPTVTINEDTNQDGVINDAELDGQIDITVELGEGTEVGDTLVITDQAGNTLFDGPVTQ
FT                   EMIDNGLTLAIDPPASGTDLVITADITDPAGNTASGSGSATLDYGTEGAPNGPNVTIDE
FT                   DLNNDGYINDAELDGQINVTIELDSGTQVGDTLEVTDQDGNIIFSETVTQEMLDNGQTI
FT                   AIDPPATGTDLVVTATVTDPSGNTATGSDAATLDYGTGTGAPEAPVVEITEDTNGDGTI
FT                   TDAELDGQINITVDLGTGTQVGDTITVTDQTGDVLYTGPVTQDMLDNGIDIAIDAPANG
FT                   TDLVISATITDPAGNTATGNDSATMDYDDSVTVPAAPNVTIVEDTNGDGFINDVELEGQ
FT                   INITVELGTNTLVGDTLVVTDQDGNELFNGTVTQEMLDNGLDLAMDPPATSTNLVITAT
FT                   VTDTLGTQASGSDNALLDYGSGTGAPAAPTVELTEDSNNDGYINDSELEGQINGTITLG
FT                   EGTVVGDTITVTDQDGNVIFNGPVTQEMIDDGLAIAIDAPATGTDLVVTATITDPAGNS
FT                   ATGSDAATLDYGTGTGAPASPIVTIDEDANNDGFINDAELDGQIDITVELGSGTVVGDT
FT                   LVVTDQDGNVIFTGTVTQEMLTNGVPVTMDAPATGTDLVVTATITDAAGNSATGSDSTT
FT                   LDYGTGTGAPAAPTVELTEDANNDGYINDSELDGQIDATVTLGAGTSVGDTVTITDQDG
FT                   NVIFSGPATQDMLDNGLAVTIDPPASGTNLVVTATITDPAGNTTSGSDNALLDYGTGSG
FT                   GPATPTVVIDEDVNNDGVITDFELIDQIDISVTLGAGTEVGDTLVVTDQDGNELFSGVV
FT                   TQAMLDNGLAVVMAIPVTGTEIIVTATVTDTSGNTAVANDSATLDYNWEITPPVAPTIE
FT                   ITEDINDDGYINSDELDGQINITVTFDASTSVGETIVVTDQNGNELFNGTVTQEMLDNG
FT                   LQLGMDAPATGTSITVTASLTNIYGMVLTDSDNALLDYGTGTGAPASPTVEITEDANND
FT                   GFINHAELDGQVDATVTLGAGTALGDTVTITDQDGNTLFSGPVTQDMLDNGINVSLDAP
FT                   ATGTDVVITATVTDVAGNTATGNDSATLDYGTGTGAPAAPTVVITEDTNNDGFINEAEL
FT                   DGQINATVTLGAGTMIGDTITVTDQDGNTLFTGAVTQDMLDNGISVSFDAPATGTTVAV
FT                   TATVTDPAGNTAQGSDNALLDYGTGTGAPASPTVTIDEDINNDGFINDVELSGQIDITV
FT                   SLGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDNGLTLAIDAPATGTELVVTANVTDPA
FT                   GNTATGNDSATLDYGIGSGAPASPTVTIDEDSNNDGFINDAELDGQINITVELGEGTAV
FT                   GDTLVVTDQAGNELFNGVVTQAMLDSGLSLAIDAPATGTELVVTANVTDPAGNTATGND
FT                   SATLDYGSSAPLAPTVEITEDANNDGFINDVELNGQINISVTLGAGTVIGDTVTVTDQD
FT                   GNVLFSGPATQDMLDNGLALAIDPPATGTNLVITANVTDPAGNSATGSDAATLDYGVDA
FT                   PAAPSVTIDEDTNNDGYINEAELDGQINITVELGEGTVVGDTLVVTDQDGNELFNGTVT
FT                   QDMLDNGQAVTMDAPATGTDVVITATVTDEAGNTATGNDAATLDYGTGVGAPASPTVEI
FT                   VEDANNDGFINDAELDGQINITVELGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDSGL
FT                   DLAIDAPATGTEVVITANVTDVAGNTAQGSDSATLDVGTGTGAPAAPTVTIDEDANNDG
FT                   FINDAELDGQINITVELGAGTAVGDTLVVTDQAGNELFNGVVTADMLTNGVPVTMDAPA
FT                   TGTDVVVTATVTDAAGNSAQGSDAATLDVGTDAPAAPTVEIVEDTNNDGTITDAELDGQ
FT                   INITVTLGSGTEVGDTVTITDQTGEVIYTGPVTQDMLDNGIDAVIDAPATGTELVITAT
FT                   VIDVAGNTATGNDSATLDYDDSVTVPGAPTVVITEDTNNDGYINDAELEGQINITVELG
FT                   ANTVVGDTLVVTDQDGNELFSGTVTQEMLDNGLTLAIDPPATGTNVVITATVTDTLGNE
FT                   AAGSDNALLDYGSGTGAPAAPTVVIDEDINNDGFINDAELDGQINATVTLGAGTVVGDT
FT                   VTITDQDGNTLFTGTVTQDMLDNGIDLSFDAPATGTDLVVTATVTDVAGNSATGSDAAT
FT                   LDYGTGTGAPASPTVVIDEDANNDGFINDAELDGQIDITVTLGAGTAVGDTLVVTDQDG
FT                   NVIFTGTVTQEMLTNGVPVTMDAPATGTDVVVTATVTDAAGNTAQGSDAATLDYGTGTG
FT                   APAAPTVVIDEDANNDGYINDAELDGQIDATVTLGAGTSVGDTVTITDQDGNVIFSGPA
FT                   TQEMIDNGLAVTIDPPATGTNLVITATVTDPAGNSSQGSDSALLDYGTGTGAPASPTVV
FT                   IDEDINNDGTINDTELDGQIDITVTLGAGTAVGDTLVVTDQAGNVLFTGVVTQAMLDNG
FT                   QAVTMDTPPSGTDVVVTATVTDVAGNTATGSDAATLDYVEAPAPAAPTVEITEDANNDG
FT                   YINSAELDGQINITVTLDAGTSVGDTLVVTDQDGNELFNGVVTTDMLTNGLPLTMDAPA
FT                   TGTTVTVTATLTNANGDSAASHDSATLDYGTGTGAPASPTVEITEDANNDGFINHAELD
FT                   GQVDATVTLGAGTALGDTVTITDQDGNTLFSGPVTQDMLDNGINVSLDAPATGTDLVIT
FT                   ATVTDVAGNTATGNDSATLDYGTGTGAPAAPTVVITEDANNDGFINEAELDGQINATVT
FT                   LGAGTVIGDTVTVTDQDGNTLFTGAVTQDMLDNGISVSFDAPATGTTVAVTATVTDPAG
FT                   NTAQGSDNALLDYGTGTGAPASPTVTIDEDINNDGFINDVELSGQIDITVSLGAGTAVG
FT                   DTLVVTDQAGNELFNGPVTQAMLDNGLTLAIDAPVTGTELVVTANVTDPAGNTATGNDA
FT                   ATLDYGIGSGAPASPTVTIDEDSNNDGFINDAELDGQINITVELGEGTAVGDTLVVTDQ
FT                   AGNELFNGVVTQAMLDSGLSLAIDAPATGTELVVTANVTDPAGNTATGNDSATLDYGSS
FT                   APLAPTVEITEDANNDGFINDAELNGQINISVTLGAGTVIGDTVTVTDQDGNVLFSGPA
FT                   TQDMLDNGLALAIDPPATGTNLVITANVTDPAGNSATGSDAATLDYGVGVGAPAAPSVT
FT                   IDEDANNDGYINEAELDGQINITVELGEGTVVGDTLVITDQDGNELFNGTVTQDMLDNG
FT                   QAVTMDAPATGTDVVVTATVTDEAGNTATGNDAATLDYGTGVGAPASPTVEIVEDANND
FT                   GFINDAELDGQINITVELGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDSGLDLAIDAP
FT                   ATGTEVVITANVTDVAGNTAQGSDSATLDYGTGAPAAPTVTIDEDANNDGFINDAELDG
FT                   QINITVELGAGTAVGDTLVVTDQAGNELFNGVVTADMLTNGVPVTMDAPATGTDVVVTA
FT                   TVTDAAGNSAQGSDAATLDVGTDAPAAPTVEIVEDTNNDGTITDAELDGQINITVTLGS
FT                   GTEVGDTVTITDQTGEVIYTGPVTQDMLDNGIDAVIDAPATGTELVITATVTDVAGNTA
FT                   TGNDSATLDYDDSVTVPGAPTVVITEDTNNDGYINDAELEGQINITVELGANTVVGDTL
FT                   VVTDQDGNELFSGTVTQDMLDNGLTLAMDPPATGTNVVITATVTDTLGNEAAGSDNALL
FT                   DYGSGTGAPAAPTVVIDEDINNDGFINDAELDGQINATVTLGAGTVVGDTVTITDQDGN
FT                   TLFTGTVTQDMLDNGIDLSFDAPATGTDLVVTATVTDAAGNSAQGSDAATLDYGTGTGA
FT                   PASPTVVIDEDANNDGFINDAELDGQIDITVTLGAGTAVGDTLVVTDQDGNVIFTGTVT
FT                   QEMLTNGVPVTMDAPATGTDVVVTATVTDAAGNTAQGSDAATLDYGTGTGAPAAPTVVI
FT                   DEDANNDGYINDAELDGQIDATVTLGAGTSVGDTVTITDQDGNVIFSGPATQEMIDNGL
FT                   AVTIDPPATGTNLVITATVTDPAGNSSQGSDSALLDYGTGTGAPASPTVVIDEDINNDG
FT                   TINDTELDGQIDITVTLGAGTAVGDTLVVTDQAGNVLFTGVVTQAMLDNGQAVTMDTPP
FT                   SGTDVVVTATVTDVAGNTATGSDAATLDYVEAPAPAAPTVEITEDANNDGYINSAELDG
FT                   QINITVTLDAGTSVGDTLVVTDQDGNELFNGVVTTDMLTNGLPLTMDAPATGTTVTVTA
FT                   TLTNANGDSAASHDSATLDYGTGTGAPASPTVEITEDANNDGFINHAELDGQVDATVTL
FT                   GAGTALGDTVTITDQDGNTLFSGPVTQDMLDNGINVSLDAPATGTDVVITATVTDVAGN
FT                   TATGNDSATLDYGTGTGAPAAPTVVITEDTNNDGFINEAELDGQINATVTLGAGTVIGD
FT                   TVTVTDQDGNTLFTGAVTQDMLDNGISVSFDAPATGTTVAVTATVTDPAGNTAQGSDNA
FT                   LLDYGTGTGAPASPTVTIDEDINNDGFINDVELSGQIDITVSLGAGTAVGDTLVVTDQA
FT                   GNTLFSGPVTQAMLDNGLTLAIDAPVTGTELVVTANVTDPAGNTATGNDSATLDYGIGS
FT                   GAPASPTVTIDEDVNNDGFINDAELDGQINITVELGEGTAVGDTLVVTDQAGNELFNGV
FT                   VTQAMLDSGLSLAIDAPATGTELVVTANVTDPAGNTATGNDSATLDYGSSAPLAPTVEI
FT                   TEDANNDGFINDAELNGQINISVTLGAGTVIGDTVTVTDQDGNVLFSGPATQDMLDNGL
FT                   ALAIDPPATGTNLVITANVTDPAGNSATGSDAATLDYGVGVGAPAAPSVTIDEDANNDG
FT                   YINEAELDGQINITVELGEGTVVGDTLVVTDQDGNELFNGTVTQDMLDNGQAVTMDAPA
FT                   TGTDVVVTATVTDEAGNTATGSDAATLDYGTGVGAPASPTVEIVEDANNDGFINDAELD
FT                   GQINITVTLGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDSGLDLAIDAPATGTEVVIT
FT                   ANVTDVAGNTAQGSDSATLDVGTGTGAPAAPTVTIDEDANNDGFINDAELDGQINITVE
FT                   LGAGTVVGDTLVVTDQAGNELFNGVVTADMLTNGVPVTMDAPATGTDVVVTATVTDAAG
FT                   NSAQGSDAATLDVGTDAPAAPTVEIVEDTNNDGTITDAELDGQINITVTLGSGTEVGDT
FT                   VTITDQTGEVIYTGPVTQDMLDNGIDAVIDAPATGTELVITATVSDVAGNTATGNDSAT
FT                   LDYDDSVTVPGAPTVVITEDTNNDGYINDAELEGQINITVELGANTVVGDTLVVTDQDG
FT                   NELFSGTVTQEMLDNGLDLAMDPPATGTNVVITATVTDTLGNEAAGSDNALLDYGSGTG
FT                   APAAPTVVIDEDINNDGFINDAELDGQINATVTLGAGTVVGDTVTITDQDGNTLFTGTV
FT                   TQDMLDNGIDLSFDAPATGTNLVVTATVTDVAGNSATGSDAATLDYGTGTGAPASPTVV
FT                   IDEDANNDGFINDAELDGQIDITVTLGAGTAVGDTLVVTDQDGNVIFTGTVTQEMLTNG
FT                   VPVTMDAPATGTDVVVTATVTDAAGNTAQGSDAATLDYGTGTGAPAAPTVVIDEDANND
FT                   GYINDAELDGQIDATVTLGAGTSVGDTVTITDQDGNVIFSGPATQEMIDNGLAVTIDPP
FT                   ATGTNLVITATVTDPAGNSSQGSDSALLDYGTGTGAPASPTVVIDEDINNDGTINDTEL
FT                   DGQIDITVTLGAGTAVGDTLVVTDQAGNVLFTGVVTQAMLDNGLAVTMDTPPSGTDVVV
FT                   TATVTDVAGNTATGSDAATLDYVEAPAPAAPTVEITEDANNDGYINSAELDGQINITVT
FT                   LDAGTSVGDTLIVTDQDGNELFNGVVTTDMLTNGLPLTMDAPATGTTVTVTATLTNANG
FT                   DSAASHDSATLDYGTGTGAPASPTVEITEDANNDGFINHTELDGQIDATVTLGAGTALG
FT                   DTVTITDQDGNTLFSGPVTQDMLDNGINVSLDAPATGTDVVITATVTDVAGNTATGNDS
FT                   ATLDYGTGTGAPAAPTVVITEDANNDGFINEAELDGQINATVTLGAGTVIGDTVTVIDQ
FT                   DGNTLFTGAVTQDMLDNGISVSFDAPATGTTVAVTATVTDPAGNTAQGSDNALLDYGTG
FT                   TGAPASPTVTIDEDINNDGFINDVELSGQIDITVSLGAGTAVGDTLVVTDQAGNTLFSG
FT                   PVTQAMLDNGLTLAIDAPVTGTELVVTANVTDPAGNTATGNDAATLDYGIGSGAPASPT
FT                   VTIDEDSNNDGFINDAELDGQINITVELGEGTAVGDTLVVTDQAGNELFSGPVTQAMLD
FT                   SGLSLAIDAPAIGTEVIITANVTDPAGNTNTGSDSAILDNGAPAAPTVEITEDANNDGF
FT                   INDAELNGQININVTLGEDTEVGDTLVITDQDGNELFNGPITQAMLDNGLDLAIDAPAT
FT                   GTNLVITANVTDPAGNSATGSDAATLDYGVGVGAPAAPSVTIDEDTNNDGYINEAELDG
FT                   QINITVELGEGTVVGDTLVVTDQDGNELFNGTVTQDMLDNGQAVTMDAPATGTDVVITA
FT                   TVTDEAGNTATGSDAATLDYGTGVGAPASPTVEIVEDANNDGFINDAELDGQINITVTL
FT                   GAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDSGLDLAIDAPATGTEVVITANVTDVAGN
FT                   TAQGSDSATLDVGTGTGAPAAPTVTIDEDANNDGFINDAELDGQINITVELGAGTVVGD
FT                   TLVVTDQAGNELFNGVVTADMLTNGVPVTMDAPATGTDVVVTATVTDAAGNSAQGSDAA
FT                   TLDVGTDAPAAPTVEIVEDTNNDGTITDAELDGQINITVTLGSGTEVGDTVTITDQTGE
FT                   VIYTGPVTQDMLDNGIDAVIDAPATGTELVITATVTDVAGNTATGNDSATLDYDDSVTV
FT                   PGAPTVVITEDTNNDGYINDAELEGQINITVELGANTVVGDTLVVTDQDGNELFSGTVT
FT                   QEMLDNGLDLAMDPPATGTNVVITATVTDTLGNEAAGSDNALLDYGSGTGAPAAPTVVI
FT                   DEDINNDGFINDAELDGQINATVTLGAGTVVGDTVTITDQDGNTLFTGTVTQDMLDNGI
FT                   DLSFDAPATGTDLVVTATVTDVAGNSATGSDAATLDYGTGTGAPASPTVVIDEDANNDG
FT                   FINDAELDGQIDITVTLGAGTAVDDTLVVTDQDGNVIFTGTVTQEMLTNGVPVTMDAPA
FT                   TGTDVVVTATVTDAAGNTAQGSDAATLDYGTGTGAPAAPTVVIDEDANNDGYINDAELD
FT                   GQIDATVTLGAGTSVGDTVTITDQDGNVIFSGPATQEMIDNGLAVTIDPPATGTNLVIT
FT                   ATVTDPAGNSSQGSDSALLDYGTGTGAPASPTVVIDEDINNDGTINDTELDGQIDITVT
FT                   LGAGTAVGDTLVVTDQAGNVLFTGVVTQAMLDNGQAVTMDTPPSGTDVVVTATVTDVAG
FT                   NTATGSDAATLDYVEAPAPAAPTVEITEDANNDGYINSAELDGQINITVTLDAGTSVGD
FT                   TLVVTDQDGNELFNGVVTTDMLTNGLPLTMDAPATGTTVTVTATLTNANGDSAASHDSA
FT                   TLDYGTGTGAPASPTVEITEDANNDGFINHTELDGQIDATVTLGAGTAVGDTVTITDQD
FT                   GNTLFSGPVTQDMLDNGINVSLDAPATGTDVVITATVTDVAGNTATGNDSATLDYGTGT
FT                   GAPAAPTVVITEDANNDGFINEAELDGQINATVTLGAGTVIGDTVTVTDQDGNTLFTGA
FT                   VTQDMLDNGISVSFDAPATGTTVAVTATVTDPAGNTAQGSDNALLDYGTGTGAPASPTV
FT                   TIDEDINNDGFINDVELSGQIDITVSLGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDN
FT                   GLTLAIDAPVTGTELVVTANVTDPAGNTATGNDSATLDYGIGSGAPASPTVTIDEDINN
FT                   DGFINDAELDGQINITVELGEGTAVGDTLVVTDQAGNELFNGVVTQAMLDSGLSLAIDA
FT                   PATGTELVVTANVTDPAGNTATGNDSATLDYGSSAPLAPTVEITEDANNDGFINDAELN
FT                   GQINISVTLGAGTVIGDTVTVTDQDGNVLFSGPATQDMLDNGLALAIDPPATGTNLVIT
FT                   ANVTDPAGNSATGSDAATLDYGVGVGAPAAPSVTIDEDTNNDGYINEAELDGQINITVE
FT                   LGEGTVVGDTLVVTDQDGNELFNGTVTQDMLDNGQAVTMDAPATGTDVVITATVTDEAG
FT                   NTATGNDAATLDYGTGVGAPASPTVEIVEDANNDGFINDAELDGQINITVTLGAGTAVG
FT                   DTLVVTDQAGNTLFSGPVTQAMLDSGLDLAIDAPATGTEVVITANVTDVAGNTAQGSDS
FT                   ATLDVGTGTGAPAAPTVTIDEDANNDGFINDAELDGQINITVELGAGTVVGDTLVVTDQ
FT                   AGNELFNGVVTADMLTNGVPVTMDAPATGTDVVVTATVTDAAGNSAQGSDAATLDVGTD
FT                   APAAPTVEIVEDTNNDGTITDAELDGQINITVTLGSGTEVGDTVTITDQTGEVIYTGPV
FT                   TQDMLDNGIDAVIDAPATGTELVITATVTDVAGNTATGNDSATLDYDDSVTVPGAPTVV
FT                   ITEDTNNDGYINDAELEGQINITVELGANTVVGDTLVVTDQDGNELFSGTVTQDMLDNG
FT                   LDLAMDPPATGTNVVITATVTDTLGNEAAGSDNALLDYGSGTGAPAAPTVVIDEDINND
FT                   GFINDAELDGQINATVTLGAGTVVGDTVTITDQDGNTLFTGTVTQDMLDNGIDLSFDAP
FT                   ATGTDLVVTATVTDAAGNSATGSDAATLDYGTGTGAPASPTVVIDEDANNDGFINDAEL
FT                   DGQIDITVTLGAGTAVDDTLVVTDQDGNVIFTGTVTQEMLTNGVPVTMDAPATGTDVVV
FT                   TATVTDAAGNTAQGSDAATLDYGTGTGAPAAPTVVIDEDANNDGYINDAELDGQIDATV
FT                   TLGAGTSVGDTVTITDQDGNVIFSGPATQEMIDNGLAVTIDPPATGTNLVITATVTDPA
FT                   GNSSQGSDSALLDYGTGTGAPASPTVVIDEDINNDGTINDTELDGQIDITVTLGAGTAV
FT                   GDTLVVTDQAGNVLFTGVVTQAMLDNGQAVTMDTPPSGTDVVVTATVTDVAGNTATGSD
FT                   AATLDYVEAPAPAAPTVEITEDANNDGYINSAELDGQINITVTLDAGTSVGDTLVVTDQ
FT                   DGNELFNGVVTTDMLTNGLPLTMDAPATGTTVTVTATLTNANGDSAASHDSATLDYGTG
FT                   TGAPASPTVEITEDANNDGFINHTELDGQIDATVTLGAGTAVGDTVTITDQDGNTLFSG
FT                   PVTQDMLDNGINVSLDAPATGTDVVITATVTDVAGNTATGNDSATLDYGTGTGAPAAPT
FT                   VVITEDANNDGFINEAELDGQINATVTLGAGTVIGDTVTVTDQDGNTLFTGAVTQDMLD
FT                   NGISVSFDAPATGTTVAVTATVTDPAGNTAQGSDNALLDYGTGTGAPASPTVTIDEDIN
FT                   NDGFINDVELSGQIDITVSLGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDNGLTLAID
FT                   APVTGTELVVTANVTDPAGNTATGNDSATLDYGIGSGAPASPTVTIDEDSNNDGFINDA
FT                   ELDGQINITVELGEGTAVGDTLVVTDQAGNELFNGVVTQAMLDSGLSLAIDAPATGTEL
FT                   VVTANVTDPAGNTATGNDSATLDYGSSAPLAPTVEITEDANNDGFINDAELNGQINISV
FT                   TLGAGTVIGDTVTVTDQDGNVLFSGPATQDMLDNGLALAIDPPATGTNLVITANVTDPA
FT                   GNSATGSDAATLDYGVGVGAPAAPSVTIDEDTNNDGYINEAELDGQINITVELGEGTVV
FT                   GDTLVITDQDGNELFNGTVTQDMLDNGQAVTMDAPATGTDVVVTATVTDEAGNTATGND
FT                   AATLDYGTGVGAPASPTVEIVEDANNDGFINDAELDGQINITVELGAGTAVGDTLVVTD
FT                   QAGNTLFSGPVTQAMLDSGLDLAIDAPATGTEVVITANVTDVAGNTAQGSDSATLDVGT
FT                   GTGAPAAPTVTIDEDANNDGFINDAELDGQINITVELGAGTVVGDTLVVTDQAGNELFN
FT                   GVVTADMLTNGVPVTMDAPATGTDVVVTATVTDAAGNSAQGSDAATLDVGTDAPAAPTV
FT                   EIVEDTNNDGTITDAELDGQINITVTLGSGTEVGDTVTITDQTGEVIYTGPVTQDMLDN
FT                   GIDAVIDAPATGTELVITATVTDVAGNTATGNDSATLDYDDSVTVPGAPTVVITEDTNN
FT                   DGYINDAELEGQINITVELGANTVVGDTLVVTDQDGNELFSGTVTQDMLDNGLDLAMDP
FT                   PATGTNVVITATVTDTLGNEAAGSDNALLDYGSGTGAPAAPTVVIDEDINNDGFINDAE
FT                   LDGQINATVTLGAGTVVGDTVTITDQDGNTLFTGTVTQDMLDNGIDLSFDAPATGTNLV
FT                   VTATVTDVAGNSATGSDAATLDYGTGTGAPASPTVVIDEDANNDGFINDAELDGQIDIT
FT                   VTLGAGTAVGDTLVVTDQDGNVIFTGTVTQEMLTNGVPVTMDAPATGTDVVVTATVTDA
FT                   AGNTAQGSDAATLDYGTGTGAPAAPTVVIDEDANNDGYINDAELDGQIDATVTLGAGTS
FT                   VGDTVTITDQDGNVIFSGPATQEMIDNGLAVTIDPPATGTNLVITATVTDPAGNSSQGS
FT                   DSALLDYGTGTGAPASPTVVIDEDINNDGTINDTELDGQIDITVTLGAGTAVGDTLVVT
FT                   DQAGNVLFTGVVTQAMLDNGLAVTMDTPPSGTDVVVTATVTDVAGNTATGSDAATLDYV
FT                   EAPAPAAPTVEITEDANNDGYINSAELDGQINITVTLDAGTSVGDTLVVTDQDGNELFN
FT                   GVVTTDMLTNGLPLTMDAPATGTTVTVTATLTNANGDSAASHDSATLDYGTGTGAPASP
FT                   TVEITEDANNDGFINHTELDGQIDATVTLGAGTAVGDTVTITDQDGNTLFSGPVTQDML
FT                   DNGINVSLDAPATGTDVVITATVTDVAGNTATGNDSATLDYGTGTGAPAAPTVVITEDA
FT                   NNDGFINEAELDGQINATVTLGAGTVIGDTVTVTDQDGNTLFTGAVTQDMLDNGISVSF
FT                   DAPATGTTVAVTATVTDPAGNTAQGSDNALLDYGTGTGAPASPTVTIDEDINNDGFIND
FT                   VELSGQIDITVSLGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDNGLTLAIDAPVTGTE
FT                   LVVTANVTDPAGNTATGNDSATLDYGIGSGAPASPTVTIDEDINNDGFINDAELDGQIN
FT                   ITVELGEGTAVGDTLVVTDQAGNELFNGVVTQAMLDSGLSLAIDAPATGTELVVTANVT
FT                   DPAGNTATGNDSATLDYGSSAPLAPTVEITEDANNDGFINDAELNGQINISVTLGAGTV
FT                   IGDTVTVTDQDGNVLFSGPATQDMLDNGLALAIDPPATGTNLVITANVTDPAGNSATGS
FT                   DAATLDYGVGVGAPAAPSVTIDEDTNNDGYINEAELDGQINITVELGEGTVVGDTLVVT
FT                   DQDGNELFNGTVTQDMLDNGQAVTMDAPATGTDVVITATVTDEAGNTATGNDAATLDYG
FT                   TGVGAPASPTVEIVEDANNDGFINDAELDGQINITVELGAGTAVGDTLVVTDQAGNTLF
FT                   SGPVTQAMLDSGLDLAIDAPATGTEVVITANVTDVAGNTAQGSDSATLDVGTGTGAPAA
FT                   PTVTIDEDANNDGFINDAELDGQINITVELGAGTVVGDTLVVTDQAGNELFNGVVTADM
FT                   LTNGVPVTMDAPATGTDVVVTATVTDAAGNSAQGSDAATLDVGTDAPAAPTVEIVEDTN
FT                   NDGTITDAELDGQINITVTLGSGTEVGDTVTITDQTGEVIYTGPVTQDMLDNGIDAVID
FT                   APATGTELVITATVTDVAGNTATGNDSATLDYDDSVTVPGAPTVVITEDTNNDGYINDA
FT                   ELEGQINITVELGANTVVGDTLVVTDQDGNELFSGTVTQDMLDNGLDLAMDPPATGTNV
FT                   VITATVTDTLGNEAAGSDNALLDYGSGTGAPAAPTVVIDEDINNDGFINDAELDGQINA
FT                   TVTLGAGTVVGDTVTITDQDGNTLFTGTVTQDMLDNGIDLSFDAPATGTDLVVTATVTD
FT                   AAGNSATGSDAATLDYGTGTGAPASPTVVIDEDANNDGFINDAELDGQIDITVTLGAGT
FT                   AVDDTLVVTDQDGNVIFTGTVTQEMLTNGVPVTMDAPATGTDVVVTATVTDAAGNTAQG
FT                   SDAATLDYGTGTGAPAAPTVVIDEDANNDGYINDAELDGQIDATVTLGAGTSVGDTVTI
FT                   TDQDGNVIFSGPATQEMIDNGLAVTIDPPATGTNLVITATVTDPAGNSSQGSDSALLDY
FT                   GTGTGAPASPTVVIDEDINNDGTINDTELDGQIDITVTLGAGTAVGDTLVVTDQAGNVL
FT                   FTGVVTQAMLDNGLAVTMDTPPSGTDVVVTATVTDVAGNTATGSDAATLDYVEAPAPAA
FT                   PTVEITEDANNDGYINSAELDGQINITVTLDAGTSVGDTLIVTDQDGNELFNGVVTTDM
FT                   LTNGLPLTMDAPATGTTVTVTATLTNANGDSAASHDSATLDYGTGTGAPASPTVEITED
FT                   ANNDGFINHTELDGQVDATVTLGAGTAVGDTVTITDQDGNTLFSGPVTQDMLDNGINVS
FT                   LDAPATGTDLVITATVTDVAGNTATGNDSATLDYGTGTGAPAAPTVVITEDTNNDGFIN
FT                   EAELDGQINATVTLGAGTVIGDTVTVTDQDGNTLFTGAVTQDMLDNGISVSFDAPATGT
FT                   TVAVTATVTDPAGNTAQGSDNALLDYGTGTGAPASPTVTIDEDINNDGFINDVELSGQI
FT                   DITVSLGAGTAVGDTLVVTDQAGNTLFSGPVTQAMLDNGLTLAIDAPATGTELVVTANV
FT                   TDPAGNTATGNDSATLDYGIGSGAPASPTVTIDEDINNDGFINDAELDGQINITVELGE
FT                   GTAVGDTLVVTDQAGNELFNGVVTQAMLDSGLSLAIDAPATGTNVTITATVTDPAGNTN
FT                   SNSDTALITNATNDAITVLEDNTASGNVLANDGAGHISVTGFTMDTDGDSVEESFDVNT
FT                   NVTVEGGTLIINSDGSYSFTPAANWNGVLPVITYTTNTGDTATLTITVSSVDEPVIAND
FT                   DSYTVNEDGSISINLLGNDVANDGGLAIQSINGVTLTGGAQNITVPNGTVVIATDGTMT
FT                   FVPDANYNGNVSFDYVATDVDGDTDTGTVTITVDNVDDPVIANDDSYTVDEDNSIAIDL
FT                   LGNDVANDGGLAIQSINGVTLTGGAQNITVTNGTVVIAANGTMTFVPDANFNGNVSFDY
FT                   VATDVDGDTDTGTVTITVNSVDEPVIANDDSYTVNEDSSIAIDLLGNDVANDGGLAIQS
FT                   INGVTLTGGAQNITVPNGTVVIATDGTMTFVPDANFNGNVSFDYVATDVDGDTDTGTVT
FT                   ITVNNVDDPVVANDDSYTVDEDNSIAIDLLGNDVANDGGLAIQSINGVTLTGGAQNITV
FT                   TNGTVVIAANGTMTFVPDANFNGNVSFDYVATDVDGDTDTGTVTITVNSVDEPVIANDD
FT                   SYTVDEDNSIAIDLLGNDIANDGGLTIQSINGVTLTGGAQNITVTNGTVVIAASGAMTF
FT                   VPDANFNGNVSFDYVATDVDGDTDTGTVTITVNSVDDPVTANDDSYTVDEDDSIAINLL
FT                   SNDLAPDGGLALVSINGVTLTGGAQNITVPNGTVVIAANGTMTFVPSPNYNGSVSFDYV
FT                   ATDLDGDTDTGTVNITVNSVDDPVVANDDSYTVNEDQPVVLNLLSNDVANDGGLAIKSI
FT                   NGVTLTGGAQNIAVTNGTVVIALSGAMTFVPNANFNGNVSFNYVATDADGDTDTGTVTI
FT                   TVNSVDDPVIANDDSYTLNEDGSIAINLLGNDVANDGGLAIQSINGVTLTGGAQSILVD
FT                   NGTVVIASDGTMTFVPDANFNGTISFDYVATDADGDTDTGSVTITVNSVNDDPDAIDDY
FT                   TMIIDAGAIATGYTGDSSSSTIVEGYGTDKVDDSAYLTTTHPDGSYTVVWRAWDTSYSG
FT                   NNKVFMQRFNADGTENGDKLTLGSRAKIESPQVTRLNDEGDLLVTWTGYNNSSSLNTHS
FT                   YAQVVYANPADHGGATMGPEMDLGASALRSVTSEQSGDNSILVWQNGFTLYMQVLDSDG
FT                   NKVGGAQTVGSISTNTNGFPIEGKPEISVLDNGNYVISWSHGSTSTATNVVLMSSDGTQ
FT                   IGSTQTLNIGRTEGVDDLETNVISIGSSGIYAVVGSTGGVVKMTLVNGSTNVPVANSTQ
FT                   TLSLAGTTGNDMPSITTIGSNGEFVVVWRGIEGGQWHTYIQRFNADGSKDGATDKFMAS
FT                   GGHGPAKVVSVGDDGDYVIVWASINNAGNYDVHTQKYDADGNKVGTELTFTGEQANIND
FT                   LGFDIVAVGNNGAYAVSFVGTDSAANGGDLSIYIGQVDENGNKVVTYPDGGTGDFDITT
FT                   SVVAAAGGTYNATFSTGVLTIVTAGGQTLTYQPGSTHSIAKDIWDNATSIKLIGAVGAD
FT                   YDLVVTTSVAITTEEDTAIVINTSDLLVNDTDIDGDTLTVVSVQDPQNGTVVLHANGTI
FT                   TFTPNANYHGPASFTYTISDGNGGTDTATVYLTVTPTDDPVSITTPAKMILDEDQLSGG
FT                   TGTEIDPVVQTQQFTVSAPDGLNRLEITNSGVTTSVTLAMLLAATPAAAIVIEGEHGTL
FT                   TITDYDASTGTVTYSYTLSEAQTHSLTEDELSDNFGVTAYDIDGDTSSTTLEVGILDDH
FT                   AQATLDTNGVDVLTDGFEVSGIVGEWSSWTGGGPYLTRFDSDDNDAGLDQMRWGVANVD
FT                   VASGYSFIDNDTGLDGVLELNQDIVLGDFTHINFPVFSSITQATLTVNFTITDSFGVVT
FT                   TVGIDINFDHNETPNSSDPEASRDIINIGQPEVTFQYEGEFYTIKVLGFIDENGDLVTT
FT                   VRTYENQTNTYELIAKVVEGVGYHLPNKEGNVLSNDLGSDGLTVVGVAFTNDDGTDIFT
FT                   GVGTTIQGTYGNLVLNADGTYEYQLTAGTNIIPEDATETFVYTIRDSDGDVSTTKLIIG
FT                   VTPSDFNGVPVDIDLNVDGNDGNDSILVVDGENSANPNQLNVNFGGGLQGTITNQAGAE
FT                   VLVTSGTAYSTHSAQNVSSGAGQDHIETGSGNDIIYAGSTGNSVSGNTDNDIELSTSTL
FT                   LSHHIMTGSLNGSNSIVDNDGLLLSADVTSEKADVVNAGSGDDMVYGQTGSDILYGHTG
FT                   NDTLDGGNHNDALRGGRGDDTLIGGQGDDVLRGDAGRDTFVWNKDELGTDHIIDFNLGQ
FT                   DKLDLSDLLQGETADNLFLYLHFTINDTTGTTTIDIDADHNGTFEQHIVLDGVDLSDIY
FT                   GDTESEIINGLLGDNGDGPLIINTVADASSPSPTGPGSDPSLEENQVTHLIP"
FT   gene            complement(646718..656497)
FT                   /locus_tag="Swoo_0478"
FT   CDS             complement(646718..656497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0478"
FT                   /product="outer membrane adhesin like proteiin"
FT                   /note="KEGG: sdn:Sden_0384 hypothetical protein; TIGRFAM:
FT                   outer membrane adhesin like proteiin; PFAM: Hemolysin-type
FT                   calcium-binding region; von Willebrand factor type A;
FT                   SMART: Cadherin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84776"
FT                   /db_xref="GOA:B1KQC1"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC1"
FT                   /protein_id="ACA84776.1"
FT                   /translation="MMLYVTTQQGKVIFVDGNTVIDIDGAKKKIVANDYFHSGAKIYIE
FT                   DNTQFIISYADGSIYSNNPTTDPAQEQSNLASIDEIQSLQNLIESGEDPTLELPETTAG
FT                   GSGNEGGFDFTSLIRTADETLAASGHDTKGFQFISAPVDEDPLSTLEELPAPSLSSSSL
FT                   TFSESQLPQGSTPTNNELNQVSSIFFTPQSGILSLSINGEVIFANGVFEGPLNLATASG
FT                   LLTITGLNINTGLISYSYTLNSAFNHTETDIHTDIFTLSLVNTQGETASSRISINLLDD
FT                   NPSGQNDLEEIDEDTSLVVGDVLNNDTLGADSANITQITNSTGESNSVFQSTVISGSFG
FT                   TLTISADGSYTYQLSTELDTVQSLTVGEIITEIFTYQLTDSDGDSIELTLSINIRGTND
FT                   APIITPPDDRNRDGYDAGTTIESGNLDDGTPVAGVSIAIGTLEATDVDNQASLNWSGNT
FT                   SGLYGTFTIDATTGEWVYTLDNNLADSLIEGQLIEESFIVTVTDEFDKSDTHTVIITIN
FT                   GTNDSPVITSQLADATGMVQEVNDPNVASASGTLTATDVDTGAVLQWSGNDTSPLGDFT
FT                   IDPDTGTWTYTLNNSAADYLAEGEQVVETFLVTVIDEFDAIDTQIVTITITGTNDAPVI
FT                   TPAVDSPGDGYDTGTATEAGNLDDGTPVAGVSTATGTLEATDVDNQASLSWSGNTSGAF
FT                   GAFTIDTITGEWVYTLDNNLADSLIEGQVVEESFIVTVTDEFGESDTHTVTITINGTND
FT                   SPIITSTAEDASGDVLEAGVQDGGNTPEPGTLQTAGILTAHDVDQGAILTWYGNAAGTY
FT                   GNLSIDPNTGSWTYLLNDNDLVDSLASGEQHEEIFLVTVIDEFGAIATQEVTVLVTGTN
FT                   DLPILNLDDSGGVTRNATTPNLNDTGILSFSDVDTGDTHTISESYLNNINWSGGLISDQ
FT                   LSAAQITSLIDGFSVDINGWDYTILNTLVQFLAEDETITLSFNVTVTDNNGAYDTETVN
FT                   IAIYGTNDDPVLIVTPLGSVTEDASNPMLNDSGTLSYTDGNATDTHTVTEIYNSDINWN
FT                   GGALESQLSTAEIASLIDGFNVNNSGWIYSIPNALVQFLALGETITLSFNIIVTDNRGG
FT                   SDTELVTITINGTNDNPVLTTDTTGSVTEDLNVINLLLSDSGNLSFTDVDVTDTHTVSQ
FT                   TLTGPVLWSDGSLSQAQIDAFVAGFSVDNSGWGYSIDNSLVQFLAASETITLSFTVTVN
FT                   DGNGGTDSELVTITINGTNDEPVLTVDISGSVTEDNSSPNLTDSGALSFTDVDVNNTHS
FT                   TSEVYNSDISWSHGTLSDELSALEIQSLIDGFSVDSNGWDYSILNSLVQFLALGETITL
FT                   SFDVTVTDNDGGSDTQTLSLTINGTNDEPVLTVDISGSVTEDDSSPNLTDSGTLSFTDV
FT                   DVNNTHSTSEVYNSDISWSHGLLSDELSALEIQSLIDGFTVDSDSWDYSILNSLVQFLA
FT                   LGETIALSFDVTVTDNDGGSDTQTVSLTINGTNDEPVLTVDISGSVTEDDSSPNLTDSG
FT                   TLSFTDVDVNNTHSTSEVYNSDISWSHGTLSDELSALEIQSLIDGFTVDSDSWDYSILN
FT                   SLVQFLALGETITLSFDVTVTDNDGGSDTQTVSLTINGTNDEPVLTVDISGSVTEDNSS
FT                   PNLTDSGVLSFTDVDVNNTHSTSEVYNSDISWSHGLLSDELSVLEIQSLIYGFTVDSDS
FT                   WDYSILNSLVQFLALGETITLSFDVTVTDNDGGSDTQTVSLTINGTNDEPVLTVDTSGS
FT                   VTEDDSSPNLTDSGALNFTDLDVNNTHSTSEVYNSDISWSHGTLSNELSALEIQSLIDG
FT                   FTVDSDGWDYSILNSLVQFLALGETITLSFDVTVTDNDGGSDTQTLSLTINGTNDEPVL
FT                   TVDISGSVTEDDSSPNLTDSGTLSFTDVDVNNTHSTSEVYNSDISWSHGLLSDELSALE
FT                   IQSLIDGFTVDSDSWDYSILNSLVQFLALGETITLSFDVTVTDNDGGSDTQTVSLTING
FT                   TNDEPVLTVDISGSVTEDDCSPNLTDSGALSFTDVDVNNTHSTSEVYNSDISWSHGTLS
FT                   DELSVLEIQSLIDGFTVDSDSWDYSILNSLVQFLALGETITLSFDVTVTDNDGGSDTQT
FT                   VSLTINGTNDEPVLTIDTSGSVTEDLNVVNLQLTDSGNLSIFDVDVNDTHTVSHALSGT
FT                   VTWSDGTLTQGQIDDLVAGFTSDGNSWDYSINNSLVQFLDVNEAITLSFLVTVDDGHGG
FT                   SDSELVTITIHGAKDLPEVVSISPIILSEEGLNNGIIDNIGDPSDTTNATVNSGILSFT
FT                   DLDSELFTLNLTGPSGLTSGGETVNWTWSVGTQTLTGSTSSGVVMTIALGAITNSGINF
FT                   SLDYTVSLFAPLDHPVNDTEDIISLDFGVTINDGSGDTATVLTVTIEDDAPLDEVDEAA
FT                   NPNLTQIVNQFITGDLFDPGADGFGDISFDVITPGLHSNGFELIYTMNGDTLTATANGV
FT                   EVFTLQAILDANGHYDYKLTLLQQIDVESLIDFDLANSPAGNNPIYYIDSDGSIYAQDN
FT                   QAANPIATITGTVNGGASNLNSNSSGLGVGPQASIGTGEVITIDYGAAGTGLTSISLGT
FT                   GNNGNHTGTTAIQYIVTYSGNTTKVVNTTINGTLTIEELAPNGLSISSVDIAYISGEAF
FT                   QIIGLASTGIITDQPIDIEFAYGATDNDGDAVTFTDTNNGHFTVTLIPENYVPNALNNT
FT                   YNVDQGHSVTGNIIEDDTGNGRDRDADGDTLTVTHINGDALVFDNNGNAHIAISGGMLS
FT                   IKADGSYIFTHNGSANLSNGFSYTVNDGNGDTDTADVEILVFAHQTLNPGDDSLNITGD
FT                   TQDLVIGDTTGIIPGQNYNIAFIIDTSGSMGSTAVNTAEQQLLTVYSQLLSYAEQNNSG
FT                   VINTLLVDFDTDASLLISINLTDPNALQLLSNALATMTSGGATNYYDAFSTAYDWFQNG
FT                   VPTTNNGNNITYFITDGQPTTDNGHPGNYYQNALNAFALLNTLSTVQAIGLGGDIDTNV
FT                   LVNFDTDGNILNNVDVNDLADSILATNLLPGSDAVDAGAGDDILFGDLVEFTGIDGQGY
FT                   EALREYVANNTLLNISDITASDVHQYVSEHTSEFDISRSDDSGDTLIGGESNDILLGQG
FT                   GDDQLIGGVGSDTIIGGIGNDMLDVGQDNDIDILIWGPISDNNAHDIVKNFDFFHEDKL
FT                   DISDLLVNEQTGNLEDFLSFNFVAGDTIITLDTNGSASGGDVMTITLEGVNLFTEYGVI
FT                   PDGVYDNNDYATIIAGLLDNEALVVDFI"
FT   gene            complement(656821..666510)
FT                   /locus_tag="Swoo_0479"
FT   CDS             complement(656821..666510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0479"
FT                   /product="outer membrane adhesin like proteiin"
FT                   /note="KEGG: plt:Plut_0676 VCBS; TIGRFAM: outer membrane
FT                   adhesin like proteiin; PFAM: Hemolysin-type calcium-binding
FT                   region; SMART: Cadherin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84777"
FT                   /db_xref="GOA:B1KQC2"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC2"
FT                   /protein_id="ACA84777.1"
FT                   /translation="MGVSTATQDAIVINLVGQLKAKDGQGNIRELAIGDLIEEGEQLIF
FT                   SATAQFNLQMADGSIINEQNIIPPEPEQALPDDLQQALTAESEVFGIDDEIAAIQAQIL
FT                   AGDDPTLDLPATAAGAGTGGNEGGSGFITLGRSADETLADSGYDTNGFAGAPATEIDPT
FT                   VTTDDPTLPTISSSSVTLAEANLAAGSAPLADALIQTNTISFTTDNGIENLTINGNAIF
FT                   AAGVFTGPISFASANGVLTISAFDPSTNTLTYTYQLSSPLNNLTTDTITETFALELTDE
FT                   LGNSASSTISVNILDDAPSGENDANNLDEDTISVTGNVLNNDTQGADTATLSLIVNSDG
FT                   VSQTLGQETVISGSFGVLQISADGSYTYLLTTDSADVQSLSQGELVTDSFSYQLLDADG
FT                   DIVTLTLSIDITGTNDAPIITTTFGEASGVVIESGNEDDGTIIPGEPVVGGTLTATDID
FT                   NGAQLSWSFTPQTNNFGSFSLDSTTGVWSYQLDNTLADSLAEGQSAQESFLVTITDEFG
FT                   ATDTQLVTITVQGTNDSPVITSTDIDASGTVTEAGNEDSGAITAGVTQTSGLLTASDID
FT                   DGAIQTWSFVPQSNNFGSFNINTATGQWRYNLDNELADSLAEGQTASETFLVTVVDEFG
FT                   ATDTQIVTVTVQGTNDSPVITSTSADAIGTVIEAGSEDDGTPIAGTAQVSGTLTVSDVD
FT                   SGASHIWSFDPQANEYGTFAIDPATGAWTYSLDNELADSLAENQQVQETFLVTVTDEFG
FT                   AVDTQLVTVTVQGTNDSPVITSSQADASGSVIESGNLDDGTVVDGVSETGGTLTASDVD
FT                   SGATQSWSFSAQTNLYGTFSLNAATGEWTYILDNTLADSLSEGEFAQETFLVTVTDEFG
FT                   ATDTQLVTVSVQGTNDSPVITSNQTEASGEVVETGNQDDGKVIAGTTQISGDLGDIDID
FT                   SGTIETWSFVPQSNEYGTFTLDPDTGGWVYDLDESIADTLPEGESVEEQFLVTVEDQFG
FT                   AVDTIVVTITVQGTNDSPIIFIGEGDSASGTVIEAGNLDDGTLVPGTASIAGTLSVSDV
FT                   DTIVTDNPVWSFAPQTNAYGTFSIDSATGAWQYNLNNSAADNLAEGQSAIETFLVTVTD
FT                   EFGATDTQVITITVQGTNDAPVITSDTESATGAVLEAGVVDGGNDIEPGILQTSGTVTA
FT                   SDVDLGSSLSWGGNAQGVYGSFTIDPNSGSWNYTLNNSALVDSLASGEQHNEIFLVTVT
FT                   DEFGAIATQEITITVTGSNDVPVLTLDDTGGLTKDISEPNLSDSGLLSFTDVDNGDTHT
FT                   VTESYNGNLVWSAGQISDHLTNEEINSLIDGFSVNNNGWDYTALNSLFQFLGEGETITL
FT                   SFDVTVTDNNGANDTETVNITIFGNNDLPVLSVEPLGSVTEDFTSPNLSDTGSLSFTDP
FT                   NATDTHTITEIYNGDIQWSGGLLDAQLSEAEISTLIDGFSVDNDSWDYSIPNALVQFLA
FT                   VNETITLSFNVTVTDSRGGSDTELVTITINGANDIPSIEGTNSGDVQEDVAVVPTSTLT
FT                   ANGSGSFNDIDITDSHTMSSLLTTAATWSGGLLSDELTGQQIDDLSSGFSAQIDSQQTD
FT                   SWSWDYTVNNDLLQFLAQGQNITMTFTVTIDDGNGGTNAQEITITITGTNDDPVISIEQ
FT                   GDSASGTVIEAGNFDDGTIVAGTDTVSGTLSVSDVDSIISDNPIWSFAAQTNLYGNFSI
FT                   NAATGAWEYELDNSAADSLAEGQSAIETFLVTVTDEFGATDTQMVTVTVQGTNDSPVLS
FT                   IEQGDSASGTVIEAGNLDDGTVVAGTAMINGTLSVSDVDSIVTNNPIWSFAAQTNLYGT
FT                   FSINAATGAWEYELDNSAADSLAEGQSAIETFLVTVTDEFGATDTQMVTVTVQGTNDSP
FT                   VLSIEQGDSTSGTVVEAGNLDDGTIVAGTDTVSGTLSVSDIDSIITNNPIWSFAAQTNL
FT                   YGTFSINAATGAWEYELDNSAADSLAEGQSAIETFLVTVTDEFGATDTQVVTVTVQGTN
FT                   DSPVLSIEQGDSASGTVIEAGNLDDGSIVAGTAIINGTLSVSDIDTIVTDNPVWSFTAQ
FT                   TNLYGSFSIDAATGAWQYNLDNSAADSLAEGQTAQETFLVTVTDEFGATDTQLVTVTVQ
FT                   GTNDSPVLSIEQGDSASGTVIEAGNLDDGSIVAGTAIINGTLSVSDIDTIVTDNPVWSF
FT                   SAQTNLYGSFSIDAATGAWQYNLDNSAADSLAEGQTAQESFLVTVTDEFGATDTQVVTI
FT                   TVQGTNDSPVLSIEQGDSASGTVIEAGNLDDGTVVAGTAIINGTLSVSDVDTIVTDNPV
FT                   WSFAAQTNLYGSFSIDAATGAWQYNLDNSAADSLAEGQSAQESFLVTVTDEFGATDTQL
FT                   VTVTVQGTNDSPVLSIEQGDSASGTVIEAGNLDDGTVVAGTAIINGTLSVSDVDTIVTD
FT                   NPVWSFATQTNLYGSFSIDSATGAWQYNLDNSAADSLAEGQTAQESFLVTVTDEFGATD
FT                   TQVVTITVQGTNDSPVLSIEQGDSASGTVIEAGNLDDGTVVAGTAIINGTLSVSDIDTI
FT                   VTDNPVWSFAAQTNLYGSFSIDAATGAWQYNLDNSAADSLAEGQSAQETFLVTVTDEFG
FT                   ATDTQLVIVTVQGTNDSPVLTINDLTAEVTEDASDPMLTDSGVLSFSDVDLTDTHTVSE
FT                   VYNNNINWTGGDITSVLTAQQITDLIDGFSVDNDSWDYNIANSLVQFLAIGESITLSFD
FT                   VTVTDINGATDTETVTVTINGTNDPLEGDFQKDIWMPAALEEIVDPYTAGYPLLLTAPS
FT                   DVDTNDSLTITVSMIPSEGEVGYYDGNNIFVPLTVNDVITTDMLTNLVYMPSGNITAAN
FT                   EYTLSFTMQSGSEEVITTYNIHTIPPTSLPGQSVQIGDGSSPLTSGNDQDAQLVLNSNF
FT                   ASNITNNPDLASLVLFTDFQKSPFDTPIPANEIGGTAGTEREDEVSIRLTINGIVFVVL
FT                   AAANGVTDWFYDVETGLMRAEFDYSIIVQESDPSITLIDYINSNNYTPAGGDIWTITYL
FT                   DNDGGSYQARFVQANFVFDSQGDPSLTITGTAGVDNLLFGGTSHDTLTGAELNDRIFAR
FT                   EGDDLLDGADGDDELVGGSGNDTITGGAGNDYLNGGADNDVLDGGTGSDILIGGMGSDT
FT                   LDAGLDSDNDTFIWQTGDADASSDIVQNFNLSHDILDLSEVLLDEENNSLESYFTFNFV
FT                   GGSTIITVDTNGALAGGDTVTITLENVDLSQEYGDINETVILDGLLFDEAIVVDLLP"
FT   gene            complement(666790..667959)
FT                   /locus_tag="Swoo_0480"
FT   CDS             complement(666790..667959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0480"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein; KEGG: sse:Ssed_4136 HemY
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84778"
FT                   /db_xref="GOA:B1KQC3"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC3"
FT                   /protein_id="ACA84778.1"
FT                   /translation="MIRVLAYLAIILIGLCISPFFDGMNGYLYVAFWDYEVEMGVVTAI
FT                   VGLILFYCILQVVEWCLVFLLNLILSSRLLPEKWRRKAARKHTLVGALALAEEDWPVAE
FT                   KAMAKGAEKGELPALNLLAAARAAQHQNDSTSRDNYLNEAEKEPIAVNAVTTTRTRYLL
FT                   QQGDLISAREQLDKLSPSSKSKLPVLRLAIELYQAQSDFNALKLLLPIIKKRQLLSDSA
FT                   FAELTMSTNRSLLLSATEVSEQELEKVWHWLSRAERKEMSYLTLYCIGLNRYDRKPEAL
FT                   KLLMKHLKSSPSTELLTGLGEILLPTDLDERELIFSMEKKHAENIDFQILLAKLHQQNS
FT                   DHRRAKEYWQKVCQIQPSKAHWLALGEAQEHLGEQNPAILSYRNAIKAD"
FT   gene            complement(667956..669107)
FT                   /locus_tag="Swoo_0481"
FT   CDS             complement(667956..669107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0481"
FT                   /product="protein of unknown function DUF513 hemX"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   sse:Ssed_4135 protein of unknown function DUF513, HemX"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84779"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC4"
FT                   /protein_id="ACA84779.1"
FT                   /translation="MDNKELDENLQEPKREIVSEEKAQALNISKSTDETSSPTPQSDSR
FT                   SSGVSWGFLFNLVLILLLTFVTLGGGYYLHQELTKQTDRAQNLAQELRLALKEPSNQIS
FT                   RLDQEQRQAQAQLSQELENLNATQLKLNDRVAKLAQRNPNHWMAEEAKYLVRMAGSKLW
FT                   LEKDPSTAVSLLKAADQRIESMKDPSLTPLRKALAQDIAQVSVIKSTDIAGTVLMLDSM
FT                   IENLDKLPLNRADLINAANMVDNSKMTESIDDWQSNLAKSWQALMDDFVVVRKRTTDVT
FT                   PLLKPDEQWYLVENIRNKLLQSQLALYRQDEVNYRQSLTLARKWIYQYFDLKNTQTEEA
FT                   LAALDALSTLEIQTPKIQQFSSTPLLQQLVIHGNLMISEEPSL"
FT   gene            complement(669164..669895)
FT                   /locus_tag="Swoo_0482"
FT   CDS             complement(669164..669895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0482"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   sse:Ssed_4134 uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84780"
FT                   /db_xref="GOA:B1KQC5"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC5"
FT                   /protein_id="ACA84780.1"
FT                   /translation="MKLLLTRPKGRNQSMSEALTQLGVPYIITPLLEVQASKTHQDQDA
FT                   IAHFNAADIIIFISTNAVEFSSQVIELKKHKTAQFYAVGDATFQALKALGIDAFAAPSD
FT                   CQQTEGLLTLADLQELTGQNIMIVRGVGGRETLAEKLTQRGAKVNYWETYQRACPAINE
FT                   RTPYLWHDEKVDTIIITSGEILHSLIKLVPKELFAWLRACHIIVPSSRVKEQALAYGLE
FT                   HVTNAKAANSKAMLSALGLSI"
FT   gene            complement(669905..670834)
FT                   /locus_tag="Swoo_0483"
FT   CDS             complement(669905..670834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0483"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: sse:Ssed_4133 hydroxymethylbilane synthase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84781"
FT                   /db_xref="GOA:B1KQC6"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /protein_id="ACA84781.1"
FT                   /translation="MSQNVIRIATRKSPLALWQAEFVKAELEKFHPDLTVELLPMSTKG
FT                   DIILDTPLAKVGGKGLFVKELEVAMLENRADIAVHSMKDVPVDFPEGLGLEIICEREDP
FT                   RDAFVSNNYKSISELPKGAVVGTSSLRRQCQIRAARPDLQIRDLRGNVGTRLGKLDAGT
FT                   YDAIILAAAGLKRLKLEERITSFISAEESLPANGQGAVGIECRTDDERVKALLAPLEHA
FT                   ETRFRVIAERAMNTHLEGGCQVPIGAYAEIVDDTLTLRGLVGNPDGTQIIASTKVGPKT
FT                   DAKALGISLAEELLSKGAKTILDAVYIK"
FT   gene            671140..673563
FT                   /locus_tag="Swoo_0484"
FT   CDS             671140..673563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0484"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylate cyclase class-I; KEGG: sse:Ssed_4132
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84782"
FT                   /db_xref="GOA:B1KQC7"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC7"
FT                   /protein_id="ACA84782.1"
FT                   /translation="MVNDQSHFVETAQRLNRIRLARALAILSPLKRDLLRLIPLLFHFH
FT                   RVGYPGYNGPLTPSGIFNYQASESEYSACSTLGLVPPNLHLVNHPAIEGIYSMGSMASF
FT                   GQNPKSDVDLWLVHDRLLSPNECRLLEEKSALISQWFEQYGLEVNIYLVHPEQFIKSSD
FT                   SDEEFQTSIGLEHSGSAQHWLLLEEFYRSQICLAGKTVAWWPDAKRSEELLFLGDVSQI
FT                   PASEYFGASLWQLYKGLNKPHKALLKVLLLEAYASQYPNTCLVSGKVWQRTMEGDFSAE
FT                   NDAYFLLYESIESYLLAQDDLRRLDIVRRCFYLKCGLRLSEKNQAKDWRYHKLSMLVEN
FT                   WKWSNSLLQTLDHCEDWHCGQLQWFNEQLNELMLGSYQTLLQFASTQKLSKSLKLSELG
FT                   LLTRKLHTYFSSDIQQIISLNRLWSDSVCEADLTIIYSKNSQEYCLYRCKPAPRNFIGQ
FT                   RAVYRSKSKAKLMAWACLNGVANDATAWYEFSEGKRKSSSLSKASKRLVTFFEHADLRV
FT                   SKMDFCQPWRYKKLVFLLNFNHDPTGLWQGQEIMVDYMNANIFSLGREQKNMLESIDII
FT                   CLNSWGEWHCHHYEGEFGLLDALCFITAGIRRGAGDIAIEVISCSTKLKSQFERTVGNL
FT                   MQRAIRLSLQVSSSATLVYPLKVSGIEYGLFFNSKGMVYQNLNDTKGLFQQLTKKKLLE
FT                   LPRPDLGNEPFSKVPEVIQDFAARGAIQYFLRQNEQELDVFILNESNELDHYQQSGIDI
FT                   DELVSKVSHHHAFEEFKASQQRFNLPQFFRLIRVDGRLRALPFGISVDEVDFEF"
FT   gene            complement(673600..673929)
FT                   /locus_tag="Swoo_0485"
FT   CDS             complement(673600..673929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0485"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: sse:Ssed_4131 frataxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84783"
FT                   /db_xref="GOA:B1KQC8"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC8"
FT                   /protein_id="ACA84783.1"
FT                   /translation="MAMTDTEFHQLADEMFQAIDNAIEIAIDEQDADVDIDASGNVLQL
FT                   TFEDTSKIVINKQEPLHQIWVATKFGGYHFSFVEGKWIDERNGGEFMPFVIDSILKQGD
FT                   IQLSL"
FT   gene            674377..675621
FT                   /locus_tag="Swoo_0486"
FT   CDS             674377..675621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0486"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: sse:Ssed_4130
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84784"
FT                   /db_xref="GOA:B1KQC9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQC9"
FT                   /protein_id="ACA84784.1"
FT                   /translation="MDHFLYKNGELLAEDCQVAELARTYGTPLYIYSRATLERHWHAFD
FT                   SAVANHPHLICYAVKANSNIAVLNVLARLGSGFDIVSGGELSRVIEAGGDPKKVVFSGV
FT                   GKTVEEMEMALNLGIHCFNVESAAELEQLNLVALKLGKIAPVSLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIAMDDAEAIFARAHALPGLQVKGVDCHIGSQLTEIKPFLDAMDRILALID
FT                   RLAEQDIIIEHFDVGGGLGVTYDDETPPQPDVYASALVERLGDRKLKLIFEPGRAIAAN
FT                   AGIFVTQVLYLKGNSDKHFALVDGAMNDLIRPSLYSAWQKIIPVVPREGESRNYDIVGP
FT                   VCETGDFLGKERELCLEPQDYLAVRSSGAYGFTMSSNYNSRPRAAEVMVDGEQAHLIRQ
FT                   REKLSQLWQGEQLLP"
FT   gene            675694..676533
FT                   /locus_tag="Swoo_0487"
FT   CDS             675694..676533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0487"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: sse:Ssed_4129
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84785"
FT                   /db_xref="GOA:B1KQD0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /protein_id="ACA84785.1"
FT                   /translation="MIHFAKMHGLGNDFMVVDGVTQNVFFSPEQIKRLADRNFGVGFDQ
FT                   LLLVEPPYDPDLDFHYRIFNADGGEVEQCGNGARCFARFVRNKGLTNKHKIKVSTSNGK
FT                   ITLRLERDGNVTVNMGVPVLDPSKIPFNAKRVEKTYLLQTSSSHAMETFLCGAISMGNP
FT                   HCVLEVEDIEHAEVERIGALLTQNERFPKGVNVGFMQVIDAGHIKLRVYERGAAETLAC
FT                   GTGACAAAAVGQLQGKLNKMVRVDLPGGTLTINWEGEGNPLWMTGPAEHVYDGQIPQ"
FT   gene            676530..677168
FT                   /locus_tag="Swoo_0488"
FT   CDS             676530..677168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0488"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   sse:Ssed_4128 protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84786"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD1"
FT                   /protein_id="ACA84786.1"
FT                   /translation="MTKASKEKTPAPFDELLIREFLLDNPDFFNRYPELLLAMQIPHAE
FT                   RGAISLIERKQEMFRNRVQQLEEEITSLLGMASRNEMIYMFNTALSLKLLKCEDLGELR
FT                   QVLSEGLKTQFHFSHVRLITVHDIDSELSQIWSKRLNQGYYFGRLTMSESKRLFGSEVG
FT                   SVALSRLSEECGQVIFAIASQDAMHFHPEMDNLLLDQLKQLLDHLLPKL"
FT   gene            677189..678088
FT                   /locus_tag="Swoo_0489"
FT   CDS             677189..678088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0489"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: sse:Ssed_4127 tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84787"
FT                   /db_xref="GOA:B1KQD2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD2"
FT                   /protein_id="ACA84787.1"
FT                   /translation="MEVNWFQHFESYLSAERQLSKHTVRNYLFELNRVDQLLDDSTSWL
FT                   SVSREQIQSAMSQLHRRGLSPRSLSLTLSAVKQFCEFLLREGVIQTNPAINLSAPKQNK
FT                   PLPKNMDPDSVSHLLEIDGDDPLSLRDKAIMELFYSSGLRLAELAALNISDIQFSERLV
FT                   KVLGKGGKERILPIGKMAISAIDKWLACRRLIPCEHDALFITNKGTRLAHRSIQARLSK
FT                   WGQEQALNMRVHPHKLRHSFATHMLESSADLRAVQELLGHANLSTTQIYTSLDFQHLAK
FT                   VYDGAHPRAAKAKKDKSE"
FT   gene            678085..678804
FT                   /locus_tag="Swoo_0490"
FT   CDS             678085..678804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0490"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: spl:Spea_0381 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84788"
FT                   /db_xref="GOA:B1KQD3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD3"
FT                   /protein_id="ACA84788.1"
FT                   /translation="MIRCYIKPEEISAISFDLDDTLYDNSPIIEKAEAELAHFLHHKYP
FT                   RTSQFEREDWFALKRKLQKERPELCHDTGLARVSVLTLGLRQLGYSVKEAEAGGLEGLQ
FT                   CFLQYRSDFTLSQPVLELLHGLKQKYRLVGITNGNVDASRIGLGSLFDFVLSPGNGVRM
FT                   KPAPDMFNVALDRLNIPAVQLLHVGDSHSSDVVGARLAGCQSLWLNPAFGRSKVEQAKA
FT                   YLPHIEIDNIKQLKLLI"
FT   gene            complement(678871..700320)
FT                   /locus_tag="Swoo_0491"
FT   CDS             complement(678871..700320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0491"
FT                   /product="outer membrane adhesin like proteiin"
FT                   /note="TIGRFAM: outer membrane adhesin like proteiin; PFAM:
FT                   Hemolysin-type calcium-binding region; von Willebrand
FT                   factor type A; Cadherin; Na-Ca exchanger/integrin-beta4;
FT                   KEGG: sbn:Sbal195_4098 outer membrane adhesin like
FT                   proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84789"
FT                   /db_xref="GOA:B1KQD4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR028059"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD4"
FT                   /protein_id="ACA84789.1"
FT                   /translation="MESLVTTQNGQVRLVAGKVTITLDGITRTISSGEQVPASATLFIE
FT                   EGAQIEIAYDDGSFYSNTETADSPVNTEALDEIEALQALIASGDDPTLELPETAAGETN
FT                   GSEGGSGFISVARSGDETIANSGFNTSFENQAPLTTSLALGEIAPDSSNNFNIAQFSDN
FT                   FVNGIAYSTSSGLNGFTGDMGSDGSFAYNPGDTITFSIGNVIIASFSADAIQGTILFLQ
FT                   DIAGTSLSDTNMNYVENMAIFLQALDNDLSDGLDDGVLQTNSLLNLDASYASNINIVFA
FT                   IHELLSNYIDPTTGQPLNLATAGKEMLSLVLAELGIVFTRESELSSDGQNVFETQAMEH
FT                   VADTIDELAGDRTPDSHDDRTADILDVPGGLITYNYNELDGKITFSANDLLEGAIGQQV
FT                   TTENLVVKNVQLNAEFADIGTLVDLGNGNYEIILNEGITQYDLEGLSIDYRVEDWTASR
FT                   DVTSNTQDQYKSHLSADIPDVFENDGFNQFALNSELTFDEDSLLEINFTSELLSEQLGF
FT                   PIAEYADDYLVPIEYSNDGGVTWQTMTVTSIDYSGSIPRPVFGFVLEAGNDSVLIRVPI
FT                   FDDAAIEPTEFFHAVVTGENVYDETLDFAIFDNDSEGSDLPLIDINYALVVEGMEFAVF
FT                   TLTLSEPSTEVITVNYSTEELTALFGEDFIATSGTVTFLPGQTMAFINVPIVDDLIVED
FT                   SPEFALINLTDPVNAALVDSQGTLRIFDNDSPSNTPISIDIAPITGDNVITTAEGQQLI
FT                   TVNGTVDADPSITLAIITITINGVTYQTEMNADGSFSIQVDGTELVNDPDTTIEAVVYG
FT                   FGNNGEQGTANTTESYDIESILQDDQSVIDEDTIATGNVLTNDSDIDNDLSVVNFEVDG
FT                   ETYTAGTTVELEGGSIVINEDGTYIFTPNDNWNGEVPVITYITNTGSSATLTIAVNAVD
FT                   DPSIVNNDSNTVNEDTVATGNVLDNDSDIDNDLTVVSFEVDGETHTAGTTVELEGGSIV
FT                   INEDGTYIFTPNDNWNGEVPVITYITNTGSSATLTIEVNAVDDPSIVNNDSNTVDEDTV
FT                   ATGNVLDNDSDIDSDLTVVSFEVDGETYTAGTTVELEGGSIVINEDGSYIFTPNDNWNG
FT                   EVPVITYTTNTGESATLTLEVTPVIDGAPQVTITTDTNNDAFISNQELNGSSDIAVTVG
FT                   LEGTGAITGDTLNVNGVEIILSETDIENGYVNLTLPNPGEGQELTVTATITDQAGNTSA
FT                   PGSDSAVIDTLAEASIDLNQIIIGTDSIINSDEASGTVTLSGTVGGDAQVGDTVTLTLD
FT                   GSTIITTSVIDLGDGVLGFNTLVDASTLVEGETTTITATITTTDAAGNSSTATDSESYS
FT                   VDISVVDAPIVTIESDVNNDELLSKSELWGHDGVEVSIAIDGDKFESGGLVTINITNGD
FT                   NLETIELKLVNGELQFTDGSPANDYVYDNGVIYLLENKPAEGETITVTATQTDVSGNTS
FT                   NQGSDTATVDTKIDQDEDGHTVAITSITQDTGSATDDFITNDNTLIFSGTVDLGDSSTL
FT                   VVNIAGTDYTTDNGLVIDAQGNWSIDLTGTTLADGTYTVTATVTDVAGNTDSATQNVVI
FT                   DTKIDQDEDGHTVAITSITQDTGSASDDFITNDNTLIFSGTVDLGDSSTLVVNIEGTDY
FT                   TTDNGLVIDAQGNWSIDLTGTTLADGTYTVTATVTDVAGNTDSATQNVVIDTKIDQDED
FT                   GHTVAITSITQDTGSATDDFITNDNTLIFSGTVDLGDSSTLVVNIAGTDYTTANGLVID
FT                   AQSNWSIDLTGTTLADGTYTVTATVTDVAGNTDSVTQNVVIDTKIDQDEDGHTVAITSI
FT                   TQDTGSSDSDFITNDNTLIFSGTVDLGDSSTLVVNIAGTDYTTDNGLVIDAQGNWSIDL
FT                   TGTTLADGTYTVTATVTDVAGNTDSVTQNVVIDTKIDQDEDGHTVAITSITQDTGSATD
FT                   DFITNDNTLIFSGTVDLGDSSTLVVNIAGTDYTTANGLAIDAQGNWSIDLTGTTLADGT
FT                   YTVTATVTDVAGNTDSATQDVIIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGA
FT                   VINGSFDATDGDVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVA
FT                   GNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATDG
FT                   TVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDTQVMV
FT                   IDTTIDQDNDGVTVSIDSMTDDTGSSDTDFISNDTGAVVNGSFDATDGTVTVVVTDSTG
FT                   APVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTDTDTQVMVIDTTIDQDNDG
FT                   VTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATDGTVTVVVTDSTGAPVAGSVTVTG
FT                   NGWVFTPAAALAEGSYTIVATITDVAGNTDTDTQVMVIDTTIDQDNDGVTVSIDSMTDD
FT                   TGSSATDFISNDTGAVINGSFDATDGTVTVVVTDSTGAPVAGSVTVTGNGWVFTPAAAL
FT                   AEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSDSDFISN
FT                   DTGAVVNGSFDATDGTVTVVVTDSTGAPVAGSVTVTGNGWVFTPAAALAEGSYTIVATI
FT                   TDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSDSDFISNDTGAVINGSFD
FT                   ATDGTVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDT
FT                   QVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATDGDVTVVVT
FT                   DSTGAPVAGTVTVTGNGWVFTPATALAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQ
FT                   DNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPVAGSV
FT                   TVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDS
FT                   MTDDTGSSDSDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPVAGTVTVTGNGWVFTP
FT                   AAALAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSDSD
FT                   FISNDTGAVVNGSFDATDGTVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTI
FT                   VATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVIN
FT                   GSFDATDGDVTVVVTDSTGAPVAGTVTVTGNGWVFTPATALAEGSYTIVATITDVAGNT
FT                   ATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSDTDFISNDTGAVVNGSFDATDGTVT
FT                   VVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDTQVMVIDT
FT                   TIDQDNDGVTVSIDSMTDDTGSSDSDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPI
FT                   AGTVTVTGNSWVFTPAAALAEGNYTIVATITDIAGNTATDTQVMVIDTTIDQDNDGVTV
FT                   SIDSMTDDTGSSDSDFISNDTGAVINGSFDATDGTVTVIVTDSTGAPVAGTVTVTGNGW
FT                   VFTPAAALAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGS
FT                   SATDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPVAGSVTVTGNGWVFTPAAALAEG
FT                   SYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSDTDFISNDTG
FT                   AVVNGSFDATDGTVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDV
FT                   AGNTDTDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATD
FT                   GTVTVVVTDSTGAPVAGSVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDTQVM
FT                   VIDTTIDQDNDGVTVSIDSMTDDTGSSDSDFISNDTGAVINGSFDATDGTVTVVVTDST
FT                   GAPVAGSVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDND
FT                   GVTVSIDSMTDDTGSSDSDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPVAGTVTVT
FT                   GNGWVFTPAAALAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSITD
FT                   DTGSSDSDFISNDTGAVVNGSFDATDGTVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAA
FT                   LAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFIS
FT                   NDTGAVINGSFDATDGDVTVVVTDSTGAPVAGTVTVTGNGWVFTPATALAEGSYTIVAT
FT                   ITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSF
FT                   DATDGTVTVIVTDSTGAPVAGSVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATD
FT                   TQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATDGTVTVVV
FT                   TDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVAGNTATDIQVMVIDTTID
FT                   QDNDGVTVSIDSMTDDTGSSATDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPVAGT
FT                   VTVTGDGWVFTPAATLAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSID
FT                   SMTDDTGSSATDFISNDTGAVINGSFDATDGDVTVVVTDSTGAPVAGTVTVTGDGWVFT
FT                   PAATLAEGSYTIVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSDS
FT                   DFISNDTGAVINGSFDATDGTVTVVVTDSTGAPVAGTVTVTGDGWVFTPAAVLAEGSYT
FT                   IVATITDVAGNTATDTQVMVIDTTIDQDNDGVTVSIDSMTDDTGSSATDFISNDTGAVI
FT                   NGSFDATDGDVTVVVTDSTGAPVAGTVTVTGNGWVFTPAAALAEGSYTIVATITDVAGN
FT                   TATDTQVMVIDTTAPVANDDAANVKEDATLSVTAADGVLKNDTDLVSNTLNVTEIRTGT
FT                   EDGTGNIGTVGTSLTGTYGTLTLNADGSYSYTADQTAADALFEGQIVTETFTYTVTDGH
FT                   GNQDTAELVITITGTNDDVTITSTTNTRVSEEGLTDGLVDSIGDTDTTDSVTASGTISI
FT                   EDVDGDALTVALSGPSGLTSGGETVQWSWDADSQTLTGFIGTVGEDSYQAIMTVALNAP
FT                   ANNAPGDWSYAVTLLAPVDHSNTSFEDDLSLNFGVDVSDGNGGSTSGNFTVTIEDDSVA
FT                   FSTVNLVADNAIGIYNGSLVTNGADNNYSADLTGNINGWNGTTTTFADSGITAGGLIVF
FT                   YYVDPADPSILIAYSDTSATPSEYDPSNPDQSIIFTLTANPNDDSYQIDVAQSIDSTET
FT                   IAVANVDGGLGGNTYAAYISLGASGYVIDNDINDVPADNELAVTLTARDASGAITVNGN
FT                   SNSFGSGNAWVDSGETFVIDYANDVASAAVNFSGATTVYFKAFDAAGNLLGEGTLTSGE
FT                   TIGNMGSISYIELTTIDSDTGNRFQYNGTTAENIVSSTEDVQLDLAVTVTDSDGDSSSG
FT                   NLVIDLNAPDTTPPTGPTALQSSVLSTLSETDLLNNGTEQDLQTLSFKAGSDSLNAFQF
FT                   GDTGDISVDGINANIFWNLNSSGQLVGTVMGKEAITLTLNWNSIESGTTGDVTVTAELL
FT                   EDFPHNINLDSLSITGIEVIAVDGSGNTANSTVNVNVEDHNFAPEFLSGTDTDASQVNQ
FT                   DVYNFNSVNNNSGVGASVGTVIADDLDSIGDLQYSFADGSLVNGIFTIDADTGEITLNQ
FT                   AINSSSSSDYTFNVLVTDENNLTDTAVVNVNINTVDANDDRTGETYSASSSSDLGWAIP
FT                   EVNGQALFTITARDADGTAGNIYIESGSNKLGISGTPRTSGATAEQIEFNAETGQSEGL
FT                   VFNFNGLVNAATFNVSNMFHTEEGGEQGVWKAYYQGQLVAMETFKTVGSHSGEFTIDTG
FT                   NIVFDTLVFEATYTVDEESQSNPGGDSSDYFLTSISVSGPALDGDALVVHEGGVLTASS
FT                   IEDSLLSNDIDLDHDETGHNHEHADSFSITAVNGQAIPADNIIMLDSGAKLTIYADGTY
FT                   SYDTNGAFTSLNAGELDTDTFTYTITDEFGATDTATVTINIIGSNAQPVAADSQINGIE
FT                   DTALILQWSDFVITDSDSSTAELAISITQVPNSQNGTLEYFNGNSWVAVTAQVLLTAAM
FT                   FDANQVRFTPANNQADGGDTATGIGNQGAALAQFDFVVTDGSSTSDSATITINIDARAD
FT                   EPTLLASSGSVEWVNKVVSNQLPTGEIVTGQDVLGNVIENIVTGSHGTDQNDLIVGEAD
FT                   LVSMLTGGEGDDVLVGGNLGDSLHGDAGNDVFIGGGQNDSIYGGSGIDTAVYSGNFAEY
FT                   TITNHFDHSTTPYLLINDSLNRDASSVNTADLDAGDHLYEVERLIFADGVYVVNPDGTL
FT                   TQVQTQELPLDIEASLTDIDTSETLSNITIDNVPEGVYLSAGSYLGNGSWTLTSQELIN
FT                   LKMMVEEGYSGDSEFALNISVTSTESSNGDFVTSTVTLDITLRDYINQTGTSGDNNITG
FT                   TDNHEVVVSDVQGIQIIAGEDYNIAFIFDTSGSMEGSITEAKNQLDMVFEQLTQSISGN
FT                   HSGVVNILLTDFASKSNFSVSVNLADPNALATLKSAVSGIIDDDRGMTNYEAGFESAMD
FT                   WFNSANIAGNGATNLTYFITDGKPNRSTKDEDPDSFAVGYDTALNEYIILGDLLDSSFK
FT                   EGDIIQYNGQTIVNQDGTVFAYETSTEIGALKFNNDGSVKSFSDKDTDDKDQALHAFNL
FT                   LASISNVETIGIGGTLSEADLALYDSDGTVRAKIDVDKLASVILGSETVLLQGNDTVDG
FT                   ASGNDIIFGDLVKFANISGQGYAALQKFVASETQTNPSDVSVQDVHEFVTSNPSLFDTS
FT                   RTQDGNDLLKGGDGSDILFGQGGNDELHGGAGNDQLFGGNGDDSLIPGLGDDILTGGQG
FT                   EDTFVWNQGDTGNDHITDFKIADDKLDLSDLLQGVSAEELASHLEFSFDANSTTIAIDA
FT                   DKDGDVDQYITLDGVDLRDEFGLSNGEPDFEGSIIQGLLGSNGEGALIIDSTASTSSSS
FT                   QTRFANASEPSQQHEELSNFHDIP"
FT   gene            complement(700778..701494)
FT                   /locus_tag="Swoo_0492"
FT   CDS             complement(700778..701494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0492"
FT                   /product="protein of unknown function DUF542 ScdA domain
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF542 ScdA domain
FT                   protein; Hemerythrin HHE cation binding domain protein;
FT                   KEGG: sse:Ssed_4124 protein of unknown function DUF542,
FT                   ScdA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84790"
FT                   /db_xref="GOA:B1KQD5"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD5"
FT                   /protein_id="ACA84790.1"
FT                   /translation="MSLTTQSDVSLSEQGVGQLVAKDFRYAHIFSQFGIDFCCGGGRSL
FT                   ANACNKANIELSDVMSELKKLERTGQKEDALNQLPVAELIDYIEAKHHSYVREKSPLLV
FT                   EYSQKMVRAHGEHYAEIKPLAGWIRALVDDLTPHLMKEEQILFPAIRAMGSGETVNACF
FT                   GHIGNPINAMQHEHDDAARILEKLHELTNDFQPPEHACTTWRVCYATLAEFEADLKQHI
FT                   HLENNILFPKALALAN"
FT   gene            complement(701600..702730)
FT                   /locus_tag="Swoo_0493"
FT   CDS             complement(701600..702730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0493"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; KEGG: sfr:Sfri_0451 Kelch repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84791"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD6"
FT                   /protein_id="ACA84791.1"
FT                   /translation="MNKLNAVLLLLFPLLLSHFQVSANSPAVHYPNLPEPVANNAVALA
FT                   TSDGEDYLFSFMGLNSEKDHQGVHNRAWRLKLNEPKAQWQAITNVPHIEQLPGRLASMA
FT                   VGIKDKVYIFGGYTVSKDHQEVSTSDNYLYSLKNNSYSRISDMPVAVDDTAALSYQDRY
FT                   IYLFGGWHQHGNVNLVQVYDTQTNIWSQATPIPAPAVFGQAVAAVGQELVLCDGVTVQA
FT                   RENQARTFTASPICLYGKIKADNHLKIDWQALPHYSLDSSFQETSKAKPLVAHYRMAAT
FT                   GDSKNQQLIFMAGSDNPYNYNGIGYNSQPSEPSNKLYRFDLKSHSWLPTIEAEQKSMDH
FT                   RGLILYQGELLRVGGMLEKQLVSDRVLITPINDLAQ"
FT   sig_peptide     complement(702659..702730)
FT                   /locus_tag="Swoo_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 24"
FT   gene            702949..703224
FT                   /locus_tag="Swoo_0494"
FT   CDS             702949..703224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0494"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: spe:Spro_4310 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84792"
FT                   /db_xref="GOA:B1KQD7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD7"
FT                   /protein_id="ACA84792.1"
FT                   /translation="MLNLYTAFDVQMELRDFISQSRKLNKLSVEELSTRSGVPYGTIRK
FT                   FETTGNISLRQFLMLYEAVGNLSKVRTLTKTDNEQPTSIEEVLKNA"
FT   gene            703217..704452
FT                   /locus_tag="Swoo_0495"
FT   CDS             703217..704452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0495"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: spe:Spro_4311 HipA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84793"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR012894"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD8"
FT                   /protein_id="ACA84793.1"
FT                   /translation="MLETPLRVNRTFSDGSKAHIGTLAENRAGTYFQFDENYLAQHPTS
FT                   IAPFNIKADLTLQKAPKQPHYGIHGVFGDSLPDGWGLHLMDRVFRQNGYNPQLITALER
FT                   LAYIGDQCLGALSYEPEMHLLEADSRDVELVTLGQEAVKEFEGTESKLIEQLMNAAGSG
FT                   GARPKLNVTKTSDGQFSTHANATGEKLIVKLTSEKFDLKHSESLVEYAYMQMASNLGIE
FT                   TPKFELIEASAGRMWLQQTRFDCTPQGKRHMISACGLLDAPFREPSLDYVDLVKATRML
FT                   CGVGEARKLVKRALFNFITVNQDDHAKNFAFLADDNDQWRLSPFYDIVYSPSPYKQHMT
FT                   SFNGNGSSPKQALNILAGQAGYSSDKPLREMLEEIYQQSRSFTQEAKNLGIPNQLLTSI
FT                   DNQMTEKWNSLR"
FT   gene            704693..705004
FT                   /locus_tag="Swoo_0496"
FT   CDS             704693..705004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0496"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   spl:Spea_3847 helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84794"
FT                   /db_xref="GOA:B1KQD9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQD9"
FT                   /protein_id="ACA84794.1"
FT                   /translation="MKVTNSKQLSAYLKDARLNMKLSQSKVGNKVGIRQDTVSSFEQNP
FT                   DSTKLETLFKILSALNLELDIKVRNPELAHSNVKDKPLDDHQAQATATAQNQEWKEEW"
FT   gene            705004..706320
FT                   /locus_tag="Swoo_0497"
FT   CDS             705004..706320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0497"
FT                   /product="HipA N-terminal domain protein"
FT                   /note="TIGRFAM: HipA N-terminal domain protein; PFAM: HipA
FT                   domain protein; KEGG: spl:Spea_3846 HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84795"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR012894"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE0"
FT                   /protein_id="ACA84795.1"
FT                   /translation="MAVLDIYMNGYLVGELTKSTTGSHLFEYAPQWLDTQGSRPISLSM
FT                   PLRKQVYKGDEVYNFFDNLLPDNIEVRNRIVARHNAQSTQAFDLLSKVGQDSVGALQLV
FT                   PHGQAPFEVKKIEAKPLSDEALEKVLKGYQSDIPLGMLNDEDDFRISIAGAQEKTALLN
FT                   LDGQWKLPIKATPTTHIIKLPIGDIQSHSYRIDMSDSVENEFLCMMIVREFGLAVPHCS
FT                   IIKVGDIKALAVDRFDRKLSSDGQWIMRLPQEDFCQTLNVPPAKKYENHGGPGIEQIMP
FT                   YLVGSTNADQDRLDFMKSQVLFWLLAATDGHAKNFSLFIDAGGGYRLTPFYDIISMYPV
FT                   IGGKGLNIRDAKLAMGLKASKGKKYSIAQIFPRHFIQTAKAVGFDTEVMAAILIEIEDR
FT                   VDEVIDKVKAQLPEDFPSHIRDSILDGLKERSQRLKDFE"
FT   gene            706378..706704
FT                   /pseudo
FT                   /locus_tag="Swoo_0498"
FT                   /note="transposase, truncation"
FT   gene            complement(706778..709369)
FT                   /locus_tag="Swoo_0499"
FT   CDS             complement(706778..709369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sec:SC171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84796"
FT                   /db_xref="InterPro:IPR007505"
FT                   /db_xref="InterPro:IPR018633"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE1"
FT                   /protein_id="ACA84796.1"
FT                   /translation="MKAKFEVKYLDITWYDKNTVVSVTESFIPLKLEFEDTLKHFTCHT
FT                   VIYPKTDGVKHGQLAFRALTKSSTAPYFERADGQRIPLKKVLDKDTGKTWWVEADVWLK
FT                   DNKRWAGKSHRTAGNIKAYLSGQICQIVIGSSEFTAEQLNRYLSDFKSDLWELILDENS
FT                   YVTGKAKKVQEGGISEESIQLVNNILSHAQNILKKPKSELREIQTLKPRKLVRPVNRTF
FT                   MELATKGERKFLTSRATEPSYNVPENRYVLFALQRIHKILKQLVTISKSKVNRLENTVT
FT                   KLNERLEAFSDVKQIDEELVLKDLKRMQSLSNAVDITNGLHKQLESINNNKPRQSTTYL
FT                   WYLKLSKKTEDGSFFAGVKTNPNAPWFEYESVKETVILKFGNGSENYSPLFEPYFEYEV
FT                   QANLANFSGISQRDTPYHTYTLLDLTSIKVIGGVGLQKRHDKYLAAKQQVDLIRNSGWR
FT                   KQLTSQEKLEQDREKRSVQNQLETYSNQHLSVKLVYEQLEPKLHKFKVLLNQIEKLGVK
FT                   PSSTFPNSMTFVQNIDYQAVHSGYKRIREQTNLTDEDLLLSLEKVEDIGLINMPLLYER
FT                   WCLLQMIKVLVQNYHYQPTDDWKRRLLKIISTGRHSESMGFSNEVLKRDLKLRYEPVLA
FT                   NGRTPDFVMDVNFERKNGERFTKRFVMDAKFYSNGILKNNGGISSVVKHLYHEKNYSEN
FT                   GANAVFVLHPAKAAIEEKVSPQLWGQDSYLGELAMFDWDSSSRQLYHQYGAICANPILR
FT                   LRYLDEFQRMIGMFLQYGIEENSLGGRPDDVESMNFCIACGSHQLTRKDTNTGNQRSAW
FT                   YECDECKHFTVYNHCYSCNTRLIKNGDYWSYHSQMPMEPLNIKCPACESLL"
FT   gene            complement(709372..711510)
FT                   /locus_tag="Swoo_0500"
FT   CDS             complement(709372..711510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sec:SC170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84797"
FT                   /db_xref="GOA:B1KQE2"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE2"
FT                   /protein_id="ACA84797.1"
FT                   /translation="MSNTDIIYSFDVVKDLPDAELYQRLFDSWGITNGKIEVWGELRKN
FT                   PFNDWVSLYDIKTVDGNRIISYPVSAHKGIDKGVFINQEVAKRLLGNDDTAWVRCELEL
FT                   SPPTERTKKSNPFDVSVKRGSAARLASLPLSNDDIIQGDVSNYIPELIYNFYIKNLTTE
FT                   IAESKSAIESELKSLEFDKIAKESALEQLDQTYAKVSEESSQLSTLVTTKNEELKALKA
FT                   QYEEMQLEMAMKIEKLKSYISEKAVFLKSFEFIDEDDFDSFIFEVTKSRGTEDMVSFSG
FT                   ILDGDYKQAVSYIQAYLKEQDILYPRHIIENYLTLIRSNDLIILAGDSGSGKTSLVQSF
FT                   AKAVGGKSKIIPVKPNWTSSEDLLGYYNPLEKKYLATPFLEALIEAQQNPDIPYFICLD
FT                   EMNLARVEYYFADFLSKLEDRDGTPEIQLYSDNESAHVLSELKAVVSIISGAKEKYSQD
FT                   GLVDFVKLMQDEAVNTEMKRAFGFSDKDSLIKYHGDIRRMLAGIISTPSAIKIPANVRI
FT                   IGAINIDETTHYLSPKILDRAHIMKFKSPLLTDWDEIFAEIDTYDFDDVSKPLFMEVEE
FT                   LGDRTPYPSFKRDDEFCQLFVELNKEFFSPLDVEFGMRTIRQGLNYLGLFTELNSSHEQ
FT                   AINNFIIHKVLPKFTFDGNKQSGNFNKLDLLEKVLLPKLEELITEHESISSEFSCVEGL
FT                   RSIIENAKSNDGVVNYWA"
FT   gene            complement(711514..713352)
FT                   /locus_tag="Swoo_0501"
FT   CDS             complement(711514..713352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0501"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: ecs:ECs5306 type I
FT                   restriction-modification enzyme S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84798"
FT                   /db_xref="GOA:B1KQE3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE3"
FT                   /protein_id="ACA84798.1"
FT                   /translation="MAEHALNKAVELTTELTAEQLITENLDIWTTAIEQKSASGRGSSK
FT                   KFSLHGIKKLRELILELAVRGKLVPQASREARNSASYEPASILLERIASEKAQLVKDKK
FT                   IKKPKALPVISEDEKPFELPKGWEWTRLQDIGHDLGQKTPDCEFTYIDVGAINKELGFV
FT                   EEPSILKASDAPSRARKLVKRNTVIYSTVRPYLLNIAVIGNDLSPEPIASTAFAIIHPL
FT                   LGMNSSYIYRYLRSPCFINYVESVQTGIAYPAINDKQFFNGIIAIPPTEEQHRIVAKVD
FT                   ELMILCDALEAQTEASKSAHQTLVEILLGALLLPSADANSPEPVESPELYFIESWQRVA
FT                   EHFDTLFTTSASIDTLKQTILQLAVMGKLVPQDTNDEPAAKLLERIAAEKAQLIADKKI
FT                   KKQKPLPAITDEEKPFELPNGWEWARFVDIAYLITDGAHHTPKYIEHGIPFLSVKDMSD
FT                   GKLNFGDTRFISEEQHKDLIKRCNPQKGDLLLTKIGTTGVPVLINTDKEFSIFVSVALI
FT                   KFSTNEIDGNFLSLLVKSPLVKKQSQEGTQGVGNKNLVLKTISNFPLLFPPLNEQHRIV
FT                   AKVDELMALCDQLKARLSDAQTIQLHLTDAIVEQAI"
FT   gene            complement(713352..714833)
FT                   /locus_tag="Swoo_0502"
FT   CDS             complement(713352..714833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0502"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: putative RNA methylase; N-6 DNA methylase;
FT                   KEGG: sbm:Shew185_1977 N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84799"
FT                   /db_xref="GOA:B1KQE4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE4"
FT                   /protein_id="ACA84799.1"
FT                   /translation="MSISSAIKSIQDIMRKDAGVDGDAQRLGQMSWLLFLKVFDAQEEE
FT                   LELELDDYREPIPEQFLWRNWAADNQGITGEELLDFVNDELFPQLKNLTAPIDKNPRGY
FT                   VVKEAFSDAFNYMKNGTLLRQVINKLNEIDFTDSKERHLFGDLYEQILKDLQSAGNAGE
FT                   FYTPRAITKFIVAVTDPKLGESIMDPACGTGGFLACAFDHVKTNYVKSGEDHKTLQQQI
FT                   FGVEKKQLPHLLCTTNMMLHGIEVPVQIKHGNTLNKPLSSWDDQVDVIITNPPFGGTEE
FT                   DGIEKNFPSEMQTRETADLFLQLIIEVLATKGRAAVVLPDGTLFGEGVKTKIKKLLTEE
FT                   CNLHTIVRLPNGVFNPYTGIKTNILFFNKGQPTKDVWFYEHPYPAGVKNYNKTKPMKFE
FT                   EFATELSWWGVETDGFASRVENEQAWKVSIDDIIARNYNLDIKNPHVGDVVSHDPQELL
FT                   QDYAKQQADIQSLREQLKDILSAALSPKDSAGEVR"
FT   gene            complement(714927..717401)
FT                   /locus_tag="Swoo_0503"
FT   CDS             complement(714927..717401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0503"
FT                   /product="EcoEI R domain protein"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   protein of unknown function DUF450; DEAD/DEAH box helicase
FT                   domain protein; EcoEI R domain protein; SMART: DEAD-like
FT                   helicases; KEGG: sdn:Sden_1234 type III restriction enzyme,
FT                   res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84800"
FT                   /db_xref="GOA:B1KQE5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE5"
FT                   /protein_id="ACA84800.1"
FT                   /translation="MSINKAKLTETDIITKFIMPAIKDAGWNDMTQIRQEVKLRDGKVI
FT                   VRGQLGVRKTVKSADIVLYHKPSMPLAVIEAKANKHEVGKGMQQGLDYARLLEVPFIFA
FT                   SNGDGFIFHDKTHAVTNSQGTSEAHYLESEIRLEDFPSPQELWAKYCAWKGYTEKQLPI
FT                   INQEYYDDGSGKHPRYYQLQAINKTVEAISSGKDRVLLVMATGTGKTYTAFQIIWRLWK
FT                   SRAKKRILFLADRNILVDQTRINDFQPFGQSMTKITGRTVDPSYEIHLALYQALTGPEE
FT                   SQKAFKQVDPDFFDLIIIDECHRGSASEDSAWREILEYFKSAAQVGLTATPKETTEVSN
FT                   SDYFGDPAYTYSLKEGIEDGFLAPYKVVRVDIDVDLQGWRPTKGQIDNQGEVIEDRIYN
FT                   QKDFDRTMVIDERTQLVAETITNYLKRTDPMAKTIVFCNDIDHAERMRRAIANLNPEQM
FT                   AKNDKYVMKITGDDELGKAQLDNFINPKKPYPVIATTSELMTTGVDAKTCKLVVLDQNI
FT                   QSMTKFKQIIGRGTRIDDRYGKLWFTILDFKKATELFADERFDGTPEKVLVVTPTDIED
FT                   DDTDIDGTDSIDDPSDEDNPFDDGELGGDSSNNQPDGNGDGAQTGEGEWTDDETRKVAK
FT                   YRVSGVSVSKVAERVQYYDSDGKLVTESFKDYTRKTMAKQFSSLDEFVKRWNDSDRKQA
FT                   IIDELAQEGIIWAALEEEVGKDMDPFDMICHAVYDQPPLTRKERANNVKKRNYFTKYSD
FT                   TAQAVLQNLLLKYADVGVQEIESMQVLKVQPFNEIGSLSEIVKKGFGGKKEYEQAISEL
FT                   EAEIYQLHQQSA"
FT   gene            complement(717615..717920)
FT                   /locus_tag="Swoo_0504"
FT   CDS             complement(717615..717920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0504"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: sse:Ssed_4119
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84801"
FT                   /db_xref="GOA:B1KQE6"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /protein_id="ACA84801.1"
FT                   /translation="MFDQTTNTETHQLTVGKIETANGTIKPQLLRDAVKRAVTNFFAQM
FT                   DGQEAEEVYEMVLSEVEAPLLDIIMQHTRGNQTRAANMLGINRGTLRKKLKKYGMN"
FT   gene            complement(717939..718907)
FT                   /locus_tag="Swoo_0505"
FT   CDS             complement(717939..718907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0505"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; dihydroorotate dehydrogenase;
FT                   KEGG: sse:Ssed_4118 putative TIM-barrel protein, nifR3
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84802"
FT                   /db_xref="GOA:B1KQE7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE7"
FT                   /protein_id="ACA84802.1"
FT                   /translation="MQIGPYQLKNQLIVAPMAGVTDQAFRNLCLRYGAAMAVSEMLSSN
FT                   PDVWDTDKSRQRMLHAGEDGIRSVQIAGADPELMANAAVVNVQQGAQIIDINMGCPAKK
FT                   VNRKLAGSALLQDPVQVKAILQAVVAAVDVPVTLKIRTGWAPEHRNGVQIAQIAEDCGI
FT                   AALAVHGRTRQCMYKGNAEYDTIKAIKKNVSIPVVANGDITTPQKAQFVLEHTGVDALM
FT                   IGRGAQGRPWIFREIQHYLETGNMLAPVEVDEKRQVMLEHLKNLYSLYGEYKGIRFARK
FT                   HVGWYLDQDEQRPFRAEFNRLETVEEQGSMVERYFDEIAQN"
FT   gene            complement(719057..719938)
FT                   /locus_tag="Swoo_0506"
FT   CDS             complement(719057..719938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0506"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: sse:Ssed_4117 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84803"
FT                   /db_xref="GOA:B1KQE8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="InterPro:IPR029063"
FT                   /protein_id="ACA84803.1"
FT                   /translation="MPWIQLKIDTDNQHADTLSDLLMEEGSLSITLEDGKDTPIFEPTL
FT                   GETPLWNHTVLTALFEADRDLSIVVDNLKLQPFLGADFSYKIEQVEDKDWEREWMDNFH
FT                   PIKFGERLWICPSWREIPDPEAVNIILDPGLAFGTGTHPTTALCLEWLDSLNFDNKEVI
FT                   DFGCGSGILAVAALKLGATKVTGIDIDYQAIDASKANAERNGVEDQLTLYLPEDQPENL
FT                   KADILVANILAGPLRELAPLIAEKVKPGGQLALSGLLQEQALEVAEFYTQWFDMDEPAH
FT                   KEEWSRLTGIRK"
FT   gene            720288..721013
FT                   /locus_tag="Swoo_0507"
FT   CDS             720288..721013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0507"
FT                   /product="fumarate reductase respiratory complex
FT                   transmembrane subunit"
FT                   /note="PFAM: fumarate reductase respiratory complex
FT                   transmembrane subunit; KEGG: sse:Ssed_4116 fumarate
FT                   reductase respiratory complex, transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84804"
FT                   /db_xref="GOA:B1KQE9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQE9"
FT                   /protein_id="ACA84804.1"
FT                   /translation="MTIKTLLPTSSFAGLTGNPWSAKADKIQSATGLLLGCFLLAHLHF
FT                   ESSILLGKDAFYQVVQILEGGMFSESGHGFPLVTKIFSVFILLVVILHAAVALRRFPAQ
FT                   LGQWRALRRHMNGINHKDSHAWFWQLVTGFILFFLAPVHIFTMITNPEIGPHLSAERVY
FT                   LDNAWLLYALLLPAVVIHAMIGLYRVAIKWGFTANRTGLRKVIKFMIIYLITIGVLSLV
FT                   SYLFIGAELTTPVQPYVPN"
FT   sig_peptide     720288..720353
FT                   /locus_tag="Swoo_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.546 at
FT                   residue 22"
FT   gene            721209..721922
FT                   /locus_tag="Swoo_0508"
FT   CDS             721209..721922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0508"
FT                   /product="fumarate reductase respiratory complex
FT                   transmembrane subunit"
FT                   /note="PFAM: fumarate reductase respiratory complex
FT                   transmembrane subunit; KEGG: sse:Ssed_4115 fumarate
FT                   reductase respiratory complex, transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84805"
FT                   /db_xref="GOA:B1KQF0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF0"
FT                   /protein_id="ACA84805.1"
FT                   /translation="MAITKINNKAGEASKLKSWSEGKNWSGKLDISQSVSGVILALFLW
FT                   THLVLVSSILLGGDAMTWVAGVMELNFLSPDGHGYPWVVSLIATGVAALALVHVVVAIT
FT                   KLPMNLRQQLALKKQMSVINHGDTKLWVWQALTGVAILFLLPVHLWLIGAAPETIGPAG
FT                   SADRIWNDGVWLLYLPLLVCVELHGAIGVYRVAIKWGAARDINTRARMKRVKTVISVVF
FT                   VLIGIASLLAFLPYA"
FT   gene            722081..724105
FT                   /locus_tag="Swoo_0509"
FT   CDS             722081..724105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0509"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: sse:Ssed_4114 succinate dehydrogenase;
FT                   TIGRFAM: succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84806"
FT                   /db_xref="GOA:B1KQF1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF1"
FT                   /protein_id="ACA84806.1"
FT                   /translation="MKLIYTDSLVVGAGLAGLRVAIASKERGLDTVVLSLIPAKRSHSA
FT                   AAQGGMQASLGNTIKGMGDDEDVHFQDTVKGSDWGCDQDVARMFAHCAPKAVRELTNWG
FT                   VPWTRVTKGPRQVVVNAEKVTIEEAEEAHGLINARDFGGTKKWRTCYTADGTGHSLLYA
FT                   VDNKAISLGIPVHERVEALSIIHDGKRCQGVVARCLITGELRAYIAKSTTIATGGYGRI
FT                   YEVSTNAIICEGIGQALALETGVAKLGNMEAVQFHPTAIVPVGILTTEGCRGDGGLLRD
FT                   KDGHRFMPDYEPEKKELASRDVVSRRMTEHMRKGKGVDSPYGPHLWLDITLLGRKHVET
FT                   NLREVKEICENFLGIDPAKDWIPVRPTQHYSMGGIRTDKTGQNPQLKGLFSVGEAACWD
FT                   MHGFNRLGGNSLAETVVGGMIIGKYVADFCQENSLEIDTGLAESFVEKLGSEIDELIDG
FT                   DGTESPFALRKEMERVMMDYVGIFRNGPELEKAVTELQALLKRSRNIGLKCKKRHANPE
FT                   LVEALRVKRMLKVALTVACGAAARTESRGAHAREDFPQRNDKDWLNRTLASWPDEHALS
FT                   PELSYEQLDVMKMELPPGYRGYGINNAIAHPDTEKREHEITEILSQLGDDADRHQRQHA
FT                   LMPFEVPESLMPKNERLCDTLDRPTPPVVGEESVGEQAL"
FT   gene            724102..724833
FT                   /locus_tag="Swoo_0510"
FT   CDS             724102..724833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0510"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   sse:Ssed_4113 succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84807"
FT                   /db_xref="GOA:B1KQF2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF2"
FT                   /protein_id="ACA84807.1"
FT                   /translation="MSQGRTLTFNIFRYDPQVSGDKPKMVKYQIEETPGMSVFIALNLL
FT                   REQQDSSLQFDFVCRAGICGSCAMVINGFPTLACRTLTSKYPQGEITLMPLPGFELIGD
FT                   LSVNTGKFMRELAERLKLWLHPDQDDVDVHRLEAPMAPEEAARLYELERCVECGVCVSA
FT                   CATKQMRETFVGAVGMMKLARFELDSRDTRSVEDFYHVIGNQDGVFGCMTLLGCQDNCP
FT                   KDLPHMQQIAYLRRKMAVALV"
FT   gene            724931..725836
FT                   /locus_tag="Swoo_0511"
FT   CDS             724931..725836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0511"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sse:Ssed_4112 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84808"
FT                   /db_xref="GOA:B1KQF3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF3"
FT                   /protein_id="ACA84808.1"
FT                   /translation="MQINDLKLFVRVADCGSITAAATELDISPASASAALKRLEKQLET
FT                   SLFIRSTRSLRLTDTGERYLIHCRKALADLTLGQQAIDDVKEKISGVVKLALPSDVGRN
FT                   VLLPWLDSFMDEYPELKLKVHIGDTLSDFYHDKIDMALRSGTPRDSSLVAFKICSASRV
FT                   LCASPDYIAKWGKVESIDQLADHNCLFFMLDERTHDQWSFTQQGRQFKVRVTGNRSCND
FT                   ADITRRWAVAGKGIVYKSSLDLGEDIAKGNLVPMLTDYQGEAADLYLVCPGREHVTPVM
FT                   LLLRDMLRQRCKQRLEESHG"
FT   gene            complement(725933..727198)
FT                   /locus_tag="Swoo_0512"
FT   CDS             complement(725933..727198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0512"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: sse:Ssed_4111 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84809"
FT                   /db_xref="GOA:B1KQF4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF4"
FT                   /protein_id="ACA84809.1"
FT                   /translation="MNLSELKDKSISDLVLLAQEMKVENTARARKQDIIFSILKAHAKS
FT                   GEDIFGGGVLEILQDGFGFLRSADASYLAGPDDIYVSPSQIRRFSMRTGDTIFGKIRPP
FT                   KEGERYFALLKVSEVNFDKPENSRSKILFENLTPLHAEERIRMERGNGSTEDITSRILD
FT                   LCSPIGKGQRGLIVAPPKAGKTLLLQNMAQSITYNNPDVVLMVLLIDERPEEVTEMQRM
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALHRPKRFFGAARNIEHGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   QELHLSRKAAEKRVFPAIDFNRSGTRREEKLTTPDELQKMWILRKILNPMDEVTGMEFL
FT                   IDKLAMTKTNDEFFTAMKRAKT"
FT   gene            complement(727434..727760)
FT                   /locus_tag="Swoo_0513"
FT   CDS             complement(727434..727760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0513"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: sse:Ssed_4110 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84810"
FT                   /db_xref="GOA:B1KQF5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF5"
FT                   /protein_id="ACA84810.1"
FT                   /translation="MSDKIVHLSDDSFENDVINSTLPVVVDFWAEWCGPCKMIAPILDD
FT                   VAEEYEGKVTIAKMNVDQNSVSPAKYGVRGIPTLLIFKNGELASTKVGALSKTQLKEFI
FT                   DAQL"
FT   gene            727936..729261
FT                   /locus_tag="Swoo_0514"
FT   CDS             727936..729261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0514"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   sse:Ssed_4109 DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84811"
FT                   /db_xref="GOA:B1KQF6"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="ACA84811.1"
FT                   /translation="MSETHLSNQKFADFSLNKEIKTALNESGFEFCTPIQALSLPILLQ
FT                   KKDIAGQAQTGTGKTLAFLVATFDHLLSTPVPEGRQLNQPRAMIMAPTRELAIQIAKDA
FT                   TLLAKHTGLKVGIVYGGESYDVQRKVLDKGVDILIGTTGRIIDYVRQGIINLSAIQAVV
FT                   LDEADRMFDLGFIKDIRFLFRRMPDAKSRLNMLFSATLSMKVQELAYDHMNEPEKVVIA
FT                   PNEKTSKNIKEEIFYPSMDEKMRLLLSLIEEDWPEKAIVFSNTKHSCENVWSWLEGDGH
FT                   RVGLLTGDVPQKKRIRILEQFTEGKLDILVATDVAARGLHISDVSHVYNYDLPDDCEDY
FT                   VHRIGRTGRAGKKGVSVSFACEEYALNLPAIEEYITHSIPVTNYDSEGLLDDIPAPIRV
FT                   HRKHNNRPQQGRNNSGRPQGRNGNRAGGRNGPRRHDQVRRHS"
FT   gene            729274..730209
FT                   /locus_tag="Swoo_0515"
FT   CDS             729274..730209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0515"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: sse:Ssed_4108
FT                   guanosine-5'-triphosphate,3'-diphosphate diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84812"
FT                   /db_xref="GOA:B1KQF7"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF7"
FT                   /protein_id="ACA84812.1"
FT                   /translation="MPTTPLYAAITLGSNSFNMLVAKTLGGRPEIIAKYKRKVRLAEGI
FT                   QSDGSLSEEVMLRGLDCLSMFSDMLKKEGVSVDNIAVIATATLRHIANSDEFCRRALPI
FT                   LGHPIEIISGMREAELIYQGMVATTEGEGRRLVIDIGGASTEFIIGDGDKVLLKTSLPM
FT                   GCVTFNDKFFTSFPFQKLDFDDAKAAVKSALGDYLSELKHLGWHCVVGASGSVQSVVEL
FT                   LNYRQEPASITLDVLTSLQEEVLTQSSPSMLSISGLHQERAPTFAAGISILLALFELLE
FT                   IESLNLSGGALREGVLQTLAQRIEQVADSA"
FT   gene            730631..733360
FT                   /locus_tag="Swoo_0516"
FT   CDS             730631..733360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0516"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: slo:Shew_0341 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84813"
FT                   /db_xref="GOA:B1KQF8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF8"
FT                   /protein_id="ACA84813.1"
FT                   /translation="MKFNRLAKLVSLASSGIVALSAPSYAVESNEESVERIEVTGSRLK
FT                   RVDMEGASPVTTITAEELAKSGFATVGDALRSSNLNAFGSWGGGSNNGWGSQATVQLKG
FT                   ASAFHTLTLLDGKRMAKSPVMDGGAANINTIPMAAVERIEILTDGASAIYGTDAIAGVV
FT                   NIILKKDFEGVQLDARMDRPTQEGGDSSNLSFTGGLNSDKGHLVFTFEHYESQKILQKD
FT                   RWYTQPFVQEGGDPSDYQDWVNISPTGRVLTQGGAGGWVYSTPFSNSDKSCADVYGDAF
FT                   IGSLDDSDYPGDTLCAYDYTQAAATSVGQTRNNTLLHYTYELSDSIELTARAYWAANET
FT                   QDVSAPVPASISIPNGLPAYTTAEGLDLVELVADPNAGMNFRFDTAGDRVAEHHDNIFD
FT                   YLLALDGTTDFMDWDIAVNYNKYDNYTWGTGYQLKGATTDLVGEWDDESNSFVGWDPRD
FT                   PNSEMPAGATANYDKRMSASYLDISGGAAFELFELPGGDANMYIGGSYREESLDSKVSA
FT                   LAEAGQIVGGNGGSGGEGERDVMAAYFEFAMPVMDNLELNLAGRYDDYSDFGGTFNPQV
FT                   SVRYNIIEPLLIRASWGTGFRAPTLSDLYQGTSEGFGYMKNYLNCYDQGESIDNCDRWD
FT                   YGPTRTGGNVDLKPEESESYNLGIVWDITESVNVSVDYWSLETTNLIDSLGASEIIKTQ
FT                   AKLWEAADAAGVARPDVSTVYPGTEISRLGNGKIDYVVSQKLNVGLSEREGIDVKVGAG
FT                   FESEFGDFKFGLGWSYFLKYKSSYSEAGVQVISDDEAGREDTPAHRVNLTADYLLGDHS
FT                   ISYYGNFIGSQESWDVIEGSWDPDAGETADDGTLYEIDSVMYHNLTYTYTLPWSNSFSL
FT                   GVTNLTDEEPKFDYNGTYEGNLYDIRGRTYWAGFRQSF"
FT   sig_peptide     730631..730711
FT                   /locus_tag="Swoo_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(733428..733964)
FT                   /locus_tag="Swoo_0517"
FT   CDS             complement(733428..733964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84814"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQF9"
FT                   /protein_id="ACA84814.1"
FT                   /translation="MNNNVKALLATTALFFSCQTLASSGCAFEDQQDGMIATCSEEKQE
FT                   VILTGLVEAQTMVTELADFTQGYKEYQVDTAAITPLKNLKEPTEIVVIIGTWCPDCHRE
FT                   TPRLIRIMEEINNPNIKVTYIGVDRAKSDPQGLAAQYEFTRIPTIIVSQQGEELGRIIE
FT                   RPETSLEIDLAKILN"
FT   sig_peptide     complement(733896..733964)
FT                   /locus_tag="Swoo_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.682 at
FT                   residue 23"
FT   gene            complement(734238..735254)
FT                   /locus_tag="Swoo_0518"
FT   CDS             complement(734238..735254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0518"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   sse:Ssed_4105 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84815"
FT                   /db_xref="GOA:B1KQG0"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQG0"
FT                   /protein_id="ACA84815.1"
FT                   /translation="MNIITSAFPQRRMRRMRKHDFSRRLMAENQLSVNDLIYPMFVLEG
FT                   NNRTEQIASMPGIERYSIDLLLKEAEEIVKLGIPLIALFPVTPAEKKTLLAEEAYNADA
FT                   LAQRAVRALKEAFPELGVMTDVALDPFTTHGQDGIIDEDGYILNDITTEILVKQALSHA
FT                   EAGADIVAPSDMMDGRIGAIRQALEEAGHVNTQIMAYSAKYSSNYYGPFRDAVGSAGNL
FT                   KGGNKHSYQMDPANSDEALHEVALDIQEGADMVMVKPGMPYLDIVTRVKRELAVPTFAY
FT                   QVSGEYAMHMAAIENGWLSEKAIVMESLLCFKRAGANGVLTYFAKRAAQWLKEEQAK"
FT   gene            complement(735305..737200)
FT                   /locus_tag="Swoo_0519"
FT   CDS             complement(735305..737200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0519"
FT                   /product="periplasmic/7TM domain sensor diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor extracellular
FT                   region 2; Diverse 7TM receptor transmembrane region; KEGG:
FT                   sse:Ssed_4104 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84816"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQG1"
FT                   /protein_id="ACA84816.1"
FT                   /translation="MKQINLILVILTLLLSYPLKSETLLALSGDSDKSLRISPWLYYTF
FT                   ESESEGIEQIRKFSTTQWDRLSLGDNNHIALKPFWIKFSIYNAEPQTINRLLSLGNPHI
FT                   DKLDIYHFAQNVLVNHTQVGDTFPFHQRPVINNLFIYPFELAPEIVNTFYIRVDTEGSA
FT                   NLPLSLWSPNAFAQHTEASALSKGFQLGALAAIGFFSLCIAITSRSFSYSYYAGYVLSV
FT                   TLLVATLQGLAFRFIWPDWPMLQHLMITTLVPLSIFFAILFTEKVLLLKYHSLPMLRLC
FT                   RYSSAAALLLVFITPMLDYSQAQYINIFSVLLVTTLLMGIASILAIRGHKLARLYTLAW
FT                   SGMLIGSFITGSSYLGLITLPIKHLTPLMVGLTFEIIFMASILAIRYNDERKLKLQTQQ
FT                   EALLQSQRIRKTKEEALLIEANSNEKLEQMVQERTLELEIALRELNEANQKLTEQATTD
FT                   SLTGVKNRAAFDKRLQAEGRLSRRQQTPMAILMLDIDRFKSINDNYGHLAGDQILRFIA
FT                   QTLKEKLKRPADLVSRFGGEEFAIILPNTDQPGAVQVAEQIRKTIYDLPISWENIDIPL
FT                   TISIGVSSEIMQSETQPTKLLEQADKALYRAKNDGRNRVMVYTPEPQKEIDHTQS"
FT   sig_peptide     complement(737135..737200)
FT                   /locus_tag="Swoo_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.546 at
FT                   residue 22"
FT   gene            complement(737209..737997)
FT                   /locus_tag="Swoo_0520"
FT   CDS             complement(737209..737997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0520"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   sse:Ssed_4103 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84817"
FT                   /db_xref="GOA:B1KQG2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:B1KQG2"
FT                   /protein_id="ACA84817.1"
FT                   /translation="MSEHIDIAVNLIGSALEKNCDEVIQRAVAHGVSPLIVIGSDLNES
FT                   QQAITLCQQYPKTLYSTAGTHPHQASQWDDTSADKIRVLAQAAEVVAIGECGLDYNRDF
FT                   SPRAKQREAFRAQLALAVELKLPVLMHERDAHEDFLAILKEYRSGLTNALLHCFTGNRE
FT                   SMEAYLELDLHLGITGWVCDERRGLELAELVRDIPDDRILIETDSPYLLPRSMRPKPKS
FT                   SKNEPQYLPYIAQYIATLREQNPTEFAAKTYQNSVKFFGL"
FT   gene            complement(737997..738482)
FT                   /locus_tag="Swoo_0521"
FT   CDS             complement(737997..738482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84818"
FT                   /db_xref="InterPro:IPR016987"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR01"
FT                   /protein_id="ACA84818.1"
FT                   /translation="MRLRWITAVAILVSANATAGIEQQLSACAANTDKLDRLICYDALA
FT                   QKVKTKGPATPPVAGAATVAAVPVTLPANIEDEFGNLKKEKADAIEKIYLEVASIKKDP
FT                   YGALKLSFTNGQVWKQTDGRRFKVKVNQSVFIEKAALGSFILGSDDRNSTIRVKRLK"
FT   sig_peptide     complement(738423..738482)
FT                   /locus_tag="Swoo_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            complement(738539..739309)
FT                   /locus_tag="Swoo_0522"
FT   CDS             complement(738539..739309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0522"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: sse:Ssed_4101 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84819"
FT                   /db_xref="GOA:B1KR02"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR02"
FT                   /protein_id="ACA84819.1"
FT                   /translation="MSQQQPLISHLLELRTRLLRAIASVILVFACMAYWSNDIYHYVAT
FT                   PLMDVMPEASSMIATDVAAPFFAPFKLTLVLAFFIAIPYVLFQIWSFIAPGLYKHEKRL
FT                   MMPLLASSTLLFYLGIAFAYYVVFPVVFGFFTSVAPEGVQVATDITSYLSFILKLFFAF
FT                   GLAFEIPIAVVLLCWAGVTTPDDLKAKRPYIIVGAFVIGMLLTPPDIISQTMLAVPMLI
FT                   LFEGGLIAARFYSKKDEEDEDEQEKQDEPGQEAK"
FT   sig_peptide     complement(739208..739309)
FT                   /locus_tag="Swoo_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.481 at
FT                   residue 34"
FT   gene            complement(739313..739711)
FT                   /locus_tag="Swoo_0523"
FT   CDS             complement(739313..739711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0523"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: sse:Ssed_4100 twin-arginine
FT                   translocation protein, TatB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84820"
FT                   /db_xref="GOA:B1KR03"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="InterPro:IPR018448"
FT                   /protein_id="ACA84820.1"
FT                   /translation="MFDGIGFMELLLIGILGLVVLGPERLPVAVRSITGWIRAMKRMAN
FT                   SVKDELEQELKIEQLHSDLKKAENQGLKDLSPELQDSIDQLKEAAQSVNRPYKIEETPS
FT                   ASSSAPSESTPSEAPTAEVSANPDKSNR"
FT   gene            complement(739718..739969)
FT                   /locus_tag="Swoo_0524"
FT   CDS             complement(739718..739969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0524"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: slo:Shew_3376 twin-arginine
FT                   translocation protein, TatA/E family subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84821"
FT                   /db_xref="GOA:B1KR04"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /protein_id="ACA84821.1"
FT                   /translation="MGNMGIWQLLIIAVIVILLFGTKKLRSLGGDLGGAVKGFKNAMSS
FT                   EEEKKALEETASEKATPSVEKTAPNAEKKTETKDKEQV"
FT   gene            complement(740031..741680)
FT                   /locus_tag="Swoo_0525"
FT   CDS             complement(740031..741680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0525"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: sse:Ssed_4098
FT                   2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84822"
FT                   /db_xref="GOA:B1KR05"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /protein_id="ACA84822.1"
FT                   /translation="MTVTSIRRAYQVIKTALHYGLDELIPSKVKPWYFRLLRCTFFWLR
FT                   NQHKDKVGGERLKLVMQELGPVYIKFGQMLSTRRDLLDDEWAEELAMLQDRVPPFDSSI
FT                   AREMIELELGTSIDTYFDDFDNTPLASASISQVHTATLKSNGKAVVLKVLRPNVEAQVD
FT                   ADLHLMSQAANFLETVLGHGNRLRPAEVVEDYRTTIEGELNLKLEALNAVKLRNNFLDS
FT                   GSLYIPYMYEELCFTRLIVMERIEGIPVSDMAALKAQGTNLKVLAERGVELFFTQVFRD
FT                   NFFHADMHPGNIFVSREHPEDPYYIGLDCGIMGTLTEEDKRYLAENFLAFFNRDYHRIA
FT                   QLYIESGWVSPDTDIAAFEQAVKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQP
FT                   QLVLLEKTLLYIEGLGRQLYPQLDLWQTAKPFLEKWMSEQVGPKGMASKIKKEFPYWAD
FT                   KLPELPELVYDNLKMGRNFVKSQNQMLDRYLKQQQKAHKSNYLLITSAVLVICGTILFN
FT                   QNATLWASYGSITVGVVLWLLGWRSRPKKRKF"
FT   gene            complement(741677..742300)
FT                   /locus_tag="Swoo_0526"
FT   CDS             complement(741677..742300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0526"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   sse:Ssed_4097 protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84823"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR06"
FT                   /protein_id="ACA84823.1"
FT                   /translation="MKREFALLLSAALETALKQVIAQSPDEYAKLRSLHGKVLCIQLSQ
FT                   LSWPIYLIFAKEIQVLGKYEGEVTTKVNADITTLYQLTEGANLTELIKQDKLSLEGDLN
FT                   LLQTFSHFLQKVEFDFAEPLSKYIGDAPTHMLITGIEQAKNDITHIFRQSRSHVGQLTT
FT                   EEYKLAPHAIEFVYLGDRIDDLVADIDAIEKRINNLQSRAKTNT"
FT   gene            complement(742312..743067)
FT                   /locus_tag="Swoo_0527"
FT   CDS             complement(742312..743067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0527"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   sse:Ssed_4096 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84824"
FT                   /db_xref="GOA:B1KR07"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /protein_id="ACA84824.1"
FT                   /translation="MSEGTPNSTHFGYKTVESDQKADMVAGVFHSVAAKYDIMNDVMSF
FT                   GIHRMWKRFTIESAGARPGMKVLDLAGGTGDLTAKFSHIVGDKGQVTLADINDSMLKVG
FT                   REKLRDKGIVGNVNYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAAIRSMLRVLKPG
FT                   GKLLVLEFSKPKHDVMRKVYDLYSFKVMPKMGALITQDAESYEYLAESIRMHPDQETLK
FT                   GMMVDAGFEQVEYTNMTDGIVALHKGYKF"
FT   gene            complement(743351..744385)
FT                   /locus_tag="Swoo_0528"
FT   CDS             complement(743351..744385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0528"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   sse:Ssed_4095 arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84825"
FT                   /db_xref="GOA:B1KR08"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR08"
FT                   /protein_id="ACA84825.1"
FT                   /translation="MQYLLPFTSQHCRQLVTAREGETKLAQTVLTHDENAVLKETLAKA
FT                   KLKGARFAIFGIGEDIGPRANLGRGGATDAFEAAMAQFLNLQSNRFFDGKSCLVLGQIK
FT                   TDDLQLSEEAATQSLRANVEQLDTRVIEIAEQVMQAGLEPIVIGGGHNNAYGLLMAAKQ
FT                   SHNKKVAAVNLDPHSDFRPREGRHSGNGFSYAAASEALGYYHVLGMHELKNSEETLDQL
FT                   SSFGGGWHTLQSTWIRREVSLASALEEIVTKLNNSQLPVALELDLDAITNMPSSASTAA
FT                   GIPLLDALHYVYTVARHTPCAYLHLAEAAPSCHVAGLQAGYRETGQSISELIYAYIQGR
FT                   GQSQ"
FT   gene            744541..746445
FT                   /locus_tag="Swoo_0529"
FT   CDS             744541..746445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0529"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S15; peptidase S9 prolyl
FT                   oligopeptidase active site domain protein; KEGG:
FT                   sbl:Sbal_0143 peptidase S9, prolyl oligopeptidase active
FT                   site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84826"
FT                   /db_xref="GOA:B1KR09"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR09"
FT                   /protein_id="ACA84826.1"
FT                   /translation="MSRIFIALLLILSSAAVHAEQLPVEAFGLLPQSEQVKLSPDGDKL
FT                   SFIIHNQGNTYIGVKDFKADATKYVVSTDNQEFKIGWYRWANNELLLVSADYPVKQRGI
FT                   KYTETRLLKVHADGSGKLKTVMKPKKRELNPQFQNGIIDLLPDEPDYILMGLALKVANR
FT                   PDVYKINLNSERKRKLLQRSRSDIHSWLTDQQHRVRLGYGRDETKIFYRLYDLATDEWR
FT                   NIWEYEIFDAPDITPLGFGLNPSELYIRAIHNDRYAIFKVDVTDKKLTKTLVYADEHYD
FT                   IEGSLIYSRKTKDVIGVYHGEANNAKVYFDPAYERFQKSLNKAIPDAYNNIVSVSDDEN
FT                   MYVLYTSNPQTPGAYYLGDRKAKTLEFIIDEYPFLLQKNLSDKRKVSYQARDGLSIEAY
FT                   VTPPYEGVESKKAALVIPHGGPMVRNYGGFDWFSQFFASRGYTVIEPNFRGSSGYGFEF
FT                   EMASIQKWGGAMQDDLADAAKWLTKNYPVDKNKVCILGASYGGYAAMMAAVKQQDVFRC
FT                   AASFAGVSDLEYIVRKAKRFTNYKVVKKQIGDDSDMLEQKSPVNFAKEINIPLLLIHGD
FT                   KDRVVDVYHSREMFEELEDLGKVVEYIELENGNHYLEIEKNRLKTLNAFDKFLTQHLN"
FT   sig_peptide     744541..744600
FT                   /locus_tag="Swoo_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(746551..747036)
FT                   /locus_tag="Swoo_0530"
FT   CDS             complement(746551..747036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0530"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: sse:Ssed_4094
FT                   protein of unknown function 1935"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84827"
FT                   /db_xref="GOA:B1KR10"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR10"
FT                   /protein_id="ACA84827.1"
FT                   /translation="MEYNTSELCDTYIDVVDVVEPMFSNYGGCNSFGGSISTIKCFEDN
FT                   GLIIEALQNDGEGRVLLVDGGGSLRRALIDASIAQVAVDNNWEGIIVYGSVRDVDALED
FT                   LDIGIQAMASIPVGADSNSVGELEIPVNFGGVTFLPLDHVYADNTGIILSPEPLDID"
FT   gene            747362..747610
FT                   /locus_tag="Swoo_0531"
FT   CDS             747362..747610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84828"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR020137"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR11"
FT                   /protein_id="ACA84828.1"
FT                   /translation="MDTANTIEIIGYSASVMVAISLMMKDIIWLRCLNFTGCTLFVIYG
FT                   VYISAWPVAGMNAFVACINIYHLIKLYREKSQQSATA"
FT   gene            747719..748282
FT                   /locus_tag="Swoo_0532"
FT   CDS             747719..748282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0532"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   sbn:Sbal195_0435 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84829"
FT                   /db_xref="GOA:B1KR12"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR12"
FT                   /protein_id="ACA84829.1"
FT                   /translation="MFTKLVKLDRRLFNYLFAQSEARKLGVLARRLSRTGDGPLYLFLV
FT                   FIVMISHAKGEMLFYLALAGFTVELPLYLILKNTIKRTRPCHLELSSCDSGYSPLTDKH
FT                   LMALKRFEPSDKFSLPSGHTAGAFVMATSVAFIYPQWGYLVYLWALLVGGSRIALGVHY
FT                   PLDILAGAALGTGSVFAILSIGFD"
FT   gene            748307..749359
FT                   /locus_tag="Swoo_0533"
FT   CDS             748307..749359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84830"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR13"
FT                   /protein_id="ACA84830.1"
FT                   /translation="MKILYGVQGTGNGHLSRARVMAKSLCKHGVDVDFFFSGRSPEQFF
FT                   DMQCFGKYQVESGLTFATHHGRVNIAQTAWSNSVPSLINDIQSLDLSGYDLVLNDFEPV
FT                   SAWAAKRQGVTSIGVSHQVALKYDVPKVGANWFNETLLNYFAPVDIALGCHWHHFGFPI
FT                   LPPFVEVEPVVSVNPHDILVYLPFEDPDAIVNFLAPFKEFKFYVYHSGKPLLRTPEHIK
FT                   WSGFNRDEFKRRLSLCSGVIGCAGFELASEALTLGKRLLVKPLVGQFEQLSNVAALELL
FT                   GAADTMLTLDGKQLQRWLKSAPPQPILYPQVGDELVKWLLSDDWHTGDKLCCQLWDKVE
FT                   LPMSWRKKNP"
FT   gene            749788..749919
FT                   /pseudo
FT                   /locus_tag="Swoo_0534"
FT                   /note="transposase, truncation"
FT   gene            750129..751049
FT                   /locus_tag="Swoo_0535"
FT   CDS             750129..751049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_2681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84831"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR14"
FT                   /protein_id="ACA84831.1"
FT                   /translation="MKYVLKISSHLGIDLIESSEDELNEVKDAKSNILESVTLEEKLDL
FT                   ALTNYKEFEMFIASISIDYKMFKGGDWQGGMQKRRELARLFSNLLSSTRLYIDHLMHHV
FT                   SRIYGKESDNYKLIKEHVSQHYDESLSYRLLETIRNHVQHAGLPISFKSMSTWNVERTH
FT                   MVTIVTPTLMIEELRQNKRFKKSVLVEIESLTKSPDLKPHIRNYIGRLTQINGFVRELL
FT                   NSDYQRWSELVLNCIEKGERLHLKASGSIHTALYCESDNYEVLEKIELFRDFLELREYF
FT                   CQHNMVLDDFESRYVSTLPIDELRT"
FT   gene            751174..751755
FT                   /locus_tag="Swoo_0536"
FT   CDS             751174..751755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84832"
FT                   /db_xref="InterPro:IPR002746"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR15"
FT                   /protein_id="ACA84832.1"
FT                   /translation="MDGVIKLIISFLGGGVIAGLISWARIARSERENRKTEHIKAQVNN
FT                   LYGPLYFFTSQNVQLLELNRNLMSAYNDEYVDQNWALAPETQKSINEETSTTIDIANTY
FT                   VKNIIANNQKIVELLQNNSEYIDPEDNDVFHKVVIDNIRDMVEKEESGKLRTPFMVYKS
FT                   VGDIFFVRQEFNELVINKFLSKNNELKKYH"
FT   gene            752620..755790
FT                   /locus_tag="Swoo_0537"
FT   CDS             752620..755790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0537"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   metal-dependent phosphohydrolase HD region; KEGG:
FT                   spl:Spea_3667 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84833"
FT                   /db_xref="GOA:B1KR16"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR16"
FT                   /protein_id="ACA84833.1"
FT                   /translation="MFSVEGYEHKRVSIRFTVVSIFIFATVLTAVIAIGLQYYFSQSMA
FT                   TDSALKHYDLNADHTSKYLSQVDTQAVNITKLLSGSDLLIEAEHFNQKSLQTFAELMRI
FT                   NPLYFSINLALPNGDFYQLVNLNAYPTIRDQLLATPDDRWVLLLVTGVGDKRFRKVSYL
FT                   DDKFNERVNREELTDFDPRQRPWYIYAGRGRVSRTQPYLFDFSQLPGQTYSIALADSGS
FT                   DFEAVLAVDITLSTLSKYLNVIGRSTSGGFESEVYLYQPSGELIASNRQQSTQVELPKS
FT                   VPLGLTQEQYSFIESLPVLRVSNETDWPPIDFAISGEPLGYGVDVMQLIAQMTGLKFTY
FT                   VNGFSWQGLLSAFKTGKIELLQSIIKTENNSELGNFSEPFLTLPYTLASLEGAPKVSAL
FT                   TALKGERVAVSTGWSIIPFLQRHFPSIELVEYPSSYESLLAVKRGEVMGTLDIGVNLHY
FT                   TVQRFFIQGISFHDELSFSPQKVPDGLTILAKNKRLIEIINLALANITPEQKEALRLKW
FT                   IDRTSPQQPMKTMGVVPYQDLIEIGEQSELHQTLQKRLINGVEQFIYVTSFAQGLSMFA
FT                   IVVPSEAILATSTDKVLTSILITAVCMLMVLPISWLFSNPIIKPINLLCRENVKVKHRH
FT                   YDSISKVETHIKELDELADSMLEMASAIKAYEESQKALMEAIIRLIAQAIDDKSPYTAG
FT                   HCNRVPELGLMLATAAHKAQSGPFKAFSFKSEDEYREFRLAAWLHDCGKITTPEHIVDK
FT                   GTKLEVNYNRIHEIRMRFEVLWRDAEIKYLKLLAESPESEEALLAQLKAQHEQLKQDFE
FT                   FIANANIGGEFMEDADIERLIQLAEISWLRYFDDRLGLSPVEEGHLGEMPSSLPATEQL
FT                   LSDKAEHLISRISPVSFDPQFGINIQVPELQYNRGELYNLSISRGTLTAEDRYKINEHV
FT                   ITTIKMLESLPFPPELARVPRYASTHHETLIGTGYPRKLIGDELSVPERILVIADIFEA
FT                   LTAGDRPYKKAKPVSVAVDILHKMALEQHLDIELFKLFLSSGIYLEYANKFLDPSQIDE
FT                   VDISRYLD"
FT   gene            756103..759270
FT                   /locus_tag="Swoo_0538"
FT   CDS             756103..759270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0538"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; metal-dependent phosphohydrolase HD region; KEGG:
FT                   sse:Ssed_0651 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84834"
FT                   /db_xref="GOA:B1KR17"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR17"
FT                   /protein_id="ACA84834.1"
FT                   /translation="MFFAEGNERRRITIRFTVVSIFILATVLTSAIAISLQYYFSQSMA
FT                   TESALKHFDRDAKHMSKYLSQLDTEAANITKLLSGLDQLVEDDHFNRKALYTFAELMRS
FT                   NPIYFGVNVGLPNGDFYQLINLEAFPSSRVKSFSIPSDRWLFSFVTGTGDNRIRQFKYL
FT                   NDDLQERISRDEVTVYDPRVRPWFVNAQFGNVSRTQPYLFDSIQSPGKTYSIKLPDHSG
FT                   AVLGMDITLDTFSKYLSTVGQNISGGSANKVYVYKPSGDIIASNQEKSDQLKIPESTRL
FT                   ELPPNLRDFVDNLSELRVSNQTNWPPIDFAISGQPYGYVVDLMKLISQMTGLDFSYVNG
FT                   LNWKGLVDAYKTGKIEVLQSIIMKDENRHLGVFSEPFLSLSYSVVTLEKVQPITNILEL
FT                   KGHKVAVPVDWLFIEQIKQHFPDIEFVEYASTHECFQAVIREEVLATLDTGINLRYTAR
FT                   QFFIEELRFHDSLSFFPYIVPTELRILAKNKRLIETINLALANITPEQKDALKLKWIDS
FT                   SSLGQPTKTMGVVPYKALIDIGSDSKKHNKLHKLMLNGIEQFVYVTEFASGHSMLGIVV
FT                   PSNIILAPSRHKVLTSIFITAVCMLTFLPVAWIFSNPIIKPINLLCRENVKIKHRDYDS
FT                   VIKVGTCIKELDELSDSMLEMAEAHKEYEESQKALIEAIIRLIAQAVDDKSPYTAGHCN
FT                   RVPELGLMLADAAHKAQSGPFATFSFKNEDEHREFRIAAWLHDCGKITTPEHIVDKGTK
FT                   LEANYNRIHEIRMRFEVLWRDAEIVYLTLLAQSPANESVLREQLNEKHEQFRQDFEFIA
FT                   NANIGGEFMSQEDKDRLGLLANVTWERHFDDRLGLSPFEELRFNEVKTGASYPVIEKLL
FT                   GDKPEHIFKRLNKVEFDPKFGIKMEIPEHQYNLGELYNLSVSRGTLTAEDRYKINEHII
FT                   STIKMLDSLPFPPELARVPRYASTHHETLIGTGYPRKLTGEELSIPERVLVIADIFEAL
FT                   TAADRPYKKAKPVSVAVDILHKMALDEHLDIELFKLFLSSGIYLEYANKFLDPSQIDEV
FT                   DISRYLD"
FT   sig_peptide     756103..756240
FT                   /locus_tag="Swoo_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.819) with cleavage site probability 0.387 at
FT                   residue 46"
FT   gene            759489..762710
FT                   /locus_tag="Swoo_0539"
FT   CDS             759489..762710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0539"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   sse:Ssed_0651 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84835"
FT                   /db_xref="GOA:B1KR18"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR18"
FT                   /protein_id="ACA84835.1"
FT                   /translation="MGVETKVSNKRFTIRFTVVGIFILATIVTASIAIGLQYYFSNTMA
FT                   TESAVKLYNLTAKNTSSYLTQVDNRATNTTQLLSNFDDLVTDGAFNPEAQQAFAEVMRT
FT                   NSLFYAIYIGMPNGDFYELINLDAHPIIRSQLNASHLDRWVIITISGEGELRQRDQSYL
FT                   DEQFNLRVTHSEHSEYDASVRPWFVGANTESVSKTEPYLFQHLQSPGQTYSIKLAESGA
FT                   VLALDIALSTLSDFLVMQGEDEREAGIHEKIYLYKESGELIASNQIQKRGVEIPESREL
FT                   KLSSKQRDLVAATQPLLVSNETDWAPIDFAISGMPQGYSIDLLNLISEMTGLRLRYING
FT                   FSWSELTQNYKAHELDMLHSVLKTDETRLLGEFSAPFLELPFALVTLPGIAPITHIEQL
FT                   NGKQLAIPVGWSIIEVIRKNYPQIEIIEMASTYAILHAVEEGEVFAALDSSIILHYTAN
FT                   QFFVEAIQYHEQLDFSPVEVDTGLHIVMPAQEQAVMEVINLALANITPEQTLALRAKWF
FT                   GEGDKKTLSTQGTVPFEALIELAASPNEQKRLIQRELNGVEEFIYVTPIGGRSSGEKEY
FT                   LAIVVPKQQLLAASIEKVLQSIFFTSICLLLILPVSWLFSSPIIRPIKLLAIENEKIKN
FT                   RQYDEVRNVDSNISELDELATSMMDMSVSIKQHEDNQKALMESFIKLIAQAIDDKSPYT
FT                   AGHCNRVPELGLMLVEAAQISELAPFKDFKFNSEDEHREFRIAAWLHDCGKITTPEYIV
FT                   DKGTKLEAVYNRIHEVRMRFEVLWRDAEIEYLKRVSSEVSSCENGPNELLLAELAHKRE
FT                   QLIEDFEFIANANVGGEFMGQEAKDRLAQLANITWERHFDDRLGLSPVEELNLSTQEGE
FT                   ISYPVTESLLSDRAEHIIKRVNKVEFDPKFGIKMAIPEHQYNLGELYNLSISRGTLTAE
FT                   DRFKINEHVTSTIKMLENLPFPPELARVPRYASTHHETLKGTGYPRKLSADDLSIPERI
FT                   LVVADIFEALTAADRPYKKAKPLSVAIDILHKMALDEHLDMDIFRLFLSSGIYLDYAHK
FT                   FLDVKQINEVDVAKYLNQEPMKKSA"
FT   sig_peptide     759489..759581
FT                   /locus_tag="Swoo_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.296 at
FT                   residue 31"
FT   gene            762774..764273
FT                   /locus_tag="Swoo_0540"
FT   CDS             762774..764273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0540"
FT                   /product="di-haem cytochrome c peroxidase"
FT                   /note="KEGG: noc:Noc_0114 di-haem cytochrome c peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84836"
FT                   /db_xref="GOA:B1KR19"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR19"
FT                   /protein_id="ACA84836.1"
FT                   /translation="MRSKSLLLVLSTSLLLSACSDSDSQDETALEQEVVTKELRGEIRL
FT                   ASLSGDPSLNRSVPEASSPLAVLGMQLFYSQALSGDMDTACVSCHHPKLGGGDNLALSI
FT                   GVEAADPLLLGPGREHSSAGHDYDGGPTVPRNAPTTFNIALWDRAIFHDGRLESIEGTE
FT                   NMNGEGTNMVSPDSPDRATPDESAANLTVMQAMFPVTSSEEMKGHHFQEYDNQEIRQYL
FT                   VERLRGETGELVTNEWLAAFQLGLQDPDGTAESLITQTNIFTAIGEFERSQVFVNSPWK
FT                   SFVQGDDDAISLNSKKGALIFFKPQEQGGANCASCHKGDFFTDEEYHNIAMVQVGRGKG
FT                   DGESGSNDFGRFKVTQLERDKFAFRTPSLLNITQMGPYGHAGSYHSLEAVVRHHLDVND
FT                   AINNYDADANIEQQGVQTQNMMSNTLAALNKLNAERNAGTEGVLQDRALSDEEFDQLIS
FT                   FLHTLTDSCIADADNTQCLAPWIPGDDIADPDGLRLEAVIR"
FT   sig_peptide     762774..762842
FT                   /locus_tag="Swoo_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.550 at
FT                   residue 23"
FT   gene            764513..765679
FT                   /locus_tag="Swoo_0541"
FT   CDS             764513..765679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84837"
FT                   /db_xref="GOA:B1KR20"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR20"
FT                   /protein_id="ACA84837.1"
FT                   /translation="MKRILLLTLFAFSNAAIAVEPLFETPKDMEPTWVDDILSVFGADG
FT                   EFDESKAIDMSYLPTAYYTPEKKFGVGLLMVGLYKTDGASAQEQPSSLVLNSFVSMNNS
FT                   YGVEVENMTFFNGGKQRLLLELELHNEASVYYGQGIEQGHLDSNHHEFEEQLYSFKPRW
FT                   MTEVADNYFVGVGANFVYASADKFQLAETEVPVDSSTILPDNVSSGVVVTSIYDSRDYR
FT                   LNATKGWLFQIDAGLYQNSEYASFSTYDLELANYIDLSSTSILSSAPGLIAWQLQGHFT
FT                   DGDVPWNMLPDLGGSNAMRGYIKGRYRDEQMMMGQVEYRLPIFQRYGMVFWGAAGSVAP
FT                   KIGDLTDELLTSYGTGFRFKIKDNINLRLDVGVGENETNFYLNVNEVF"
FT   sig_peptide     764513..764569
FT                   /locus_tag="Swoo_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            765682..766443
FT                   /locus_tag="Swoo_0542"
FT   CDS             765682..766443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84838"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR21"
FT                   /protein_id="ACA84838.1"
FT                   /translation="MRHAIGATTPLMSILILTSALVGVSNRAFASDELAKPLDLPLASC
FT                   NRISHYAIYLSGIHTGTMSRTETWQGKTAVVSSESKASILGIGTQYQQRAELSWSDSTH
FT                   EWLTDNFHQKVTGFRSRDMRASFKEAGLESRVDIDGEIDTYSSKTIPIRDVDTLAIQIR
FT                   EYLLQGRKQFALIRQASDAIEPYQLYVQELQSENIAPWGELSLIPVEQTGAEDVTYYFA
FT                   PALDYQLVKARYHGFILHGLIELDSYTSTCE"
FT   sig_peptide     765682..765774
FT                   /locus_tag="Swoo_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 31"
FT   gene            767062..768462
FT                   /locus_tag="Swoo_0543"
FT   CDS             767062..768462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0543"
FT                   /product="Endonuclease I"
FT                   /note="PFAM: Endonuclease I; KEGG: xcv:XCV0569 putative
FT                   extracellular ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84839"
FT                   /db_xref="GOA:B1KR22"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR22"
FT                   /protein_id="ACA84839.1"
FT                   /translation="MFYQLKHKVNRIGAIFIAAFITIPASAEIPANYYQSVDESTPESL
FT                   RNSLHQIIKGHTKIPYTSSSTDTWDVLEQADEDPNNSNNVIDVYKNASYRKVGGGNSNY
FT                   NREHSWPKSYGFPNNVSSNYPYTDMHHLFIANGSYNSSRSNKPYADCTSCNEKVTLLND
FT                   GRGGSATESNWTVGSFESGSWETWEGRKGDVARALMYMAIRYEGGSHAVTGHMEPDLIL
FT                   TDDRSLIGASNTGSNIAVAYMGLRAELIDWSREDPVDDYELRHNEVVFTYQGNRNPFID
FT                   HPEYIACVFEEICSGNGGGTPPPASTNAWINEIHYDNRGGDVNESVEILAPAATNLLNW
FT                   RIEAYNGNNSSLYKTVELSGTVPDQQNGFGSINFNIKGIQNGSADGLALINPQGEVVQF
FT                   LSYEGTLVAQNGSAEGMESTDIGVMETNSTQSGYSLQLSGHGQEYSDFIWQSPMQNSRG
FT                   SINHNQSF"
FT   sig_peptide     767062..767145
FT                   /locus_tag="Swoo_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(768631..769989)
FT                   /locus_tag="Swoo_0544"
FT   CDS             complement(768631..769989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0544"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: sse:Ssed_4090
FT                   acetyl CoA carboxylase, biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84840"
FT                   /db_xref="GOA:B1KR23"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR23"
FT                   /protein_id="ACA84840.1"
FT                   /translation="MKPEPLKRVLIANRGEIALRVQRACSQLGIETVAVHSTADRDQLH
FT                   LRHASNTICIGKPAPIDSYLNIPAIISAAAQAKADAIHPGYGFLSENADFAEQVQRSGF
FT                   TFIGPNADVIRKMGDKVSAISAMKKVGVPTVPGSDGVLTQDNKLNQQIAEKIGYPIIVK
FT                   ATAGGGGKGMRVVHHSDELIQAIELTQAEAKAAFANGDLYMEKYLQHPRHIEIQVLSDG
FT                   QGNAIHLGERDCSMQRRHQKVLEEAPALEIDSATRSKIGKLCANACIEIGYRGAGTFEF
FT                   LFEAGEFYFIEMNTRIQVEHPITEMITGIDLIHAQLEIASGRALTIKQQDIQLNGHSIE
FT                   CRINAEDPHTFTPSPGTITGFHAPGGIGVRWDSHLYSGYTVPPYYDSMIGKLITWGTTR
FT                   DQAIARMQTALDELTIEGISTNQALLQQILKDRGFREGGQSIHYLEKQVLEKK"
FT   gene            complement(770054..770518)
FT                   /locus_tag="Swoo_0545"
FT   CDS             complement(770054..770518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0545"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: sse:Ssed_4089 acetylCoA
FT                   carboxylase, BccP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84841"
FT                   /db_xref="GOA:B1KR24"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR24"
FT                   /protein_id="ACA84841.1"
FT                   /translation="MDIRKIKKLIELVQESGIAELEVTEGEESVRICQHRDQTSASQTT
FT                   QQIHTLANSPQVDNSQDDASDVDQVTDFDEKNTVISPMVGTFYLSPAPEAEPLCKVGQR
FT                   VEQGDPICIIEAMKMMNQIEALRSGIVSKILVESGDGVEFDQALIIIEDE"
FT   gene            complement(770578..771027)
FT                   /locus_tag="Swoo_0546"
FT   CDS             complement(770578..771027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0546"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: sse:Ssed_4088 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84842"
FT                   /db_xref="GOA:B1KR25"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /protein_id="ACA84842.1"
FT                   /translation="MSAKAKILLVNGPNLNLLGRREPGHYGHHTLDSIVQNMKNTANSA
FT                   DVELEHIQSNAEHELIDAIHSTDANFIIINPAAFTHTSVAIRDAILGVAIPFIEVHLSN
FT                   VHAREPFRHHSYFSDKAVGVICGLGADGYQFALKSAINRLQGPSA"
FT   gene            772107..772736
FT                   /locus_tag="Swoo_0547"
FT   CDS             772107..772736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0547"
FT                   /product="BRCT domain protein"
FT                   /note="PFAM: BRCT domain protein; KEGG: cbe:Cbei_0352 DNA
FT                   ligase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84843"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR26"
FT                   /protein_id="ACA84843.1"
FT                   /translation="MSDNKFNIYVKPSDSDAKESLLAFINAVQSKNFQSLSNASEYCEV
FT                   EHHLDVELSSSELDGVFNLKFWAVGSLTVEDFLAFLIEELNVSAVEAAVFIGDCGEYDF
FT                   HFMSSEDDESFDEYDDHEWSWLENPVIEWEDQNIVLTGKFENYESRDELAEELEDLGAN
FT                   IRSSISKKTTLLVTGLRVGPSKLEKAKSLGVRIITENELMESMELC"
FT   gene            complement(773183..773614)
FT                   /locus_tag="Swoo_0548"
FT   CDS             complement(773183..773614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0548"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: ade:Adeh_1031
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84844"
FT                   /db_xref="GOA:B1KR27"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR27"
FT                   /protein_id="ACA84844.1"
FT                   /translation="MFFLKELPTEVMLDKYTSDLTNGEKNSIIEALRIMRQASLLIRSI
FT                   ETYFSVHDLSQLRFLILIVIDREPNRSSLYPHEIASRLDVSRPVLTRTLKSLIEDGLLT
FT                   SSNDETDKRAKKITLTKKGVTCLSKVIPGYFNEINKLME"
FT   gene            complement(773624..773914)
FT                   /locus_tag="Swoo_0549"
FT   CDS             complement(773624..773914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0549"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bmu:Bmul_4219 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84845"
FT                   /db_xref="GOA:B1KR28"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR28"
FT                   /protein_id="ACA84845.1"
FT                   /translation="MNEHTFIFAKITPKPKYFEVSKEAIMNIISQTRNEPGCLEFTLHE
FT                   DGSGNLCLYEEWIDDNALKLHHEMDYTKAVFEAYTDWLAIPPEISKLIKQA"
FT   gene            complement(774455..774868)
FT                   /locus_tag="Swoo_0550"
FT   CDS             complement(774455..774868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0550"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   sse:Ssed_4087 class I peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84846"
FT                   /db_xref="GOA:B1KR29"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR29"
FT                   /protein_id="ACA84846.1"
FT                   /translation="MIKISNSVSLQENEIEWQFIRSSGAGGQHLNKVSTAAQIIFDINA
FT                   SSLPEFYKQALLKKADHRITKSGKIIIKCQASRSQDFNRQTALEQFIELVASVAIVQKR
FT                   RVATKPTKGSQRRRVDAKKQKGATKALRQNKDF"
FT   gene            774986..775351
FT                   /locus_tag="Swoo_0551"
FT   CDS             774986..775351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84847"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR30"
FT                   /protein_id="ACA84847.1"
FT                   /translation="MLCKIPDIAEGVISLFASGRLSSSDYQEKLKPLIEQSRGEAGKVF
FT                   LYVEADVLLEGWDANSLTGSGEVRLDNFDALVLVGGPDWFGNAVRLMGPFMQSEVAWYP
FT                   LEAKVEAIAWMTERLEK"
FT   gene            775503..775703
FT                   /locus_tag="Swoo_0552"
FT   CDS             775503..775703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swoo_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swoo_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA84848"
FT                   /db_xref="InterPro:IPR021379"
FT                   /db_xref="UniProtKB/TrEMBL:B1KR31"
FT                   /protein_id="ACA84848.1"
FT                   /translation="MSLSTKLTKTVSATFSILMASVFVISLSGCAPEVGSEKWCKQMSE
FT                   KDKGDWSTNEATDYAKHCVFK"
FT   sig_peptide     775503..775592
FT                   /locus_tag="Swoo_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with clea