spacer

EBI Dbfetch

ID   CP000270; SV 1; circular; genomic DNA; STD; PRO; 4895836 BP.
XX
AC   CP000270; AAAJ03000000-AAAJ03000058;
XX
PR   Project:PRJNA254;
XX
DT   03-JUL-2006 (Rel. 88, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Burkholderia xenovorans LB400 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Burkholderia xenovorans LB400
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
XX
RN   [1]
RP   1-4895836
RX   DOI; 10.1073/pnas.0606924103.
RX   PUBMED; 17030797.
RA   Chain P.S., Denef V.J., Konstantinidis K.T., Vergez L.M., Agullo L.,
RA   Reyes V.L., Hauser L., Cordova M., Gomez L., Gonzalez M., Land M., Lao V.,
RA   Larimer F., LiPuma J.J., Mahenthiralingam E., Malfatti S.A., Marx C.J.,
RA   Parnell J.J., Ramette A., Richardson P., Seeger M., Smith D., Spilker T.,
RA   Sul W.J., Tsoi T.V., Ulrich L.E., Zhulin I.B., Tiedje J.M.;
RT   "Burkholderia xenovorans LB400 harbors a multi-replicon, 9.73-Mbp genome
RT   shaped for versatility";
RL   Proc. Natl. Acad. Sci. U.S.A. 103(42):15280-15287(2006).
XX
RN   [2]
RP   1-4895836
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Lykidis A., Richardson P.;
RT   "Complete sequence of Chromosome 1 of Burkholderia xenovorans LB400";
RL   Unpublished.
XX
RN   [3]
RP   1-4895836
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Chain P.,
RA   Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Kyrpides N., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (13-MAR-2006) to the INSDC.
RL   US DOE Joint Genome Instiute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b045f08a58321a06e3fd4597772e54c5.
DR   BioSample; SAMN02598451.
DR   EnsemblGenomes-Gn; Bxe_AR0017.
DR   EnsemblGenomes-Gn; Bxe_AR0018.
DR   EnsemblGenomes-Gn; Bxe_AR0019.
DR   EnsemblGenomes-Gn; Bxe_AR0020.
DR   EnsemblGenomes-Gn; Bxe_AR0021.
DR   EnsemblGenomes-Gn; Bxe_AR0022.
DR   EnsemblGenomes-Gn; Bxe_AR0023.
DR   EnsemblGenomes-Gn; Bxe_AR0024.
DR   EnsemblGenomes-Gn; Bxe_AR0025.
DR   EnsemblGenomes-Gn; Bxe_AR0026.
DR   EnsemblGenomes-Gn; Bxe_AR0027.
DR   EnsemblGenomes-Gn; Bxe_AR0028.
DR   EnsemblGenomes-Gn; Bxe_AR0029.
DR   EnsemblGenomes-Gn; Bxe_AR0030.
DR   EnsemblGenomes-Gn; Bxe_AR0031.
DR   EnsemblGenomes-Gn; Bxe_AR0032.
DR   EnsemblGenomes-Gn; Bxe_AR0033.
DR   EnsemblGenomes-Gn; Bxe_AR0034.
DR   EnsemblGenomes-Gn; Bxe_AR0035.
DR   EnsemblGenomes-Gn; Bxe_AR0036.
DR   EnsemblGenomes-Gn; Bxe_AR0038.
DR   EnsemblGenomes-Gn; Bxe_AR0039.
DR   EnsemblGenomes-Gn; Bxe_AR0040.
DR   EnsemblGenomes-Gn; Bxe_AR0041.
DR   EnsemblGenomes-Gn; Bxe_AR0042.
DR   EnsemblGenomes-Gn; Bxe_AR0043.
DR   EnsemblGenomes-Gn; Bxe_AR0044.
DR   EnsemblGenomes-Gn; Bxe_AR0045.
DR   EnsemblGenomes-Gn; Bxe_AR0046.
DR   EnsemblGenomes-Gn; Bxe_AR0047.
DR   EnsemblGenomes-Gn; Bxe_AR0048.
DR   EnsemblGenomes-Gn; Bxe_AR0049.
DR   EnsemblGenomes-Gn; Bxe_AR0050.
DR   EnsemblGenomes-Gn; Bxe_AR0051.
DR   EnsemblGenomes-Gn; Bxe_AR0052.
DR   EnsemblGenomes-Gn; Bxe_AR0053.
DR   EnsemblGenomes-Gn; Bxe_AR0054.
DR   EnsemblGenomes-Gn; Bxe_AR0055.
DR   EnsemblGenomes-Gn; Bxe_AR0056.
DR   EnsemblGenomes-Gn; Bxe_AR0057.
DR   EnsemblGenomes-Gn; Bxe_AR0058.
DR   EnsemblGenomes-Gn; Bxe_AR0059.
DR   EnsemblGenomes-Gn; Bxe_AR0060.
DR   EnsemblGenomes-Gn; Bxe_AR0061.
DR   EnsemblGenomes-Gn; Bxe_AR0062.
DR   EnsemblGenomes-Gn; Bxe_AR0063.
DR   EnsemblGenomes-Gn; Bxe_AR0064.
DR   EnsemblGenomes-Gn; Bxe_AR0065.
DR   EnsemblGenomes-Gn; Bxe_AR0066.
DR   EnsemblGenomes-Gn; Bxe_AR0067.
DR   EnsemblGenomes-Gn; Bxe_AR0069.
DR   EnsemblGenomes-Gn; Bxe_AR0070.
DR   EnsemblGenomes-Gn; Bxe_AR0071.
DR   EnsemblGenomes-Gn; Bxe_AR0072.
DR   EnsemblGenomes-Gn; Bxe_AR0073.
DR   EnsemblGenomes-Gn; Bxe_AR0074.
DR   EnsemblGenomes-Gn; Bxe_AR0075.
DR   EnsemblGenomes-Gn; Bxe_AR0076.
DR   EnsemblGenomes-Gn; Bxe_AR0077.
DR   EnsemblGenomes-Gn; Bxe_AR0078.
DR   EnsemblGenomes-Gn; Bxe_AR0079.
DR   EnsemblGenomes-Gn; Bxe_AR0080.
DR   EnsemblGenomes-Gn; Bxe_AR0081.
DR   EnsemblGenomes-Gn; Bxe_AR0082.
DR   EnsemblGenomes-Gn; Bxe_AR0083.
DR   EnsemblGenomes-Gn; Bxe_AR0084.
DR   EnsemblGenomes-Gn; Bxe_AR0085.
DR   EnsemblGenomes-Tr; Bxe_AR0017.
DR   EnsemblGenomes-Tr; Bxe_AR0018.
DR   EnsemblGenomes-Tr; Bxe_AR0019.
DR   EnsemblGenomes-Tr; Bxe_AR0020.
DR   EnsemblGenomes-Tr; Bxe_AR0021.
DR   EnsemblGenomes-Tr; Bxe_AR0022.
DR   EnsemblGenomes-Tr; Bxe_AR0023.
DR   EnsemblGenomes-Tr; Bxe_AR0024.
DR   EnsemblGenomes-Tr; Bxe_AR0025.
DR   EnsemblGenomes-Tr; Bxe_AR0026.
DR   EnsemblGenomes-Tr; Bxe_AR0027.
DR   EnsemblGenomes-Tr; Bxe_AR0028.
DR   EnsemblGenomes-Tr; Bxe_AR0029.
DR   EnsemblGenomes-Tr; Bxe_AR0030.
DR   EnsemblGenomes-Tr; Bxe_AR0031.
DR   EnsemblGenomes-Tr; Bxe_AR0032.
DR   EnsemblGenomes-Tr; Bxe_AR0033.
DR   EnsemblGenomes-Tr; Bxe_AR0034.
DR   EnsemblGenomes-Tr; Bxe_AR0035.
DR   EnsemblGenomes-Tr; Bxe_AR0036.
DR   EnsemblGenomes-Tr; Bxe_AR0038.
DR   EnsemblGenomes-Tr; Bxe_AR0039.
DR   EnsemblGenomes-Tr; Bxe_AR0040.
DR   EnsemblGenomes-Tr; Bxe_AR0041.
DR   EnsemblGenomes-Tr; Bxe_AR0042.
DR   EnsemblGenomes-Tr; Bxe_AR0043.
DR   EnsemblGenomes-Tr; Bxe_AR0044.
DR   EnsemblGenomes-Tr; Bxe_AR0045.
DR   EnsemblGenomes-Tr; Bxe_AR0046.
DR   EnsemblGenomes-Tr; Bxe_AR0047.
DR   EnsemblGenomes-Tr; Bxe_AR0048.
DR   EnsemblGenomes-Tr; Bxe_AR0049.
DR   EnsemblGenomes-Tr; Bxe_AR0050.
DR   EnsemblGenomes-Tr; Bxe_AR0051.
DR   EnsemblGenomes-Tr; Bxe_AR0052.
DR   EnsemblGenomes-Tr; Bxe_AR0053.
DR   EnsemblGenomes-Tr; Bxe_AR0054.
DR   EnsemblGenomes-Tr; Bxe_AR0055.
DR   EnsemblGenomes-Tr; Bxe_AR0056.
DR   EnsemblGenomes-Tr; Bxe_AR0057.
DR   EnsemblGenomes-Tr; Bxe_AR0058.
DR   EnsemblGenomes-Tr; Bxe_AR0059.
DR   EnsemblGenomes-Tr; Bxe_AR0060.
DR   EnsemblGenomes-Tr; Bxe_AR0061.
DR   EnsemblGenomes-Tr; Bxe_AR0062.
DR   EnsemblGenomes-Tr; Bxe_AR0063.
DR   EnsemblGenomes-Tr; Bxe_AR0064.
DR   EnsemblGenomes-Tr; Bxe_AR0065.
DR   EnsemblGenomes-Tr; Bxe_AR0066.
DR   EnsemblGenomes-Tr; Bxe_AR0067.
DR   EnsemblGenomes-Tr; Bxe_AR0069.
DR   EnsemblGenomes-Tr; Bxe_AR0070.
DR   EnsemblGenomes-Tr; Bxe_AR0071.
DR   EnsemblGenomes-Tr; Bxe_AR0072.
DR   EnsemblGenomes-Tr; Bxe_AR0073.
DR   EnsemblGenomes-Tr; Bxe_AR0074.
DR   EnsemblGenomes-Tr; Bxe_AR0075.
DR   EnsemblGenomes-Tr; Bxe_AR0076.
DR   EnsemblGenomes-Tr; Bxe_AR0077.
DR   EnsemblGenomes-Tr; Bxe_AR0078.
DR   EnsemblGenomes-Tr; Bxe_AR0079.
DR   EnsemblGenomes-Tr; Bxe_AR0080.
DR   EnsemblGenomes-Tr; Bxe_AR0081.
DR   EnsemblGenomes-Tr; Bxe_AR0082.
DR   EnsemblGenomes-Tr; Bxe_AR0083.
DR   EnsemblGenomes-Tr; Bxe_AR0084.
DR   EnsemblGenomes-Tr; Bxe_AR0085.
DR   EuropePMC; PMC1847439; 17362501.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2681681; 19286791.
DR   EuropePMC; PMC2892462; 20504315.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02227; sX8.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000270.
DR   SILVA-SSU; CP000270.
DR   StrainInfo; 374301; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2351477
CC   Source DNA and bacteria available from Jim Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Contacts: Jim Tiedje (tiedjej@pilot.msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4895836
FT                   /organism="Burkholderia xenovorans LB400"
FT                   /chromosome="1"
FT                   /strain="LB400"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:266265"
FT   gene            192..1826
FT                   /locus_tag="Bxe_A4462"
FT   CDS             192..1826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4462"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4462"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28539"
FT                   /db_xref="GOA:Q147F0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q147F0"
FT                   /protein_id="ABE28539.1"
FT                   /translation="MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAP
FT                   NRFKLDWVKSQFSGRIADMARDFWHTPIDVQFVLDPKAGMRAPAAAAPAPASARPASAP
FT                   GSMGGSAGNGAAVDAAVGAVQAAQTARANGANSANNAMANLNANARAAAEQNANARAAA
FT                   EDSADLDLPSLDANEAAAARRTWRPGQSAGSNGNGETDSMYERSKLNPVLTFDNFVTGK
FT                   ANQLARAAAIQVADNPGISYNPLFLYGGVGLGKTHLIHAIGNQLLMDKAGARIRYIHAE
FT                   QYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQ
FT                   VIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMRVAILMRKAQSEFVSLNEDVA
FT                   FFVAKHLRSNVRELEGALRKILAYSKFHGREITIEVTKEALKDLLTVQNRQISVENIQK
FT                   TTADFYSIKVADMYSKKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHA
FT                   VRKIADERSKDAQLNHELHVLEQTLKG"
FT   gene            2047..3150
FT                   /locus_tag="Bxe_A4461"
FT   CDS             2047..3150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4461"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4461"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28540"
FT                   /db_xref="GOA:Q147E9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E9"
FT                   /protein_id="ABE28540.1"
FT                   /translation="MQLVKTERDNLLRPLQTVSGIVERRHTLPILANLLITKNGPDVSF
FT                   LSTDLELQITTRADFGVGGDSVATTVAARKLLDILRAMPDGQVTLTLNDKRLTVQSGKS
FT                   RFALQTLAADEFPTVAQAKDYGANLVVPQKTFRQLLGMVHFSMAQQDIRYYLNGMLLVV
FT                   DGDQLMAVATDGHRLAFSSMKIEGSFQRQEVIIPRKTILELQRLLEDIDDTLKIDIAQT
FT                   QVKFTFGQVELVSKLVEGKFPDFQRVIPKSHKNQFVIGREELQRSLQRAAILTSDKFKG
FT                   VRCIIEPGQLKIMSTNADQEEAQEELEIAYDGDSVDIGFNVTYLLDVLANLKVDTLQVS
FT                   LGDASSSALITIPENDEFKYVVMPMRI"
FT   gene            3266..5737
FT                   /locus_tag="Bxe_A4460"
FT   CDS             3266..5737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4460"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4460"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28541"
FT                   /db_xref="GOA:Q147E8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E8"
FT                   /protein_id="ABE28541.1"
FT                   /translation="MTETNNSQPDNSYGASSIQILEGLEAVRKRPGMYIGDTSDGTGLH
FT                   HLVFEVLDNSIDEALAGHCNDIQVIIHADNSISITDNGRGVPTGLKMDDKHDPKRSAAE
FT                   IVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNALSAWLRLTIRRDGKKHFMEFHRGVPQ
FT                   NRIIEEIDGVAVSPIQVTGETENRGTEVHFLADETIFGNIEYHYDILAKRIRELSFLNN
FT                   GVRIKLTDQRTGKEEDFAFVGGVKGFVEYINKNKSVLHPNIFHISGEKDGVGVEVAMQW
FT                   NDSYNENVLCFTNNIPQRDGGTHLTGLRAAMTRVLNKYINDHEVAKKAKVETSGDDMRE
FT                   GLSCVLSVKVPEPKFSAQTKDKLVSSEVRAPVEDVVAKALEEFLLETPNDAKIICSKIV
FT                   DAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPAKSEIYIVEGDSAGGSAKQG
FT                   RDRKFQAILPLRGKVLNVEKARYDKLLSSEQIVTLITALGCGIGKEDYNLDKLRYHRII
FT                   IMTDADVDGAHIRTLLLTFFYRQMPEMIERGYIYIAQPPLFKIKAGKDERYLKDEAEVN
FT                   AHILKLALQGSELLASEGATPITGDALGELARAYLLAQAVVNRLSRLYDAGALEAVMDG
FT                   VVVDLSSEEAAEVSAAALEAKLRDDALKPEVKVTTMYDPVRELRSLRVARTHHGNQKIS
FT                   VLDQDFQLTADYQQLINTANTFKGLIGTGAVIKRGERSMAVTDFKSAMKWLLADAERNI
FT                   SKQRYKGLGEMNPGQLWETTMDPTVRRLLRVQIEDAIAADGIFTTLMGDDVEPRRAFIE
FT                   SNALRAGNIDV"
FT   gene            complement(5932..7425)
FT                   /locus_tag="Bxe_A4459"
FT   CDS             complement(5932..7425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4459"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28542"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E7"
FT                   /protein_id="ABE28542.1"
FT                   /translation="MQHELEMVTLEELVPKDHLLRKIDAAVDFEFIREKVAHLYCADNG
FT                   RPALDPVVMFKLLFVGYLFGVRSERQLMREVQVNVAYRWFARLRLTDRVPDASTFSQNR
FT                   RRRFTDTTVYQEIFDAIVQQAIGRGMVEGRVLYTDSTHLKANANKRKFDLVQLEQTPSA
FT                   YLAALDAAVDADRAAHDKKPLRRDGPQANDKGKNDDDTPGSSGTGEGKETKVSRTDPES
FT                   GYMVRDDKPTGFFYLDHRTVDARYPIITDTHVTPASVHDSQPYLARLDRQRRRFGFHVQ
FT                   AVGLDAGYFTPAICQGLEDRGIDGVMGYRTPNHKPGFFYKRDFRYSRYREEYTCPRGQV
FT                   LRYSTTNRAGYQEFRSDPAQCGSCEVRNKCTTSANHVKVVIRHVWERAKEHVDARRLTD
FT                   WGKAIYKRRKETVERSFADAKQLHGHRYARMRGLRKVAEQCLLGAAAQNIKKIALLVAR
FT                   LKACLRVPGSRPGVLHRLASAFLARFVRSGETHRTICLA"
FT   gene            complement(8140..8388)
FT                   /locus_tag="Bxe_A4458"
FT   CDS             complement(8140..8388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4458"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28543"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E6"
FT                   /protein_id="ABE28543.1"
FT                   /translation="MLYVRRQRRIPKIRYFLDHCSCKRFRQNEIALEAMHVSFDLFRKY
FT                   ESATGREEGASDKARARSKERCPPGRRRYPLSSRRLS"
FT   gene            complement(8408..9037)
FT                   /locus_tag="Bxe_A4457"
FT   CDS             complement(8408..9037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4457"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4457"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28544"
FT                   /db_xref="GOA:Q13RK7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK7"
FT                   /protein_id="ABE28544.1"
FT                   /translation="MWFRHSLLATARRVAKGRCLATHSRSVARRTASPWRNRFLACARR
FT                   QLIDSRRAGGKKTGPNPTDRRKLGSKHHLIVDAQGIPLAVILSAANRHDITQLDALVDA
FT                   IPRIRGKRGRPLHKPRIVQGDRGYSSEPHRQRLRERGITPLLAKVGAPHGSGLGKTRWP
FT                   VERSIAWLHSFRRLKIRYERYAHVHEAFLSLACALICWTRLKPLFN"
FT   gene            9386..11887
FT                   /locus_tag="Bxe_A4456"
FT   CDS             9386..11887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4456"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28545"
FT                   /db_xref="InterPro:IPR026866"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E4"
FT                   /protein_id="ABE28545.1"
FT                   /translation="MTIIQEICQWSKTLSAWQQDAIARLYVNRELSPEDIEDIEDIYAL
FT                   AKAEAGIPDEDGRVPKKLEGTEVAPQTNPTRLVQIVAVKELQHVNALVQGGRLPISPTG
FT                   LTVIYGENGAGKSGYSRIFKHACRARDRREPILPNARLDPKDVGTAQAVFETIVDGTTV
FT                   DFVWKHRSEPPVPLADISIFDTHCARAYIDNQGDFAYVPYGLDILEGLVSLSTKLKARA
FT                   TKEKADSSPSDAAYSSLINQTTAVGRALSGISKKTTREQIEQLAELSDDEVERREVLTK
FT                   TLSEADPKTKAREIRNKELRIKGLKTQIEAKLGTVSVEKLRNLQELIGKSNAAKKTADT
FT                   AAEAFRSEPGQLPGTGGEEWKTLFEAARDFAAISHAGHQISALPEDAKCPLCQNELGAE
FT                   GAGRLGRFDAFIKDRVEQAAKDARNLAKDAYNAIKSAKLDFPIDAALKEELNALDAQLL
FT                   PFCEQLEASLKTRQSDALLASGGTLPWESVCAVQNDAAVRLGEVADALEAQAKTLEASA
FT                   DEVARAKLLLERAELDARHKLREVKDAVLEAISKYEYCAKLQKCIDGTDTRGISRKSTD
FT                   LSRTLASKELADALNDELKRLKCHELQVVMKPESPGGRTQFKLTLQLPGNATPAAILSE
FT                   GEQRAIAIASFLAETKLGGGLGGIVFDDPVSSLDHRRRWEVAERLVEESLKRQVIVFTH
FT                   DIYFLCILEQKAEELKAQFQANYIRRTGDGFGAHSDGLPFDVLGTKNRVGKLRQMLVEV
FT                   RKAHADGDEDAHRTLTSRAYGDLRLAWERCVEEVLFNGAIQRFGEGVSTLRLKEVTVSD
FT                   DDYRAIEAAIVDGRIKLTHFR"
FT   gene            11968..13479
FT                   /locus_tag="Bxe_A4455"
FT   CDS             11968..13479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4455"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4455"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28546"
FT                   /db_xref="GOA:Q13ST1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ST1"
FT                   /protein_id="ABE28546.1"
FT                   /translation="MLAKIRRMHFRDGVPLRDIARQTGLSRNTIRRWLREPSASEPKFA
FT                   RRVSNSVVDPWSEQLRLWLVADTRRTRRERRSATQMYEDLRAAGYDGSYDRVSAFVRNW
FT                   KKERDSGAQRGAFIPLAFEYGEAFQFDWSCEYVFIGGLRRRVEVAHMKLAASRAFWLVA
FT                   YPTQSHEMLFDAHARAFVALGGIPRRGIYDNMKTAVDKVGPGKERAINARFHAMCGHYL
FT                   FEPEFCNRAAGWEKGIVEKNVQDRRRQIWHDAIGIRWESLEVLNIWLAERCQQAWKQLR
FT                   HPQWPELSVEDALADERPRLMQVPKPFDGYIEKPVRVSPTSLVHLDRNRYSVPTEYAHH
FT                   IVSLRSYPTYISLVADGVEIARHPRSFDRYQTFYDWRHYIALVERKPGALRNGAPFLTM
FT                   PEPMLRLQRHLLRQTGGDRVMVQVLAATPVHGLEAVLVAVELALESGRPSGDHVLNILA
FT                   RLKSQSVHSGDGVRTAITLKVEPLADVYRYERLRVTRDQEDGHVE"
FT   gene            13469..14278
FT                   /locus_tag="Bxe_A4454"
FT   CDS             13469..14278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4454"
FT                   /product="Putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28547"
FT                   /db_xref="GOA:Q13ST2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ST2"
FT                   /protein_id="ABE28547.1"
FT                   /translation="MSNETAALLKSLKLHGMAQAWPELVAQARHSDFEPEKFMQMLLKA
FT                   ETAERQVRSINYQMAAARFPAHRDLAGFDFQQASVDETLVRELHTVRFCESAQNVVFIG
FT                   GPGTGKTHLATSIGIDAIQNHAKRVRFFTTVELVNQLEAEKAAGKPGQLANRLMYVDAI
FT                   VLDELGYLPFTQTGGALLFHLLSKLYERTSVLVTTNLSFTEWSNVFGDAKMTTALLDRL
FT                   THHCHIVETGNDSWRFKNSTAGQPASRAATRKSSPKRQKEEEIDAPE"
FT   gene            complement(14424..15005)
FT                   /locus_tag="Bxe_A4453"
FT   CDS             complement(14424..15005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4453"
FT                   /product="Putative flavin-dependent reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28548"
FT                   /db_xref="GOA:Q147E1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E1"
FT                   /protein_id="ABE28548.1"
FT                   /translation="MLATQFRDIFSALAAGVSVITFDAGGHVHGFTATSLTPVSLMPPL
FT                   ALFCVARSSRSGASLSHGKMIGISILGETQRHVSRRFSEQAKPGSYRDITVRRNEDGVP
FT                   VVSGANATIEARIANIYPAGDHLICVCELKSGCLTQADEPLLYFSRRYHGVSVLPELET
FT                   ERELAPQKEEVEEAAVCGDSDGRVQGRRAC"
FT   gene            complement(15111..16586)
FT                   /locus_tag="Bxe_A4452"
FT   CDS             complement(15111..16586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4452"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28549"
FT                   /db_xref="GOA:Q147E0"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:Q147E0"
FT                   /protein_id="ABE28549.1"
FT                   /translation="MSRTQEKHNRSVSKDVLVVGGGTSGFVAAIAAARNGASVLLLEQR
FT                   DHLGGTHSGGMVMMIRSMRHMKAPANMEQKKIMMTGYESSFDDEQVVRSIVQEYINRML
FT                   EIGSAWGRKDEATARQMFDPEIAKWVIQDMVAEAGVEVWLNTQATDVIMEGNALKGVVI
FT                   ESLRDRVEVHAGITIDTTGDGDIAAAAGAAFEFGSPEDGKCQPASLYFAVGGVQLDKTI
FT                   AYMRDHANEFGEEYVKTMVGLKEQNKPITMFPFKEKIREALKNGDYPIPYGVETVNPDT
FT                   LSYIVRPMFRNGKFRYDVTYHNMDMAYNFDATDRVELTKATLAMRDLANKMAKFYRKYV
FT                   PGYEDSYLSYTAQSVGIRDSRRIVCDYTLTREDVLAGQVFPDGIGRYGSLMDVHDKSGK
FT                   KSLSLVEVGGHGWFHVPFRSLLPKGIENLMVAGRCISADYDAQGSVRSQAASMVTGQAT
FT                   GTAAALAVQQKRKLRELDVSALQEVLKAQNQVI"
FT   gene            complement(16649..17965)
FT                   /locus_tag="Bxe_A4451"
FT   CDS             complement(16649..17965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4451"
FT                   /product="Putative oxalate/formate antiporter,
FT                   majorfacilitator superfamily (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28550"
FT                   /db_xref="GOA:Q147D9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR026355"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D9"
FT                   /protein_id="ABE28550.1"
FT                   /translation="MATREHRPTNRWLQLIAGIVAMIMVANYQYAFTLFTPGIKEHFVG
FT                   TPYSSIALIFTIFVIFETWPVPVAGVLIDKFGVKLLMFIGTGLVFTGWLLGGAFAGSVK
FT                   DLYLYYGVITGLGAGTIYVAVTGNAIKWFPDHRGLAAGLTAAGFGGGSALTLIPISATI
FT                   KAIGWEHAMVTWGTIQAVVVLGMTFILRHPPANWAPPGWTPKITKTLAQTAESYTWLQA
FT                   LRMPEFYLLYLIHFLISLGGLMTLGNLSEIARYLHVETATIMGISIVAFAATANGIGSV
FT                   ASRIFWGVTSDRLGRENTMSVVFVLEGIFIFCVTQITGSPILFVVIFPLIFFGYTQINT
FT                   LLSATTGDLFGARHVSANFGMLYTAKGAAAIFSGWGAARVAAAFAGSFQAPYYIAAACD
FT                   LLAAVLAIFVLKPLVRAKLASRNLKKEADSASTMINAQL"
FT   gene            complement(18021..18347)
FT                   /locus_tag="Bxe_A4450"
FT   CDS             complement(18021..18347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28551"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D8"
FT                   /protein_id="ABE28551.1"
FT                   /translation="MRSLWPLRPLWPSAGAAAAFPARLGMSVLSLDESSQEPVWRFAPV
FT                   TAITLFARLWRSVSPDSYATAFPLPSPRFAALNLLSRRDHTKSIADVNPYPVTDFSSCP
FT                   FRKF"
FT   gene            complement(18386..19111)
FT                   /locus_tag="Bxe_A4449"
FT   CDS             complement(18386..19111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4449"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4449"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28552"
FT                   /db_xref="GOA:Q147D7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D7"
FT                   /protein_id="ABE28552.1"
FT                   /translation="MRNTAVAEQPASVPAMSRLTRQRLHDTVVEYLRDYIVKGVLAPGV
FT                   KLNERELCETLGISRTPLREAIKVLAAEGLIEISANRGAAVTKLAESEIDEMFELMSGL
FT                   EAFAGELACERITPHEIAEIKALHYAMVACREREDLSGYYGYNQQIHDRINGAARNCAL
FT                   RQTYLSINRRLQAMRFKSNFHKSKRDHAVHDHEEMIKALESRDGKRLSAILRQHLLDKR
FT                   DVVLVTLATARETPATGGR"
FT   gene            complement(19242..20768)
FT                   /locus_tag="Bxe_A4448"
FT   CDS             complement(19242..20768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4448"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4448"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28553"
FT                   /db_xref="GOA:Q147D6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D6"
FT                   /protein_id="ABE28553.1"
FT                   /translation="MNTLSSVIRLHDDDDVAIARNALTAGTVLTELDGLTVRADIPAAH
FT                   KIALRPIEAGSIVRRYGQTIGFATQRIEPGEHVHVHNVSMGDFERDYAFGADVRPVEAA
FT                   STPVTFQGFRRADGQVATRNYIGVISTVNCSATVSKMVAQHFSAPGRLDAYPNVDGVVP
FT                   ITHSFGCCIDHNGEGIQQLRRTINGFVKHPNFAGVLVIGLGCEANQMGAMFMTGGIETG
FT                   PMMVPLVMQEQGGTQKTVDAAIKAIDQMLPVANQAQREPLPISHLNIALQCGGSDGYSG
FT                   ITANPALGAAVDLLVAHGGTAILSETPEIYGAEHLLTRRAISRDVGEKIVERIHWWEAY
FT                   AEREKGSIDNNPTPGNKAGGLTTILEKSLGAVAKSGSTPLMGVYRYAEPVDTHGLVFMD
FT                   APGYDPMGATGQIASGANLVVFTTGRGSCFGAKPAPSIKVATNTPMFNRMRDDMDINCG
FT                   DIMEGHATVRQKGEEIFRAIVEVASGVKSKSEALGVGNEEFVPWMIGAQM"
FT   gene            20900..21616
FT                   /locus_tag="Bxe_A4447"
FT   CDS             20900..21616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4447"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4447"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28554"
FT                   /db_xref="GOA:Q147D5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D5"
FT                   /protein_id="ABE28554.1"
FT                   /translation="MASIQPTRSVLEHTVRELERHMLDGSWGDGARLPAERALAEQFGV
FT                   SRATVREAIQRLVSRGLLQTRRGSGVFLVGRHPARLAAPWLQLIAEHPPLRADTLEFRL
FT                   VFECAAAGLAARRASEDERGQLREIVTRMRDAVLTHDLAAEAAADAQFHATLALASHNR
FT                   MFDHFYSSVIVMLREHITSNTYEATLNHAQAAERAHARLLQHERICDAICRQVPEDATH
FT                   AMRAHIEFVGHQFEAE"
FT   gene            complement(22011..22493)
FT                   /locus_tag="Bxe_A4446"
FT   CDS             complement(22011..22493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4446"
FT                   /product="Putative DNA gyrase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4446"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28555"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D4"
FT                   /protein_id="ABE28555.1"
FT                   /translation="MTMREVVIRHVEPIELLSVDHVGPYPQIGKAFDALFGWLAKHNLL
FT                   AAQMRVIGVYYDDPSVVEESALRSKAGVLLPHPVQASVTLSPPVSVAHLKGGDYAVLEH
FT                   RGPYSDLRAAYDWLYGTWLVQSGRKAADAPSFEEYLNSPKDTAPADLITEICVPLV"
FT   gene            22755..24158
FT                   /locus_tag="Bxe_A4445"
FT   CDS             22755..24158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4445"
FT                   /product="ethanolamine:proton symporter, EAT family"
FT                   /note="TC 2.A.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28556"
FT                   /db_xref="GOA:Q147D3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D3"
FT                   /protein_id="ABE28556.1"
FT                   /translation="MKSESKNQHVGKVTHHELKQTLGTWQLWGIAVGLVISGEYFGWSY
FT                   GWASAGTLGFVITAIFIAAMYTTFIFSFTELTTSIPHAGGPFAYARHAFGPTGGYLAGA
FT                   ATLVEFVFAPPAIALAIGAYLHVQFPGLEPKHAAMGAYLVFMALNIVGVQIAAAFELCV
FT                   TLLAIFELFVFMGVVSPGFQWSNFTKGGWSGADTFSMGSFHGMFAAIPFAIWFFLAIEG
FT                   VAMAAEEAKNPKRSIPIAYVTGILTLVVLAIGVMVFAGAAGDWTKLSNINDPLPQAMKF
FT                   IVGEHSGWMHMLVWLGLFGLVASFHGIILGYSRQIFALARAGYLPEWLSRVHPRFKTPH
FT                   RAIIAGGVVGIAAIYSDELIQFGGQTLTANIVTMSVFGAIVMYIISMLSLFKLRRAEPN
FT                   MERPFRAPLFPVFPAFALVAAVICLATMVYFNFLVAIVFAIFLALGYVYFLMTRHQREA
FT                   APADALLEE"
FT   gene            24202..25596
FT                   /locus_tag="Bxe_A4444"
FT   CDS             24202..25596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4444"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28557"
FT                   /db_xref="GOA:Q147D2"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D2"
FT                   /protein_id="ABE28557.1"
FT                   /translation="MSYTETIGSRTYRFADLKTLMAKASPQRSGDQLAGVAAASEEERV
FT                   AAKMALAQVPLRTFLNEALIPYESDEVTRLVIDDHSPQAFAEIAHLTVGDFRNWLLSST
FT                   TDADALTRIAAGLTPEMVAAVSKLMRNQDLIAAARKRPVITRFRNTVGLPGHMSVRLQP
FT                   NHPTDDVKGIAASMLDGLMYGCGDAMIGINPASDNLAAITRLLLMVDDFRQRYQVPTQS
FT                   CVLTHVTNTIAAIEKGAPVDLVFQSIAGTEKANAGFGISLALLQEAYEAGLSLKRGTVG
FT                   NNLMYFETGQGSALSADAHFGVDQQTCEVRAYAVARKFNPFLVNTVVGFIGPEYLYDGK
FT                   QITRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDNLLTLLGVAGINFIMGIPGAD
FT                   DVMLNYQSTSFHDALYVREVLGLRRAPEFEEWLESMQITDARGALLSASTQQPLLEGAP
FT                   DWMGIA"
FT   gene            25593..26390
FT                   /locus_tag="Bxe_A4443"
FT   CDS             25593..26390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4443"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28558"
FT                   /db_xref="GOA:Q147D1"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D1"
FT                   /protein_id="ABE28558.1"
FT                   /translation="MSEFLEKNPWNALRQFTNARIALGRAGNSLPTAPLLAFNLSHAQA
FT                   RDAVHHPLDTDVLHEQLRTQHFTTLDVHSAAPDREHYLRRPDLGRRLSEESRVALAAVP
FT                   DGSPEVVFVIGDGLSAFAASKQSLPLLRAVIPRLADWKIGPVVVARQARVALGDEIGEL
FT                   LNARLVVMLIGERPGLSSPDSLGIYLTYGPKVGCSDAQRNCISNVRPEGLDYPLAAHKL
FT                   HYLLTHARRLGLTGVGLKDDSDALLADTPAAPAISGESNPGAA"
FT   gene            complement(26407..26802)
FT                   /locus_tag="Bxe_A4442"
FT   CDS             complement(26407..26802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4442"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4442"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28559"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:Q147D0"
FT                   /protein_id="ABE28559.1"
FT                   /translation="MADEKEVARVIATPAAVELIDKLRAEHGAVLFHQSGGCCDGSAPM
FT                   MFPQSEFMVGSSDVKLGTIADVPFYMSESQFEYWQHTQLIIDVVPGNGGMFSLERPSGL
FT                   RFLTRSRLFEDDENAWLETHPVQRADA"
FT   gene            complement(26868..28388)
FT                   /locus_tag="Bxe_A4441"
FT   CDS             complement(26868..28388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4441"
FT                   /product="Aldehyde dehydrogenase (NAD+)"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4441"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28560"
FT                   /db_xref="GOA:Q147C9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C9"
FT                   /protein_id="ABE28560.1"
FT                   /translation="MNHAEMQFLTTEFPYKKQYANFIGGEWVKPVGGEYFDNVSPITGE
FT                   AFTSIPRSREADVELALDAAHRAKTAWGKTSAADRANILNRIADRMEANLQRLAVAETI
FT                   DNGKPLRETTAADIPLAIDHFRYFAGAVRAQEGSLSEIDHDTVAYHFHEPLGVVGQIIP
FT                   WNFPILMAVWKLAPALAAGNCVVLKPAEQTPASILVLVELIQDLLPPGVLNVVNGFGLE
FT                   AGKPLASSKRIAKIAFTGETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVMNEDDS
FT                   FFDKALEGFAMFALNQGEVCTCPSRVLIDEKIYDRFMERALKRVAAITQGHPLDTKTMI
FT                   GAQASQEQLEKILSYVDLGKQEGAECLIGGERNALGGELSKGYYVKPTVFRGNNKMRIF
FT                   QEEIFGPVVSVTTFRNEEEALEIANDTLYGLGAGVWTRDGTRAYRFGRQIQAGRVWTNC
FT                   YHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYSDKPLGFF"
FT   gene            28717..29775
FT                   /locus_tag="Bxe_A4440"
FT   CDS             28717..29775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4440"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4440"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28561"
FT                   /db_xref="GOA:Q147C8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C8"
FT                   /protein_id="ABE28561.1"
FT                   /translation="MTTDTFGGDLPASTLVPQPSFCVQTRVAHDADEQARNLHGWSQTY
FT                   DQLTAGCFVGGLTELCLDHMQLFVETTSHTLRQTCEVQKDAYWFGIPACAAGSGRIDAQ
FT                   VIAGDALAFRPGGIEFELLTSAGYEIFGVVVKGEVLRRYAAQVERVGLADPVPNTQVVP
FT                   IGMARKAQLCATLRQLLDDGAARGTPLSSVARNNLQAAVLASLFDVGALPASEPVAMPA
FT                   RPRRQSIVSEARDYVLLNRDRAVSVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRAIR
FT                   LNGARRDLSNASRESRSVQDVAAAWGFWHLSQFATDYRKLFGMRPSETLKAATGTRVER
FT                   AGAFNAVALAHH"
FT   gene            complement(29838..31967)
FT                   /locus_tag="Bxe_A4439"
FT   CDS             complement(29838..31967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4439"
FT                   /product="Heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type
FT                   ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4439"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28562"
FT                   /db_xref="GOA:Q147C7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C7"
FT                   /protein_id="ABE28562.1"
FT                   /translation="MPQSETVGSDMRTAIRIMQMDCPTEEALIRKKFSRMPHVRSMDFN
FT                   LMQRILTVVHAPEALDSILAALRSLDFTPELANAAPDTAPTAAPHTPPKPWWPLALAGA
FT                   AAAGSEAAGWLGAPGWLPAALAILAILSCGLTTYRKGWLAIRNGNLNINALMSIAVTGA
FT                   LILRQWPEAAMVMVLFTIAELIEAKSLDRARNAIQGLMQLTPEEASVQQPDGGWRSTEL
FT                   KAIAPGAVVRVKPGERVALDGEIVAGRSTVNQAPITGESLPVDKAVGDAVFAGTINQTG
FT                   SFDYRVSAAASNTTLARIIHAVEEAQATKAPTQRFVDQFARVYTPIVFAVALAVAIVPP
FT                   LLFGGSWQAWIYKALVMLVIACPCALVISTPVTIVSGLAAAARKGILIKGGAYLEQGRK
FT                   LTRLALDKTGTITHGKPVQTEFEILAEVDAGRCRTLAASLAGRSDHPVSMALAAAAKAD
FT                   GVTSLTVGAFEALTGRGVRGEIDGLSYWLGNHRLVEELGRCSASLEARLDALERQGRTV
FT                   VMLVDGERVLALFAVADTVKESSRAAIAELQHLGVKTAMLTGDNPHTAAAIAQQVGVDE
FT                   ARGNQLPEDKLNAIAQWSKEHATVGMVGDGINDAPALARADIGFAMGAMGTDTAIETAD
FT                   VALMDDDLRKIPSFIRLSKATHSVLVQNITLALGIKSVFLVLTVIGLGTMWMAVFADVG
FT                   ASLLVVANGLRLLRK"
FT   gene            32344..32775
FT                   /locus_tag="Bxe_A4438"
FT   CDS             32344..32775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4438"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4438"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28563"
FT                   /db_xref="GOA:Q147C6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C6"
FT                   /protein_id="ABE28563.1"
FT                   /translation="MKIGELAKIAHCTTETIRFYEKESLLPEAERTGANYRSYTAKHVE
FT                   RLRFIRNCRALDMTHDEIRGLLRLTDAPATGCGGINALIDEHIAHVDTRIEELKQLKVQ
FT                   LTTLREQCHGEQAVEDCGIVQGLNEMDVSAPRARHTHLG"
FT   gene            32832..33077
FT                   /locus_tag="Bxe_A4437"
FT   CDS             32832..33077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28564"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C5"
FT                   /protein_id="ABE28564.1"
FT                   /translation="MRPAVSTIESSWRSNVFTCRNQSCDAQWEQSDVVIKNEGQGLLFR
FT                   CPMCGARNYVERFDADDGSVLYEQIEGRPATGPMAE"
FT   gene            33113..34516
FT                   /locus_tag="Bxe_A4436"
FT   CDS             33113..34516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4436"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4436"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28565"
FT                   /db_xref="GOA:Q147C4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C4"
FT                   /protein_id="ABE28565.1"
FT                   /translation="MNSPHTAGAPFSQLSLPPATLANLTQLGYVEMTPIQAASLPIALA
FT                   GHDLIAQAKTGSGKTAAFSLALLARLDVRNFAVQAMVLCPTRELADQVTQEIRRLARAE
FT                   ENIKVLTLCGGTPMRPQTASLEHGAHIVVGTPGRIMDHLERGSLPLQSLNTLVLDEADR
FT                   MLDMGFFDDIATVVKQCPKERQTLLFSATYPEGIVKLSQQFLRNPKEVKLAERHDNTKI
FT                   RQRFYEVTEDERLHAVGLLLNHYRPVSTLAFCNTKQQCRDLLDVLRAQGFHALALHGEL
FT                   DQRERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIGRTGR
FT                   ADQEGWALSLASMNEMGRVGSLEQAQKRDVEWHKLSELTATSNEPLLPPMETLQILGGR
FT                   KEKIRPGDVLGALTGEAGFAGSQIGKINVTEMSTYVAVERSVAREAVRKLSAGKVKGKK
FT                   VKVRLMDDA"
FT   gene            34841..35995
FT                   /locus_tag="Bxe_A4435"
FT   CDS             34841..35995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4435"
FT                   /product="2-keto-4-methylthiobutyrate aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4435"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28566"
FT                   /db_xref="GOA:Q147C3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C3"
FT                   /protein_id="ABE28566.1"
FT                   /translation="MQSAMQARSKLPDVGTTIFTVIGQLAAQYDALNLSQGAPNFAPDA
FT                   SLIDGVAQAMRAGHNQYAPMAGIAALREALADKVATLYGVHYDPASEVTVIASASEGLY
FT                   STISALVHPGDEVIYFEPSFDSYGPIVRLQGATPVAIKLSLNDFRVDWDEVAAAITPKT
FT                   RMIIINTPHNPTATVFSEADVARLKAITRNTDIVILADEVYEHVVFDGAKHQSMACHAE
FT                   LAERSVIVSSFGKSYHVTGWRVGYCLAPAALMDEIRKVHQFMVFSADTPMQYAFVDALA
FT                   RRESYLGLSAFYQKKRDLLTDALRDSRFELLPSEGSFFMLARFRGFSEESDSDFVLRLI
FT                   RDARVATIPLSAFYTDGTDSGLIRLSFSKDDATLIEGARRLCQI"
FT   gene            36117..36911
FT                   /locus_tag="Bxe_A4434"
FT   CDS             36117..36911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4434"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4434"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28567"
FT                   /db_xref="GOA:Q147C2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C2"
FT                   /protein_id="ABE28567.1"
FT                   /translation="MKLLKPLLALACAFASLAAASAVSAADTSTLRFGLEAQYPPFESK
FT                   GPNGELQGLDIDVGNAVCAAAHMTCKWVETSFDGLIPALQGRKFDAINSAMNATEQRRQ
FT                   AIDFTTVVYRVPTQLIAKRDSGLLPTTASLKGKRVGVLQSSIQETFAKAHWESAGVTVV
FT                   PYQDQNQVYTDLVAGRLDATLVLAPAGQTGFLSKPNGAGYAFVGEPVRDDRILGSGIAY
FT                   GIRKGDTALRDRLNAAIAKVQADGTVKTLATKYLGNIDVTAK"
FT   gene            complement(37085..38950)
FT                   /locus_tag="Bxe_A4433"
FT   CDS             complement(37085..38950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4433"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28568"
FT                   /db_xref="GOA:Q147C1"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C1"
FT                   /protein_id="ABE28568.1"
FT                   /translation="MNMLDRPGRRRSLWLRTLSWDLNDPRLTVAARVWVPILFGLWSLF
FT                   LGQDRNWDGFNYHQYNGFALLNGKLHTDFAPAGMQTYFNPMLDVFHYALNRAFPAPLVG
FT                   FIMGTLHGLNFVLLLSIIRRTLPGLAPEDANRAPLLLAAAGILTANFLSGLGNSMGDDT
FT                   TTLFVLASLLLVLRLWDRLPTWSTATAAALSGAGLVAGLGMGLKLTNAPFAVALCAGLL
FT                   LLPATPLARVRAAFLFGVGALAGLLAAGGYWMAVMWHTFGNPFFPQFSSIFPNPLTPPG
FT                   GVADQSWLPKSAREYVLWPLVFAFDSKRVGQARLHQIIWPVVYVLFWALAATRVAEWVR
FT                   SRPRVRRLNPRAAYVVTFVALGYFLWMILFSIYRYVVPIETLTPLVVYLLLNRLLPYLT
FT                   ARRAAAWLLCVTTVVVVAGGVETWGHERWARAAFRADVPVLESPQNTTAVIVGGDPPWG
FT                   WIVQFFPVSVAFTQIDGSFPYSPRFDRHIADIVRSRGGPTYAIIEGRYNWRVDNVAKMD
FT                   RVANAIGLTDNVKGCNTMQAAIDRLHLHASLQWTPNAADTRMCRLDLRHDDVRDVVSEN
FT                   AQLVEQARPALERHGFTVDASSCITYRAYVGQGVFPYQWCRITRR"
FT   gene            39493..40023
FT                   /locus_tag="Bxe_A4432"
FT   CDS             39493..40023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4432"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4432"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28569"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q147C0"
FT                   /protein_id="ABE28569.1"
FT                   /translation="MEQSGGAPSSPRRADSYLLPTLFDRLRDDAPHRQTEVPGEYAVTR
FT                   TQLRDIIQRDLAYLLNATNLGDLIDPQRYPLVAASTVNFGVPPLAGAFMASRKWADIEK
FT                   TIKDAIGRFEPRLIPESLRVVPRSDSDRQGRHSQVAFDIHGMVRMEPYPLEFMVQSSLD
FT                   LESSRLHVDLKRI"
FT   gene            40056..41948
FT                   /locus_tag="Bxe_A4431"
FT   CDS             40056..41948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4431"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28570"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B9"
FT                   /protein_id="ABE28570.1"
FT                   /translation="MDPRLLEYYNQELIYLRESAGEFAQAHPKIARRLGLQAGEMTDPY
FT                   VERLIESFCFMAARMRLKIDAEFPRFTQRLLEVTYPNYVAPTPSMAVAQFYPAHTKGDL
FT                   TGGFRVPRGGKLKTTTPRGEHTPCTFRTTQDVVLYPLEIVSARLTGIPPDIPGIERYVP
FT                   AHSQVCGALRLRIRTTNHEKIASLRNLDRLPVYLAGDEQVASNLFELVHTAGIASIVGE
FT                   PNGFNAPDRPFSAVTSKAVVHEGLDPDQGMLPLIWSKFHGHNLLHEYFACPSRFYFFTL
FT                   TGLQDGLGKTRGAEAEIVVLLDRAPDRLASLVDASRFALFCTPVINLFPQRLERIELAE
FT                   ASTEFHLVPKRQAPLDYEVFSVQALHAQVGNSSEKFEFRPLYQTLNNDEGNHGRYFSVR
FT                   RERRLPSDTSRRYGTRTPYIGTETFVSLVDQREAPYHEGIRYLSADAWLTNRDLPLLVP
FT                   RNGIDDFMQMESGEPIASIGLIRPPSAPRPPYAEGETAWRLIRLLNFNYLPLEDVDHRP
FT                   GGQGLRDMLRLFLSSEDTEHERQVESLLGVKTRSVTRKLPGNGPLVFGRGIECQLTVDE
FT                   TGFSGTSPYLLGLILEHYLARHVSINSFTQTELHSMQRGRITRWPVRMGTRGVA"
FT   gene            41948..42280
FT                   /pseudo
FT                   /locus_tag="Bxe_A4430"
FT   gene            42394..44568
FT                   /locus_tag="Bxe_A4429"
FT   CDS             42394..44568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4429"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4429"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28571"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B8"
FT                   /protein_id="ABE28571.1"
FT                   /translation="MLKSLTRTVTMRGAALPGTPLGEPALLLRSIQGEEVLSQIYTYTL
FT                   NCCTPLASVMPEHAAANIDLKSMIGKELTVTIELEGMGDYVPGLAGIAGAANIGAGTRE
FT                   ISGIVTKAHYVGQSNQQSHYQLILAPWIWLADQRSDFRIFQGKTVVEIIEQVFENYMYS
FT                   YQMRLSEQYPVLDYQVQYGETDFYFVQRLMAEHGIYWFFEHSDGFHRMILVDQPGAHKP
FT                   VESAAYQTLWYFPPGHKIDREYVDRFTLGGSLQSGRWTTNDFDFKKPNAVLIEQNELPQ
FT                   KTAHSNLERYEWPGDYTNPSHGEQFARLRMEEVRAHGERARGSGNVRDIVCGTTFRLEG
FT                   YPHEAANQEYLVISSSIAASEADQTTGSSEYTFKSSFLVQPATTVFRPSRKPYPKPRTS
FT                   GPQTAIVTGPPDQEIWTDQYGRVKLSFHWDRSGVKDQSSSCWIRVSYPWVGTNYGSINI
FT                   PRIGTEVIVDFENGDPDLPIVTGRVYNAASMPPWPLPAGATQSGTLSRSTKGGGYDNAN
FT                   AIRFEDMKGSEELWLHAEKDQRIEVEHDESHWVGNNRLKTIDGNETVKVNMNRTEAVAL
FT                   NETIAVGMNRSEIVGLNETVVVGVNRMITTGIDQAVQVGVNSMMTVGAMQTESIGSNYQ
FT                   LTVGSNFTSQIGNSLSQSAGQSISMTAGKMVSVNSGGTAGYSASDKLTLQCGQASISLE
FT                   SNGNITISGTSIDVQGSQHVGINGAIVDIN"
FT   gene            44699..46036
FT                   /locus_tag="Bxe_A4428"
FT   CDS             44699..46036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4428"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4428"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28572"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B7"
FT                   /protein_id="ABE28572.1"
FT                   /translation="MQFLNLTPFDTLCFGGVDLEDEQFRVVVMKVGYELLPTDVPGRFV
FT                   AQTVKEPVPLCMRDEYYGAVNESSVREESDLAHYKPRCDVIIRGSTHAPDGVAATHWNA
FT                   RIKVSSPQSSLQTVSQVAGLSAKLDLKPALDARYAERWAIPVALPEHSFDPGTSRQVLL
FT                   DKTLQVSGPREFQRHFAGWSVSTPQAATHVPLRWEHAFGGGSVVRNPRHGQDPDEVEFL
FT                   LNEVCFSNPLGCGWIEDRYADTLRKAGLKQPERLPAPQIEVPDGPTRRPVTILHPDQFD
FT                   TTNPAEFIRIAQGYGELPAGFGIVGRSWAPRLQLAGTYDEKWKDERWPLLPDDFDFGYW
FT                   NCAPRDQQIEALPADARLELWNLVDSALTPDGYLRVELPGDWPLVYIHRNDGICLPMPM
FT                   TTDTLLIDTDAMTLTLTHRFPFIEESFIERVEAHIHRPLGTPLATV"
FT   gene            46092..46448
FT                   /locus_tag="Bxe_A4427"
FT   CDS             46092..46448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4427"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28573"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B6"
FT                   /protein_id="ABE28573.1"
FT                   /translation="MATNLIARRDGGWVVISKVPDVCLTFIGAIPVPVPYPVFASLQPA
FT                   QQTTTNVNVNGDPIVVFDSSFVPMTQGGEAGTQGGIMSGTTAQKTRPLQHSNTVKCQGK
FT                   FIVRAEDLFSMNGP"
FT   gene            46582..50670
FT                   /locus_tag="Bxe_A4426"
FT   CDS             46582..50670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4426"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28574"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B5"
FT                   /protein_id="ABE28574.1"
FT                   /translation="MPRGKLTPTQVQNFLNGGSGNTFGNPTQKQLPQSQRSISNPGGKG
FT                   GVNLKPTDPDWKEHFHEIMDMFGNIPVIGSLFNAINAGVYLAEGNVASAMENLGYVVMD
FT                   LIPGAGELKSAGNIGEDIGKLAEKTGTRLTEGEAEKAGKQIAEKQAEKQAEKRAEKRAE
FT                   KQAGEQAEKDGGKAEKEKQEACRNNKGVGHPVNPITGVKFLDGEEDLDFVLPCAVPLHW
FT                   QRSYFSNLVGNGWLGQGWSLPFSLCLKRVGYSVLMVDAQGHETRLPMLAPGERKRMDST
FT                   GFEVHRETSARYRFTSADCSTQYVFASLTVGEYDGAGQNDGTLPLVAIGDRYGNHQRLL
FT                   YDEAGMPALIHDAGGRVLRLQFTALPVDEGGTVQRLQRVVLGSQALVSYEYSPEGDLVR
FT                   VRDADGQATREYRYNNHILIEHSQPGALIARYEYDQYTLDGKVLRLENNLGQTWQFRYL
FT                   PSRTEVTDALGQTRCYLFNDQKMMVGQIDAAGNATRIDVDGQGNPLRVTDPAGGVRLAT
FT                   YDARGNMTSLTDAAGRRTEIQYHPQWQRPTLIVDAMGAATRVAYDAAGNLIRRTNALGH
FT                   VTGYAYDDDGRVIRITDAHGKHRHFAYDVHGRLTSHIDCSGRATHYGWDDWGHLALVTN
FT                   AAGETTRYWRNRRGRLLRTRHADGTGEEFTYDIHGRLIAHTDAHGASTQWERAADGLPV
FT                   TRIDALGHCLRYEYDAARRLQTLTNENGAPYRFTYDTAGRLVEQQGFDGRLIRYRYDAA
FT                   GWLTEQIELGAYEDHAAADGNHPDTLRTTYERDKAGRITATTISRAGDERTERITWRYD
FT                   AAGRLIEASNDCCRLERGYDAVGRLSSETSHVAGRSLTVSYEHDALGNHIRTTLPDGRH
FT                   IDYLYYGSGHLHQISIDGEVISDIERDALHREVSRTQGELVSHYQYDLQGRHIGQQTMG
FT                   RAVSGHSAITLISRTYRYDEVGNVREMTDRQSGVHRYRYDPLGQLIESEHETFALDPAH
FT                   NILDSRDLSPVVGNRVMQFGQHRYVYDMHGNVVEKISGAHTRIRLDYSPAHRIERARVA
FT                   RNGTEERVEYGYDALGRRVFRKNASGITLFVWEGNRLLSEVRDDRTFVYVYAHNSFVPV
FT                   AQIESRNAQNGRARDDLPIRYYHTDQIGLPYESTDDAGRTQWRARYAAWGRLLGANGGH
FT                   EQMHESGRQAHQPLRFQGQYFDEETGLHYNRHRYYDPDAGRFMTQDPIGLRGGINLYRY
FT                   APNPGRWIDPLGLAVDLSLVGPHYACNLNNFPNTFQVLGHGSPGGNIADLSGETLTPSE
FT                   LGDYMREASNYRQGQPVTLYACHLGAGGKNSYAQQLSNYLGADVNAPTDVLKTIDLGDG
FT                   DVMALVANGGGWQKFSPIC"
FT   gene            complement(50862..50937)
FT                   /locus_tag="Bxe_AR0017"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(50862..50937)
FT                   /locus_tag="Bxe_AR0017"
FT                   /product="tRNA-Lys"
FT   gene            51141..51545
FT                   /locus_tag="Bxe_A4425"
FT   CDS             51141..51545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4425"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28575"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B4"
FT                   /protein_id="ABE28575.1"
FT                   /translation="MDDKEIIELLDRILAPWVRALTLTPVKVDEESATLRLPFSGGLRH
FT                   AGGVICGQVFMAAADTAMIVAISAALGGFKPMSTVSLNINFMRAVRKGDVLITARVLRM
FT                   GRNLVFGEVELFDESGNMAVHATTTYALLD"
FT   gene            51583..52461
FT                   /locus_tag="Bxe_A4424"
FT   CDS             51583..52461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4424"
FT                   /product="Putative patatin-like phospholipase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28576"
FT                   /db_xref="GOA:Q147B3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B3"
FT                   /protein_id="ABE28576.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVQPELRIRPRVITGISAGAATA
FT                   CMLYTRDSDWVMRYYEDALRHNTRNAYWGNLLRGESVFPHYRIYRQALLDIYGEKFSTL
FT                   ADAPEIRIGVSHLPRWLGARSAVAAGLIAYNIEKYVRKTLHPTLGQTLGFHPEFVRAQD
FT                   CASVEDLADLILQSSSTPPFTPVLRRNGRPVLDGGMVDNVPVGALDAEAPGYVLVMVTR
FT                   LYPRPQMFVVPHGVQQRLYVQPSRKVPISSWDYTSPSQMVHAYNLGRADGETFLERVPD
FT                   LLEAGAHEAAR"
FT   gene            complement(52547..53638)
FT                   /locus_tag="Bxe_A4423"
FT   CDS             complement(52547..53638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4423"
FT                   /product="Putative 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28577"
FT                   /db_xref="GOA:Q147B2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B2"
FT                   /protein_id="ABE28577.1"
FT                   /translation="MTWVTWWDSQHNTPFRTTEVRRKTHTMKIAILDDYQDAVRKLDCF
FT                   QLLADHEVKVFNNTVRGLGQLASRLAEVDALVLIRERTRISSQLLDKLPRLRMISQTGK
FT                   VSSHIDLAACTERGIAVLEGTGSPFAPAELTWALIMAAQRRIPQYVANLKQGAWQQSGL
FT                   KTSALPPNFGLGQVLRGQTLGIWGYGKIGRLVAGYGKAFGMNVLIWGREHSREAARADG
FT                   YGVAESREALFEQSDVLSLHLRLHDDTRGIVKQEDLMRMKPTALLVNTSRAELLDENAL
FT                   VNALSHNRPGMVAIDVYESEPILQGYSLLRMENVICTPHIGYVERESYEQYFTAAFNNI
FT                   LAFDAGDPASVANPEALQGGRRR"
FT   gene            53941..55797
FT                   /locus_tag="Bxe_A4422"
FT   CDS             53941..55797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4422"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28578"
FT                   /db_xref="GOA:Q147B1"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B1"
FT                   /protein_id="ABE28578.1"
FT                   /translation="MNHPSFEGQPTIEAPAWVKNRKLVDWVQRVAAMTKPDRIVWCDGS
FT                   QEEYDRLCAQMVEAGTLKKLNPAKRPNSYLAWSDPSDVARVEDRTFICSQQREDAGPTN
FT                   NWVAPAEMRSTLGGLFEGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVTNMRIM
FT                   TRMGRKVYDVLGEDGEFVPCVHSVGAPLAAGEKDVPWPCNATKYIVHFPESREIWSYGS
FT                   GYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPEGRKHHVAAAFPSACGKTN
FT                   FAMLIPPEGLNGWKISTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTSEKTNFNAMA
FT                   TLKENVIFTNVALTDDGDVWWEGMTDEPPAHLIDWQGKDWTPAGAKQSGRKAAHPNARF
FT                   TAPASQCPSIDADWENPAGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETT
FT                   AAAAGQQGVVRRDPFAMLPFCGYNMSDYFGHWLKTGERLEQLGAKLPKIFCVNWFRKGA
FT                   DGKFVWPGFGENMRVLSWMVGRVEGSAQGAEHAFGVSPHYEDIDWSGLNFSREQFEQVI
FT                   SVDDAAWRDELALHAELFDTLQHGLPPALTQAKRTLEGKLAA"
FT   gene            complement(55810..56088)
FT                   /locus_tag="Bxe_A4421"
FT   CDS             complement(55810..56088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28579"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B0"
FT                   /protein_id="ABE28579.1"
FT                   /translation="MKRTWNSPTTREIVCKLPAKAEILSIFVRLCALTWGTTINCSAKG
FT                   NNLLQCSFGHLSCSNRREGRVGVAESEKIAKLSAPKENRPKAVLHAK"
FT   gene            56137..57240
FT                   /locus_tag="Bxe_A4420"
FT   CDS             56137..57240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4420"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28580"
FT                   /db_xref="GOA:Q147A9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A9"
FT                   /protein_id="ABE28580.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRIVAPVVFGL
FT                   HNLAPVLQTYAERYPKVIPDVTLVDRQVDLVEEGFDVGVVIARQMRSASIVTRRLTTGC
FT                   MTVCATPAYLEKHGMPTRPEHLLEHPCLSLPSEYWGDERVFTGPEGEVRVRPSNVIVAN
FT                   NTEMLRQFALLGMGIAILPSYLIGRDMTRGRLVRLLGDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQTPNSLLGEQWIKEDGLGRSAVTTAPDSADPMPPEAFDGAEPLSRL
FT                   LDSELSPLPKTLAKTTPRTRSTVLSPL"
FT   gene            complement(57407..60073)
FT                   /locus_tag="Bxe_A4419"
FT   CDS             complement(57407..60073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4419"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4419"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28581"
FT                   /db_xref="GOA:Q147A8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A8"
FT                   /protein_id="ABE28581.1"
FT                   /translation="MSKALIIAEKPSVANDIARALGGFTKHDEYYESDEYVLSSAVGHL
FT                   LEIAAPEDYEVKRGKWSFANLPVIPPHFDLNPIAKSESRLKVLTKLLKRKDVDRLINAC
FT                   DAGREGELIFRLIAQHAKARQPVQRLWLQSMTAGAIRDGFARLRSDEEMQPLADAARCR
FT                   SEADWLVGINGTRAMTAFNSKGGGFFLTTVGRVQTPTLSIVVEREEKIRRFVPRDYWEV
FT                   KAEFVCSAGFYEGRWFDPKFKRDEFDPEKRDSRLWSLPAAETIVAACRGQIGTVTEESK
FT                   PSTQLSPALFDLTSLQREANGRFGFSAKNTLGLAQALYEKHKVLTYPRTDARALPEDYM
FT                   DTVKETLGMLKESNNYLPFAKQVLDKGWVKPNKRIFDNSKISDHFAIIPTLQAPKNLSE
FT                   PEQKLYDLVVKRFLSVFFPAAEFKVTTRITEVVGHHFKTEGKVLVEPGWLQVYGREISG
FT                   EDANLVPVQKDEKVKTDRIAAQQLVTKPPARYNEATLLSAMEGAGKLVEDDELREAMAA
FT                   KGLGTPATRAAIIEGLLGEKYLIREGRDLIPTAKAFQLMTLLRGLGVKELTAPELTGEW
FT                   EYKLSQMERGNLPRDAFMQEIARMTQTIVKRAKEYDSDTIPGDYATLETPCPNCGGQVK
FT                   ENYRRFACSKCEFSISKIPGGRQFEIPEVEELLQNKTIGPLSGFRSKMGRPFSAILKLS
FT                   FDDEIKNYKLEFDFGQDAGGEDGEPPDFSDQQPVGACPKCKGRVFEHGMSYVCENSVAN
FT                   PKTCDFRSGKVILQQEIAREQMAKLLEEGRTDLLTNFKSSRTGRNFKAFLVKQNDGKIG
FT                   FEFEKKEPSAKTVAKTAAAKAAAEAADSESEDGGAPVAVKAAPAAKKAAAKKAPATKTA
FT                   AARKAPARKTAARKTGS"
FT   gene            complement(60321..60698)
FT                   /locus_tag="Bxe_A4418"
FT   CDS             complement(60321..60698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4418"
FT                   /product="Putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28582"
FT                   /db_xref="GOA:Q147A7"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A7"
FT                   /protein_id="ABE28582.1"
FT                   /translation="MPALNLDTDQDRIAERVNEAETLFVACLCAQWCGTCREYRDAFDK
FT                   LADRHPEICFAWIDIETHADRFDDLDVENFPTILIEDSVTTRFFGTVLPHAAIVERMLS
FT                   DLTALPGVSGAPKLRPALATA"
FT   gene            complement(60788..62053)
FT                   /locus_tag="Bxe_A4417"
FT   CDS             complement(60788..62053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4417"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4417"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28583"
FT                   /db_xref="GOA:Q147A6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A6"
FT                   /protein_id="ABE28583.1"
FT                   /translation="MRTLPATDIELAAWLRLSLAPGLKPAALRLLLCAFGLPEAIFDQA
FT                   PEALAAIAGEAAARAALAPTGPEFDAQLDAVIAWREQPGNQIVTLDDPAYPPALLTMPD
FT                   PPPLLYIKGRLNLLHTRAVALVGSRSATPQGVEDAERFARELSVAGVTVISGLALGIDG
FT                   AAHRGGLEGVGSTVAVIGTGADLVYPSAHHALARQIAVQGAILSEWPLGTPARAANFPQ
FT                   RNRLIAGLVSGVVIVEAAMRSGSLITARLANEMGRDVFALPGSIHAPLSRGCHRIIKQG
FT                   AKLVETPDEVLEELGFTRREAPRAASGPAHAILWNDAGSGKAPAVNGATTVRPKPATAQ
FT                   TAETSAADSATAPNPAPAHRPVDPEAERLLTALGHSPTTLEILATRTEMEDATLQSTLL
FT                   QLELAGQVTVLPGGRFMRASHG"
FT   gene            62298..62801
FT                   /locus_tag="Bxe_A4416"
FT   CDS             62298..62801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4416"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28584"
FT                   /db_xref="GOA:Q147A5"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A5"
FT                   /protein_id="ABE28584.1"
FT                   /translation="MALLNIINYPDKRLHKIAKPVEAVNDRIRRLVKDMAETMYAAPGV
FT                   GLAATQVDVHERVIVIDVSDDHNELLTFINPEIIWSSDERKLSEEGCLSVPGIYDNVER
FT                   AEKVRVRALNEKGETFEMDCEGLLAVCIQHEMDHLMGRVFVEYLSSLKQTRIKSKMKKL
FT                   AHAM"
FT   gene            62833..63819
FT                   /locus_tag="Bxe_A4415"
FT   CDS             62833..63819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4415"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4415"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28585"
FT                   /db_xref="GOA:Q147A4"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q147A4"
FT                   /protein_id="ABE28585.1"
FT                   /translation="MSHSLRVIFAGTPEFAAAALAAIHGAGFPVPLVLTQPDRPAGRGM
FT                   KLQASPVKRYAQEHGLAVAQPPSLRRAGKYPEQAAAAIGQLRATPHDVMVVAAYGLILP
FT                   QEVLDIPPLGCINIHASLLPRWRGAAPIHRAIEAGDAETGITLMQMDVGLDTGAMISET
FT                   RTAISGDDTTATLHDRLAQDGAKLIVEALVELERTGRLAATPQPAEGVTYAEKIGKHEA
FT                   ALDWRRPAAVLARQVRAFDPFPGGVGTLEDGTSIKIWAAIPADTKAGGAPGTIAEVTPE
FT                   GVVVACGEGALRLTQLQKPGGKRLPVREFLAGSTLAVGQRFQLPEAK"
FT   gene            63933..64574
FT                   /locus_tag="Bxe_A4414"
FT   CDS             63933..64574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4414"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4414"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28586"
FT                   /db_xref="GOA:Q147A3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A3"
FT                   /protein_id="ABE28586.1"
FT                   /translation="MFGITHFEFFVVAVFLLNVTPGPDTAYIVGRSVAQGRGAGLMSAL
FT                   GISAGCCVHSLACAFGLTALLAASAAAFTVIKFAGAIYLIYLGVRLIFAKPAADQAAGE
FT                   ARAAGAPKSLRQLFLQGFWTNVLNPKVVLFFVSFFPQFVALGSDHKALAFLTLGAVFVV
FT                   MSTLWNSLVAWVAGSVTRRFSGRPLVKQWLDRGVGGAFVGLGIKLATASR"
FT   gene            64646..65536
FT                   /locus_tag="Bxe_A4413"
FT   CDS             64646..65536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4413"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28587"
FT                   /db_xref="GOA:Q147A2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A2"
FT                   /protein_id="ABE28587.1"
FT                   /translation="MNPALGQGVADMFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIA
FT                   LVIALGMNFFSYWFSDKMVLRMYNAQEVDETSAPQFYRMVRELSTRAGLPMPRVYLINE
FT                   DAPNAFATGRNPEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTVSATMAG
FT                   AISALANFAMFFGGRDENGRPTNPIASIAVALLAPIAGALIQMAISRAREFEADRGGAQ
FT                   ISGDPQALASALDKIHRYASGIPFPTAEQHPATAQMMIMNPLAGGGIANLFSTHPATEE
FT                   RIARLMEMARTGRFE"
FT   gene            65920..67293
FT                   /locus_tag="Bxe_A4412"
FT   CDS             65920..67293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4412"
FT                   /product="Fmu, rRNA SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4412"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28588"
FT                   /db_xref="GOA:Q147A1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A1"
FT                   /protein_id="ABE28588.1"
FT                   /translation="MLHLAPESLGFALDCAGQAVGAVRLGAALPAALQSVFVSAPEGSV
FT                   AAARGAVQDIAYRTMRRLATAEWLIAKLVKKAPPPHVGHVLACSLALLVDDEANAAYAP
FT                   FTVVDQAVSAIAARREFAFAKGLVNAVLRTFLRERETLLSAAQADEVARWNYPAWWIDA
FT                   VKRAWPDAWQSVLAAGNTQGPLTLRVNARRSTVDAYLQLLQNQHIAASKAGDYAVKLAT
FT                   PMPVDRIPGFTDGVVSVQDAGAQLAAQLLGVHDGMRVLDACAAPGGKTGHLLELANLQL
FT                   VALESDASRARRIGENLQRLKLEAEVRIGDAGTPAKWHDDIDQPFDRILADVPCSASGI
FT                   VRRHPDIRWLRRASDIPALVAEQRRILDALWPLVKPGGELLYVTCSIFPEEGELQAQWF
FT                   GNKYQDAVRLDAPGQLLPSVARAPADASAGSHAGQSAEDSAGANSDHDGFFYARFQKR"
FT   gene            67290..67889
FT                   /locus_tag="Bxe_A4411"
FT   CDS             67290..67889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4411"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28589"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A0"
FT                   /protein_id="ABE28589.1"
FT                   /translation="MTIKRFFPLRLAAVLWIALAVWLAAPGVAHADSIAVQRASLQADN
FT                   TGWNLDARFDFDLNSNLEDAVNKGIPLYFTTDFELSRPRWYWFDEQPVSVSQSIRLSFQ
FT                   PLTREYRVSSVSSGGLQLGFTTLKDALAVIKHITSWHVIDRNDVHAGENYTASVRMQLD
FT                   IALMPKPFQIDAVNNRDWNLASEWKRFTFTVTERAK"
FT   gene            67891..70293
FT                   /locus_tag="Bxe_A4410"
FT   CDS             67891..70293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4410"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28590"
FT                   /db_xref="GOA:Q146Z9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z9"
FT                   /protein_id="ABE28590.1"
FT                   /translation="MRSATSVSSIVVRVLVSTVAVTAVLLLVLLAAASANTEFFDRYYQ
FT                   WLYAANLAVAMIFLLVVATLVIIIIARLRKGKFGTRLLAKLAFFMALVGVVPGGIIYVV
FT                   SYQFVSRSIESWFDVNVETALTSGLNLGRGMLDASLSDLQTKGRLMSEQLASADAAGTT
FT                   LTLLRLRDQFGVQDATIVEPTRSMSGATPDMHVVAQASGNYATLVPNDLPTPLMIDQAR
FT                   GRGYAAIEGEVDGDPHAHGSKGVLRLRVVQRIPDSNASLLQPTERFLQLTQPVSPSLAR
FT                   NADAVQRAYREYQEKALGRTGLRKMYIGTLTLALFLATFIAMMLALALGNQLARPLFLL
FT                   AQGTKEITEGDYTPKREIKSRDELGFLTQSFNAMTRQLSEARAAVENNRIALEHSKAYL
FT                   ESILANLTAGVFVFDRQFRLTTANRGAERIFRQPFQAVMGSALDQIGVLSEFGGMVRKA
FT                   FADREAASGDGHDDRGHWQQQFSVQVPGETEPLTLLVRGARLVSATDRDAEDMQTSGYV
FT                   VVFDDISDVISAQRSIAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADKLSPSDADVL
FT                   KRGATTIVNQVAAMKQMVDNFRDYARTPPAVLAHLQLNDLVSEVLTLYGIEEGKGAIQV
FT                   ELAALPAIRGDATQLRQVIHNLLQNAQDAVADLEHPRVLLETRTVEYGDPDAEGKVRVA
FT                   VRLTVSDNGPGFSARILTRAFEPYVTTKAKGTGLGLAMVKKIVDEHGARIDIRNRMKAG
FT                   DVIEGAQISILFLQLADDAATPGTGPRPAHGGASQGKTKATVQTRAA"
FT   gene            70294..70983
FT                   /locus_tag="Bxe_A4409"
FT   CDS             70294..70983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4409"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28591"
FT                   /db_xref="GOA:Q146Z8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z8"
FT                   /protein_id="ABE28591.1"
FT                   /translation="MATILVVDDEMGIRELLSEILSDEGHVVEAAENAQEAREFRLRQA
FT                   PDLVLLDIWMPDTDGVTLLKEWAAQGQLTMPVIMMSGHATIDTAVEATKIGALNFLEKP
FT                   IALQKLLKAVEQGLARGNAAGAPGGAAAKPVSPVSASAVASAAALPMLSTDGLGSGALA
FT                   AQTASISFDIPLRDARDAFERAYFEYHLARENGSMTRVAEKTGLERTHLYRKLKQLGVD
FT                   LGKNKGE"
FT   gene            71102..71177
FT                   /locus_tag="Bxe_AR0018"
FT                   /note="tRNA-Phe1"
FT   tRNA            71102..71177
FT                   /locus_tag="Bxe_AR0018"
FT                   /product="tRNA-Phe"
FT   gene            complement(71231..71521)
FT                   /locus_tag="Bxe_A4408"
FT   CDS             complement(71231..71521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28592"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z7"
FT                   /protein_id="ABE28592.1"
FT                   /translation="MRHASNAARRVPALLPAQSSIGRALRMQSRWALIPLIVGRGFGAG
FT                   GGVAARHSGDALTCKSLNWRDFIMLRRTPPAAPRRAAHTSRSNGRPPCPSQ"
FT   gene            71599..72297
FT                   /locus_tag="Bxe_A4407"
FT   CDS             71599..72297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4407"
FT                   /product="preQ(0) biosynthesis protein QueC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28593"
FT                   /db_xref="GOA:Q146Z6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Z6"
FT                   /protein_id="ABE28593.1"
FT                   /translation="MLFSGGQDSATCLAWALERYETVETLGFDYGQRHRVELECREGFR
FT                   NAVVRAFPAWADRLGEDHMIDLSVLGAISDTAMTREIEIEATANGLPNTFVPGRNLMFM
FT                   TIAAAIAYRRGLQVLVGGMCETDFSGYPDCRDDTMKALQVALNLGMDTRFLLETPLMWL
FT                   DKADTWRLAHELGGAELVELVRVETHTCYLGERAELHAWGFGCGECPACRLRKRGYEAY
FT                   LAGENVTEPV"
FT   gene            72371..73003
FT                   /locus_tag="Bxe_A4406"
FT   CDS             72371..73003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4406"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28594"
FT                   /db_xref="GOA:Q146Z5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z5"
FT                   /protein_id="ABE28594.1"
FT                   /translation="MTYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAEAV
FT                   CRFCDTDFVGTDGENGGKYRTAEDLVRMIASQWPQGEGERFVVCTGGEPMLQIDQPLVD
FT                   ALHAAGFEIAIETNGSLPVLETIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLSEYA
FT                   KLDFEYFLVQPMDGPSREINTRLAIDWCKRHPQWRLSMQTHKYLNIP"
FT   gene            73010..73456
FT                   /locus_tag="Bxe_A4405"
FT   CDS             73010..73456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4405"
FT                   /product="Putative 6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28595"
FT                   /db_xref="GOA:Q146Z4"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z4"
FT                   /protein_id="ABE28595.1"
FT                   /translation="MLTITRKLEFDAGHRIPDHRSQCRNLHGHRYVLEITLQGDLVDTE
FT                   GAPDRGMVMDFADVKSLAVEHLVDKWDHAFLVYEGDTQVRGFLETMAGHKTVVLDRIPT
FT                   VENLAAVAFGILANVYDAHYGVNLRLHKLRLYETPNCWADVIRD"
FT   gene            73714..74496
FT                   /locus_tag="Bxe_A4404"
FT   CDS             73714..74496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4404"
FT                   /product="2-dehydro-3-deoxyglucarate aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4404"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28596"
FT                   /db_xref="GOA:Q146Z3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z3"
FT                   /protein_id="ABE28596.1"
FT                   /translation="MSSLTNPLKQRLKETGPLFGLWLSLGSDAAAEALAHAGYDWLLID
FT                   MEHAPNDSGDVASQLRAIAAAHLPSEPVVRVPANEAWLVKRVLDAGARTLMFPNIESAD
FT                   EAARAVRLTQYPTAGALDGERGVAGVVRAAAYGMRRDYVQTANAQIATIVQIESARGLQ
FT                   EVEKIAATPGVDCLFVGPADLAASLGHLGDSKHADVQAAMARIVSAADKAGIAAGIFAM
FT                   DVASAKQHRDAGFRFIALAADVMWMLRATRQALQEVRS"
FT   gene            74493..75194
FT                   /locus_tag="Bxe_A4403"
FT   CDS             74493..75194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4403"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28597"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z2"
FT                   /protein_id="ABE28597.1"
FT                   /translation="MKGMVQCVVVRLALTAALMANVAAYAQDRVAKSDDPETQTAVADY
FT                   NAGNLGAALAEFRKAAERGSRLAEFNYAMMLLNGEGTPANVDEGKKWLRKAADANMSHA
FT                   QYVYGKMYDDGEFVGRDPVEAHRWFLKAAQQGHVQAELALANQFLDGRGTERDNRQAFV
FT                   WYKKAAQGGDMTAQYVTGSFYERGGDGVDRNLNVARAYYAAAAAQGDPAARLKYQQLSA
FT                   QLRDQKEVKPQ"
FT   gene            complement(75294..76442)
FT                   /locus_tag="Bxe_A4402"
FT   CDS             complement(75294..76442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4402"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28598"
FT                   /db_xref="GOA:Q146Z1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z1"
FT                   /protein_id="ABE28598.1"
FT                   /translation="MQFDKRAWLDRIKRMFAGFDRPLALIVFLLLCVGIVTLYSASLDV
FT                   PGRVEDQLRNIMLTFVLMWALANVPPTTLMRFAVPLYTFGIALLVAVALFGLTRKGAKR
FT                   WINVGVVIQPSEILKIATPLMLAWYYQRREGVMRWYDFLVGLLILAVPVGLIAKQPDLG
FT                   TAVLVFAAGFFVIYFAGLSFKLIVPVLIAGVIAVGSIAAFQDKICQPEVQWPLMHDYQK
FT                   HRICTLLDPTSDPLGKGFHTIQAVIAIGSGGAFGKGWLKGTQAHLEFIPEKHTDFIFAV
FT                   FSEEFGLAGGIVLLTLYMLLIARGLYIAANGATLFGRLLAGSLTMAFFTYAFVNIGMVS
FT                   GILPVVGVPLPFMSYGGTALTTLGVAIGLIMSIARQKRLMQS"
FT   gene            complement(76453..78756)
FT                   /locus_tag="Bxe_A4401"
FT   CDS             complement(76453..78756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4401"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28599"
FT                   /db_xref="GOA:Q146Z0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z0"
FT                   /protein_id="ABE28599.1"
FT                   /translation="MTEFKDTQQQLSKFRLRVAAAGLFVFVCFGLIGFRFLFLQVWHYS
FT                   KYSLQADENRISVAPIVPNRGIITDRNGVVLAKNYSAYTLEITPSKLNDSLENVIDNLA
FT                   TVVSIDARDRRRFKKLQEDSKNFESLPIRTRLTDDEVARFTAQRFRFPGVEVRARLFRQ
FT                   YPLGPTAAHVIGYIGRISQRDQDRIDDASDQNDSDPDHYDPRLDANNYKGTDYIGKIGV
FT                   EQSYETELHGQTGFEEVEVTAGGRPVRTLSRTQATPGNNLVLSLDIGLQQVAEQAFAGR
FT                   RGALVAIEPSSGDVLAFVSAPSFDPNSFVDGIDQQTWDDLNNSPDHPLLNRPLHGTYPP
FT                   GSTYKPFMALAALTLHKRTPGWGFQDPGSYTFGGHTFRNDVRSGQGWVDMNRAIVVSND
FT                   TYFYMLAHDLGVNNIANFMKPWGFGQITGIDISGEARGILPSTEWKRKAYRKPEQQRWY
FT                   EGETISLGIGQGYNSFTILQLAHATATLANNGVVMKPHLVRDIENPITKETRPVVRDPS
FT                   DRIAVKQSDIDIIKRAMVGVVTNGTASKLFVGAPYQAAGKTGTAQVYSLQGANYKGHAI
FT                   AEHLRDHALFIAFAPAEQPKIALALIVENGGWGAEAAGPIARKVLDYYLVGKNKPGAQA
FT                   AAIEAAASATEDASAPEVGGAPAPQEAVQPVKVAAGFTALPIPGAASAAEAASAAAAAS
FT                   AASAASASASAAASAPVAASTSAAAKNPTPRKSGAPHKPRPASEPAPSAAAPSRDDGIQ
FT                   ATSPRQPVSGGIDE"
FT   gene            complement(78898..79410)
FT                   /locus_tag="Bxe_A4400"
FT   CDS             complement(78898..79410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4400"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4400"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28600"
FT                   /db_xref="GOA:Q146Y9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y9"
FT                   /protein_id="ABE28600.1"
FT                   /translation="MNRPQYILQPVNPYFISFSLAAAFLLNLMPWGRLVGVPDFVALVL
FT                   LFWNVHQPRKVGMGIAFLLGLLMDVHNASLLGEHALAYTLLSYGAITIHRRVLWMSLGV
FT                   QTFAVMPLLVVAQLVPFVIRLLTGAAFPGWGYLIDGFVEAALWPIASMLLLMPQRRPAD
FT                   PDDTRPI"
FT   gene            complement(79407..80516)
FT                   /locus_tag="Bxe_A4399"
FT   CDS             complement(79407..80516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4399"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28601"
FT                   /db_xref="GOA:Q146Y8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y8"
FT                   /protein_id="ABE28601.1"
FT                   /translation="MEYSPPPLFKQGPSALARLVFFVVLALALLISDARFKTLEIVRGV
FT                   LGAGLYPLQRAALVPRDMFVGAADLAVTSATLRSENDKLRAKDLQLSQQANTAAELAAE
FT                   NAHLRALLQLSQRSTTQSLPAEIQYDTRDPFTQKVVIGRGAQQGIQNGSPVVNEDGVIG
FT                   QVTRVFPLQAEVTLLTDKDQAVPVQVVRTGLRSVIYGTPKGDTLDLRFVPISADIQSGD
FT                   ELVTSGLDGVYPPGLPVARVVRVDKQADTAFARVICLPVAPVRGARQLLVLHYVNNVPP
FT                   RPAEEPDAATAAKDAKAKKGGKPADGKAAADKAPAKAGEKPAAEKPATARPAEKAPAKP
FT                   AAAEKKSAAEKKPAAEKNAKPQATPGAQP"
FT   gene            complement(80670..81713)
FT                   /locus_tag="Bxe_A4398"
FT   CDS             complement(80670..81713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4398"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28602"
FT                   /db_xref="GOA:Q146Y7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y7"
FT                   /protein_id="ABE28602.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYMRGKGIVLDEPSVVSIRQEG
FT                   GPNGKKTIQAVGKEAKQMLGKVPGNIEAIRPMKDGVIADFTVTEQMIKQFIKTAHESRM
FT                   FSPSPRIIICVPCGSTQVERRAIKEAAHGAGASQVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVGVISLGGIVYKGSVRVGGDKFDEAIVNYIRRNYGMLIGEQTAEAIKKE
FT                   IGSAFPGSEVKEMEVKGRNLSEGIPRSFTISSNEILEALTDPLNQIVSSVKIALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGSGMALERMDKL
FT                   GSIFSYE"
FT   gene            82093..82392
FT                   /locus_tag="Bxe_A4397"
FT   CDS             82093..82392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4397"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28603"
FT                   /db_xref="GOA:Q146Y6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Y6"
FT                   /protein_id="ABE28603.1"
FT                   /translation="MALTLTDVKRIAHLARLELADAEAEHTLVQLNDFFGLVEQMQAVD
FT                   TTGIAPLAHPIEQIEDVALRLRDDTVTETVEREAFQRPAPAVQDGLYLVPKVIE"
FT   gene            82586..84073
FT                   /locus_tag="Bxe_A4396"
FT   CDS             82586..84073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4396"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4396"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28604"
FT                   /db_xref="GOA:Q146Y5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Y5"
FT                   /protein_id="ABE28604.1"
FT                   /translation="MHEKSLTELRAALTARECSAVELAQLYLKRIEAANSLNAFIQVDP
FT                   DLTLAQAKAADALLHTGHAGPLVGLPIAHKDVFVTKGWRSTAGSKMLSNYESPFDATVV
FT                   ARLQNAGMVCVGKTNMDEFAMGSSNENSYFGPVQNPWDVKAVPGGSSGGSAAAVAARLA
FT                   PAATGTDTGGSIRQPASFSGITGIKPTYGRVSRYGMIAFASSLDQGGPMARSAADCATL
FT                   LNAMAGFDGRDSTSLVRDDEDYTRYLGQPWKEDGAGKPLAGLRIGLPKEYFGAGLADDV
FT                   RASIDAALKQYEALGATLVEVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAE
FT                   YRDLLDMYKKSRAEGFGPEVKRRILVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFR
FT                   QCDVIMGPVAPTVAWDLGAKGDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAQR
FT                   PVGLQIIGNYFNEARMLQVADAFQRATDWHRKAPAGV"
FT   gene            84079..85554
FT                   /locus_tag="Bxe_A4395"
FT   CDS             84079..85554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4395"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4395"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28605"
FT                   /db_xref="GOA:Q146Y4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Y4"
FT                   /protein_id="ABE28605.1"
FT                   /translation="MTKQWEVVIGLETHAQLSTHSKIFSGASTQFGAAPNTQACPVDLA
FT                   LPGTLPVMNRGAVERAIQFGLAIGATVAPRSIFARKNYFYPDLPKGYQISQYEIPVVQG
FT                   GQVTIQVPANEKANTPAYEKVVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEI
FT                   VTEPEMRSAAEAVAYAKTLHTLVTWLGICDGNMQEGSFRCDANVSVRPVGQAEFGTRAE
FT                   IKNLNSFRFLEEAIQYEVRRQIELIEDGGTVVQETRLYDPDKRETRSMRSKEDAHDYRY
FT                   FPDPDLMPLVIDAAWVERVKSEMPELPVAIQQRFVTQYGLTPYDANVLTSSKAMAAYYE
FT                   AVVSKLGPANAKAAANWLMGEVSSQLNREDLDIAASPVSSAQLALLLQRIADGTISHKI
FT                   AKEIFLSIWEEKATDEAATDRIIEAKGLKQISDTGALEAIIDEVLAANQKSVEEFRAGK
FT                   EKAFNALIGQAMKATKGKANPAQVNELLRKKLS"
FT   gene            85690..86529
FT                   /locus_tag="Bxe_A4394"
FT   CDS             85690..86529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4394"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28606"
FT                   /db_xref="GOA:Q146Y3"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y3"
FT                   /protein_id="ABE28606.1"
FT                   /translation="MARQPELDDFRVPYFGDGKKKNKFSLDGFDPAAKPFSAGSKDADK
FT                   TRLSEIGAKLDIQQERLHAQQQRRVLLVLQGMDTSGKDGTIRAVFHDVDPLGLRIVPFK
FT                   APTPVEMAHDFLWRVHSQAPAAGELTVFNRSHYEDLLVPTVLGNLDAQAFEQRCHHIRQ
FT                   FEALLAYSGTTIIKCMLHISKDEQRVRLQARIDDSTKHWKFDVADLDARKQWDRYQVAY
FT                   GEALAATSTEYAPWYVIPANSKTHRNVMVAELLLRTFEALKLEYPPAKESLKGIKIV"
FT   gene            86576..87355
FT                   /locus_tag="Bxe_A4393"
FT   CDS             86576..87355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4393"
FT                   /product="ExodeoxyribonucleaseIII xth"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4393"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28607"
FT                   /db_xref="GOA:Q146Y2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y2"
FT                   /protein_id="ABE28607.1"
FT                   /translation="MLRVITANLNGIRSAAKKGFFDWFGEQKADVLCVQEIKCSQDDMT
FT                   PEFMAPHDFTGYFQHAVKKGYSGAGVYTRHEPDEVVIGFGSEEFDPEGRYVELRFGKLS
FT                   VISVYVPSGSSGDERQQAKYRFMDEFMPHLAELAQEREVIVCGDVNIVHKEIDIKNWKS
FT                   NQKNSGCLPEERAWLTKLFDEVGYVDVFRTLDQRPEQYTWWSNRGQAYAKNVGWRIDYQ
FT                   IATPGIASKAKRTDVFRDIKFSDHAPLTVDYDHKLKK"
FT   gene            complement(87454..88254)
FT                   /locus_tag="Bxe_A4392"
FT   CDS             complement(87454..88254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4392"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4392"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28608"
FT                   /db_xref="GOA:Q146Y1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y1"
FT                   /protein_id="ABE28608.1"
FT                   /translation="MRYGGYLVFRNLIPSPMLEAQAAEEFNQIAYGAEHANRLYGDTDA
FT                   HVTRVRSIVDKLIPYSLKWNERAKNWKWDVAVVRSTDIRMYCLPGGKIVVYGGLLDRAR
FT                   LNDNELGMLIGHEIAHALREHARERLGQLQASQLDSSGTIPQLFGLADLGAAPLGIGSR
FT                   LLEMKYENTDETEADVIGSDIASRAGFDPRAAVTLWDKLAQATRGNREQGFIYVHPYTS
FT                   ARRQDIVKRLPDMLPLYAKAIGKTVDTLPDYAGMGRPRRKPVRD"
FT   gene            88340..88777
FT                   /locus_tag="Bxe_A4391"
FT   CDS             88340..88777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4391"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4391"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28609"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Y0"
FT                   /protein_id="ABE28609.1"
FT                   /translation="MTGAGGVDGADEGGVAAAGALPALAALLAPGAADVALSWLAAPAA
FT                   GFAAGVAEVAGDGADIAAGALVAAAGMAVAWAFNGAANVRLTLPSAHTARSAARPTVRA
FT                   GRRDRVERNTPIGRRAFTTAPSTAQCAAEAPCRATPARYKR"
FT   gene            complement(88701..90095)
FT                   /locus_tag="Bxe_A4390"
FT   CDS             complement(88701..90095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4390"
FT                   /product="putative major facilitator superfamily
FT                   (MFS)muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4390"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28610"
FT                   /db_xref="GOA:Q146X9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X9"
FT                   /protein_id="ABE28610.1"
FT                   /translation="MSNPPHEAPALTAHEEHPGWRAFLNTRMLICVFLGFTSGLPLFTL
FT                   VYLVQAWLRSEGVNLKEIGLFALIQFPYTWKFIWAPLMDRYVPRFPGWRPGRRRGWMLV
FT                   TQILVAGAIATLGFVSPKESIWTVAALTALVAFFGASQDIVIDAYRRELLSDTQQGLGN
FT                   AVHVNAYKIAALVPGSLALILSDHLPWSTVFIVTAAFMLPGMVMTLVVHEPAVHGTPPR
FT                   NLREAIVQPFKEFIQRDGWRGALFVLGFIFLYKLGDTMATTLSTSFFLDIGFSRTQIGV
FT                   IAKTTAFGASLAGGIVGGIWLMKIGIGRGLWIFGILQMVSTLGFAWLAHLGPASPGLVA
FT                   IYDIAVWLSQGTTKLLALVGVDWAVQLEPRSVALALVYGFETFATGLTMAAFTAYIAST
FT                   TDPRYTATQFALFTSLASVPRTLASAASGYVVAQIGWFDYFIVCTALALPGMVLLLRIA
FT                   PWRAQS"
FT   gene            complement(90110..90718)
FT                   /locus_tag="Bxe_A4389"
FT   CDS             complement(90110..90718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4389"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4389"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28611"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X8"
FT                   /protein_id="ABE28611.1"
FT                   /translation="MNQRALDYLALRPDFRAIARWVEPRATVLDLGCGDGSLLSLLSEE
FT                   LDVLGYGIEINDAGVLASTQNGVNVIQQNLEDGLRLFEDGSFDFAILSQTLQTIHQTAA
FT                   ILRETVRVGKECIVSFPNFGYWAHRLSVLRGRMPVSKSLPYQWHNTPNVRVLTIEDFEA
FT                   LAPEVGIEILDRVVLHEGQVVRWGVNWRGSLAVYRVKKS"
FT   gene            complement(90715..91860)
FT                   /locus_tag="Bxe_A4388"
FT   CDS             complement(90715..91860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4388"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28612"
FT                   /db_xref="GOA:Q146X7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146X7"
FT                   /protein_id="ABE28612.1"
FT                   /translation="MESIGIVAPQKMHFTEPLPLQNGSSLAGYDLMVETYGTLNAARSN
FT                   AVLVCHALNASHHVAGVYADNPRDIGWWDNMVGPGKPLDTDKFFVIGVNNLGSCFGSTG
FT                   PMSIDPSTGNPYGATFPVVTVEDWVNAQARVADQFGITRFAAVMGGSLGGMQALAWSMM
FT                   YPERVAHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHNVKPKRGLRVARM
FT                   IGHITYLSDDDMAEKFGRSLRRAEGALDAYNFNFDVEFEVESYLRYQGDKFADYFDANT
FT                   YLLITRALDYFDPAKAFAGDLTAAVAHTTAKYLIASFTTDWRFAPARSRELVKALLDHK
FT                   RTVTYAEIDAPHGHDAFLLDDARYHNLMRAYYERIANEVNA"
FT   gene            complement(92179..92778)
FT                   /locus_tag="Bxe_A4387"
FT   CDS             complement(92179..92778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4387"
FT                   /product="cell division inhibitor SlmA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4387"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28613"
FT                   /db_xref="GOA:Q146X6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X6"
FT                   /protein_id="ABE28613.1"
FT                   /translation="MHILQTLAAMLETPKSEKITTAALAARLGVSEAALYRHFASKAQM
FT                   FEGLIEFIEQTIFGLINQIADKESNGVLQARAIALMLLNFPAKNPGMTRVLTCEALVGE
FT                   HERLTERVNQMLERVEASLKQCLRLAQMEANAGASPADGTIAQHDTVPLPANYDPAIRA
FT                   SLLLSYIIGRWHRYVRSGFARPPAEHADAQLLLILQ"
FT   gene            complement(92847..93650)
FT                   /locus_tag="Bxe_A4386"
FT   CDS             complement(92847..93650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4386"
FT                   /product="HAD-superfamily hydrolase, subfamily IA,
FT                   variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28614"
FT                   /db_xref="GOA:Q146X5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X5"
FT                   /protein_id="ABE28614.1"
FT                   /translation="MRTPTSRRHRPHIAGGRPVWLFDLDNTLHHASHAIFPAINHGMTQ
FT                   YIIDALQVDLEEANRLRTGYTQRYGAALLGLTRHHPLDANDFLKVVHTFPDLGSMIRHE
FT                   RGVARLVAALPGRKIVLTNAPEAYARAVLAELRIERLFEQVIAIEHMRDRRLWRAKPDH
FT                   AMLRKAMRDAHVSLKDVILVEDTRSHLKNYRRLGIRTVWITGHLPRKPHADGVPTRLPG
FT                   TGRPHYVDRTIRSLKSLRLSTRSVRLKRQQTGRQPCSRSTSLTKS"
FT   gene            complement(93865..94764)
FT                   /locus_tag="Bxe_A4385"
FT   CDS             complement(93865..94764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4385"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28615"
FT                   /db_xref="GOA:Q146X4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146X4"
FT                   /protein_id="ABE28615.1"
FT                   /translation="MSELPDLSQIAPTLKAEILAEALPYIRQYHGKTVVIKYGGNAMTE
FT                   ERLKQGFARDVILLKLVGINPVIVHGGGPQIDQALKKIGKQGTFIQGMRVTDEETMEVV
FT                   EWVLGGEVQQDIVTLINHFGGHAVGLTGKDGGLIHARKMLMPDRDNPGQYVDIGQVGEV
FT                   EAINPAVVKALQDDAFIPVISPIGFGEDGLSYNINADLVAGKLAVVLNAEKLVMMTNIP
FT                   GVMDKEGNLLTDLSAREIDGLFADGTISGGMLPKISSALDAAKSGVRSVHIIDGRIEHS
FT                   VLLEILTEQPFGTMIRSH"
FT   gene            complement(95295..96935)
FT                   /locus_tag="Bxe_A4384"
FT   CDS             complement(95295..96935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28616"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X3"
FT                   /protein_id="ABE28616.1"
FT                   /translation="MLPTSSGEADASSAFLTVLREAAAARHDGTAQTEAGCLDAAARLH
FT                   PLDDASLASLTATLLEQHRLGDAIELAAIIAQLDPHRALAHFRHGYALQIANRHGEAIA
FT                   PYRRALAIDPRLPCLRSNLAGALAHVGGDLNEQIALLECAVRDEPGEGDGWTNLTNAYR
FT                   MNRDLPRALEAGVKAVQCAPHSPLAHNNYALTLREAQRWSEAERAAQTACALGPNDPAL
FT                   RSNLSMLQLIRADYEHGWASHEARWDGSAELGGNRPVMPAPLWRGEPLAGKTLLVWGEQ
FT                   GMGDVLQFCRYIPMLAGRVHREGGRLVWNSFPQMGALLARSLGAHADEFSAGGGVESLP
FT                   AFDYEIPLLSLPLIFDTREETIPAATAPYLHADPAAIRSWQKRLAGESRLKVGLTWTGS
FT                   HSHQRNPFRRVGWERYAAYFGGMQDVAFYSLQPGATDEVAAARAAGLSMTDCTAEFTSF
FT                   DDTAAFVGALDLVITVCTSAAHLSGALGQRTWVLLDVNPHWVWLLDRRDSPWYPGATLY
FT                   RQPRFGEWEPALAAVARDLKALAGERRAA"
FT   gene            97065..98375
FT                   /locus_tag="Bxe_A4383"
FT   CDS             97065..98375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4383"
FT                   /product="Periplasmic Sensor Signal Transduction Histidine
FT                   Kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28617"
FT                   /db_xref="GOA:Q146X2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X2"
FT                   /protein_id="ABE28617.1"
FT                   /translation="MHRITNTGRVNLGHLFWLRSLAIIGQLMTIAFVQTFIGVQLPLPA
FT                   MLLVIALEVIFNGLTWWRVSQQRPESNMELFGQIWVDLGALSALLFLSGGTTNPFVSLY
FT                   LPSLAIAAAVLPWHLMAWLAAFAVACYAVLGFDSVPLNLDNPANLFDYYRAGMWVNFMV
FT                   SVGLIAWFVARMSGALRLRDAALGDAQQRLLHDERAVALGVQAATVAHEIGTPLSTIAM
FT                   LSEELRDAARSDKGLAPYTADLELLEQQMALCTSALARLRSRASTSASRQPVGEWLESF
FT                   GEQWRLRHPHVKFERLGMPPAEVSLDDTVAVSQILTILLDNAARASRDHVTLSCSLAAR
FT                   GDQIVFEVCDAGSGIPAALRGSLGAMPVESTQGGHGVGLYLAFAAAARLKGSIELTDVS
FT                   AIKPRGTRAVLKLPLAARKFFGSGRHGAEPSNTEKQV"
FT   gene            98372..98914
FT                   /locus_tag="Bxe_A4382"
FT   CDS             98372..98914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4382"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28618"
FT                   /db_xref="GOA:Q146X1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q146X1"
FT                   /protein_id="ABE28618.1"
FT                   /translation="MSEMNFLVIDDDEVFSGILARGLTRRGYMVSEAHNADEAIKLANQ
FT                   QKFSQITVDLHLGNDSGLTLVAPLRDLQPDARMLVLTGYASIATAVQAVKDGADNYLAK
FT                   PANVETILSALQSEASALQAEEAIEHPTPLSVARLEWEHIQRVLAEHGGNISATARALN
FT                   MHRRTLQRKLAKRPVKQ"
FT   gene            complement(99064..100410)
FT                   /locus_tag="Bxe_A4381"
FT   CDS             complement(99064..100410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4381"
FT                   /product="Heat shock protein HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4381"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28619"
FT                   /db_xref="GOA:Q146X0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146X0"
FT                   /protein_id="ABE28619.1"
FT                   /translation="MSTMTPAEIVSELDKHIIGQGRAKKAVAVALRNRWRRQQVEEPLR
FT                   QEITPKNILMIGPTGVGKTEIARRLAKLADAPFIKIEATKFTEVGYVGRDVDSIVRDLI
FT                   EISVKQTRETEMRKVRTKAEDQAEDRILDILLPSARPVGFGASSGAADTVDEGSTTRQT
FT                   FRKRLREGLLDDKEVELDVEQPQVGMDIMGPPGMEDMTEQIRSMFANIGGGKKTRRKMK
FT                   VKEALKALTDEEAARMLNDEEVKTKAVQNVEQNGIVFLDEIDKIASRNEAGGGEVSRQG
FT                   VQRDLLPLVEGTTINTKYGMVKTDHILFIASGAFHLAKPSDLIPELQGRFPIRVELDSL
FT                   SVNDFESILVSTDASLVKQYQALLATEDVHLEFADDGIRRLAEIAYAVNEKTENIGARR
FT                   LYTVIEKLLEEVSFAAGNHSGRTVQIDAAYVDRALNEVAEDEDLSRYVL"
FT   gene            complement(100420..100956)
FT                   /locus_tag="Bxe_A4380"
FT   CDS             complement(100420..100956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4380"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4380"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28620"
FT                   /db_xref="GOA:Q146W9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146W9"
FT                   /protein_id="ABE28620.1"
FT                   /translation="MEQFHGTTIVSVRRGDKVALGGDGQVTLGNIVMKGGAKKVRRIYN
FT                   GKVMVGFAGGTADAFSLLDRFEAKLEKHQGNLTRAAVELAKDWRTDRMLRRLEAMLIAA
FT                   DATTTLVITGNGDVLDPEGGICAIGSGGAYAQAAAKALADNTELSPREIVEKSLEIAGD
FT                   MCIYTNHNRVIETIE"
FT   gene            complement(101289..101708)
FT                   /locus_tag="Bxe_A4379"
FT   CDS             complement(101289..101708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4379"
FT                   /product="Transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4379"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28621"
FT                   /db_xref="GOA:Q146W8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W8"
FT                   /protein_id="ABE28621.1"
FT                   /translation="MTTKRLLTEAEILKMSDKDYMNEDQLAFFKNKLEQLQADILRNAG
FT                   QTTENLRETVIVPDPADRATIEEEHALELRTRDRERKLLKKVQQSIARIDSGEYGWCEE
FT                   TGEPIGIPRLLARPTATLSLEAQERRELRQKLFGD"
FT   gene            101909..102265
FT                   /locus_tag="Bxe_A4378"
FT   CDS             101909..102265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4378"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28622"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W7"
FT                   /protein_id="ABE28622.1"
FT                   /translation="MLLRYCLPATGLFRLCQPALSAYCPDKIFRRRFRPGAGYALTGQF
FT                   VLILQWARIVTESQSGTATGENPPAARRYPENITRARPKSDGRARFNTAGFSRVFHTRA
FT                   FSTGFRPPPAIFSR"
FT   gene            complement(102386..103477)
FT                   /locus_tag="Bxe_A4377"
FT   CDS             complement(102386..103477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4377"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4377"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28623"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W6"
FT                   /protein_id="ABE28623.1"
FT                   /translation="MIPVTILTGFLGSGKTTLLKRILNEKHGMKIAVIENEFGEENIDN
FT                   EILVQDTGEQIIQMSNGCICCTIRGDLSRVLGDLAAQKQAGTLDFDRVVIETTGLANPG
FT                   PVAQTFFMDDQIANEFLLDAIITLVDAKHANHQLDEHEVVQRQVGFADRLFITKSDLVD
FT                   EKHLADLRHRLLHMNPRAAIKVVNFGEADIKEIFDLRGFNLNSKLEIDPDFLVEDEHAH
FT                   SHAHAHDEHGHTHDDHANCDHDHGHCDHEGHDHGHHHHHAHHDDKIKSFVYRNDRPFDP
FT                   NKLEDFLGGILQIYGERLLRYKGVLYMKGVDRKVVFQGVHQMMGSDLAAKWQPIEKKTN
FT                   KMVFIGIELPQDLITDGLDACLV"
FT   gene            complement(103667..104869)
FT                   /locus_tag="Bxe_A4376"
FT   CDS             complement(103667..104869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4376"
FT                   /product="23S rRNA m(5)C-1962 methyltransferase /
FT                   SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4376"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28624"
FT                   /db_xref="GOA:Q146W5"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W5"
FT                   /protein_id="ABE28624.1"
FT                   /translation="MNTVTLKPSKEKSLLRRHPWVYANAIDRIDGNPAPGATVLVRAHD
FT                   GRFLARAAYSPHSQIRARVWSFDETEPIDHAFFKRRVQRALAHRQTMVHDTGAVRLIFG
FT                   EADGLPGLIVDHYVAEDEGQRSQLVCQFMAAGVEAWKEAIVAALTGATGCPNVYERSDV
FT                   SIRQKEGLEQITGVLAGEPPSEALIVSENDVRYHVDVRNGHKTGFYVDQRDNRPLVQQL
FT                   AQDRDMLNCFCYTGGFSLAALKGGAKRVVSIDSSGDALAIAQQNVAANGFDAERATWLD
FT                   ADAFKTLRRLYDDGERFDLVVLDPPKFAPSREHVDRASRAYKDINLTGLKLLRPGGLLF
FT                   TYSCSGAIDSELFQKIISGAAADARVDARILKRLGAGMDHPLLTAFPEGEYLKGLLLQI
FT                   A"
FT   gene            complement(104965..105888)
FT                   /locus_tag="Bxe_A4375"
FT   CDS             complement(104965..105888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4375"
FT                   /product="Putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28625"
FT                   /db_xref="GOA:Q146W4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W4"
FT                   /protein_id="ABE28625.1"
FT                   /translation="MTAADPIAAYLSNLEHERRLSAHTLRGYTHELEELKLLAKGRPLE
FT                   SLSAVDIRGAVSRAHAGGLTARSISHRLSAWRAFYRWLAGRVDLPANPVATVRAPKQPK
FT                   TLPKALSVDDATRLMESPPAASPEGLRDHAMLELFYSSGLRLAELVGLDARFADADGYR
FT                   SAGWIKLDSAEVEVLGKGNRRRVVPVGSKALEALAAWLAVRDQMVKHDPHPLFLSARGN
FT                   RLSPNVVRERVKRAALVAGIPANVHPHVLRHSFATHVLQSSGDLRAVQELLGHASITAT
FT                   QVYTALDFQHLAHVYDQAHPRAKKRD"
FT   gene            complement(105930..106652)
FT                   /locus_tag="Bxe_A4374"
FT   CDS             complement(105930..106652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4374"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28626"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W3"
FT                   /protein_id="ABE28626.1"
FT                   /translation="MNDREVAEYLLANPEFFADHAEMLATIRLANPHGKAAVSLQERQM
FT                   EMLRDKNKHLERRLAELLRYGHENDSIASKFNRWTIRVIAERDPYALPRTIATGLRDIF
FT                   DVPQAALRVWDVAEPYTQADFARHVGEEVRIFAGSLTTPYCGANTGFEAAQWLAPSGAS
FT                   GGDESAAGQAGPESAHATESIALLALRDPEGNEEAPTFGLLVMGSPDARRFHEGMATDF
FT                   LTQIGALASAALSRLLPR"
FT   gene            complement(106734..107597)
FT                   /locus_tag="Bxe_A4373"
FT   CDS             complement(106734..107597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4373"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28627"
FT                   /db_xref="GOA:Q146W2"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146W2"
FT                   /protein_id="ABE28627.1"
FT                   /translation="MKLKFTKMHGAGNDFVVLDGYTQPVNLTPAQVRALADRHFGVGAD
FT                   QLLLVEKPTVAGVDFRYRIFNCDGGEVEHCGNGARCFVKFVRERGLTDQRSVRVQVQKG
FT                   TITLTMQENGEVLVDMGTPVFDPERVPFATKGLEGRREGADTLWPLDVSGTTRWISVVS
FT                   MGNPHAVQVVGDVEAFPVLAEGPVIERHARFPQRVNAGFMQIVGRNEIRLRVYERGAGE
FT                   TLACGTGACAAVAAGIRRGLLDSPVRVHTHGGDLTISWDSTREGEPLLMAGPAVTVFEG
FT                   EIELPD"
FT   gene            complement(107696..108580)
FT                   /locus_tag="Bxe_A4372"
FT   CDS             complement(107696..108580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4372"
FT                   /product="Putative lipid A biosynthesis
FT                   lauroylacyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4372"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28628"
FT                   /db_xref="GOA:Q146W1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q146W1"
FT                   /protein_id="ABE28628.1"
FT                   /translation="MLSRYGAKLAIGLLKLFALLPYGLIARFGDGLGWLLYQIPSRRKR
FT                   IVHINLKLCFPEWSDERREDVAQKHFRHAIRSYLERSVQWFGSAKKLEKLIQLDSAIDL
FT                   TDPNLPPTLFLGFHFVGIEAGSIFLNYSLRRQCGSLYQPMSNPELEAVAKAARARFGAD
FT                   MASRADSARIVLRWLRERKPVMLGADMDYGARNSTFVPFFGVPTCTLTAVGRLAKVGHA
FT                   QVVPFIGEVLPNYKGYRLKVFKPWENYPTGDDDADARRMNAFLEEQIPLMPEQYYWVHK
FT                   RFKTRPPGDPSVY"
FT   gene            108858..110048
FT                   /locus_tag="Bxe_A4371"
FT   CDS             108858..110048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4371"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4371"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28629"
FT                   /db_xref="GOA:Q146W0"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146W0"
FT                   /protein_id="ABE28629.1"
FT                   /translation="MANDYLFTSESVSEGHPDKVADQISDAILDAILAQDKYSRVAAET
FT                   LCNTGLVVLAGEITTTANVDYIQVARNTIKRIGYDNTDYGIDYRGCAVLVAYDKQSPDI
FT                   AQGVDRAHDNNLDQGAGDQGLMFGYACEETPELMPLPIHLSHRLVERQANLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSIDTVVLSTQHSPDIDLGTLREAVIEEVIKPTLPADLIKG
FT                   DIKFLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYA
FT                   GRYVAKNIVAAGLASRCLIQVSYAIGVAQPTSVMVNTFGTGRVSDAVITRLVQEHFDLR
FT                   PKGIIQMLDLLRPIYEKSAAYGHFGREEPEFTWESTDKALALAEAAGTEPVAALAE"
FT   gene            complement(110251..110661)
FT                   /locus_tag="Bxe_A4370"
FT   CDS             complement(110251..110661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4370"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28630"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V9"
FT                   /protein_id="ABE28630.1"
FT                   /translation="MAHTPSRDTLPTSEAMHTLLSTPLTRAALKAARPARRHVVRALRH
FT                   HATRTRALGEQWRDAKAVDGIRTWFNTFFSALRLQGSSRRFSLRTLLRKPTPLRLAAPR
FT                   AAVAVPQNSSRRPRRMSTNGSTGWFAFAFASR"
FT   gene            111078..111839
FT                   /locus_tag="Bxe_A4369"
FT   CDS             111078..111839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4369"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28631"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V8"
FT                   /protein_id="ABE28631.1"
FT                   /translation="MSLHSKKEQIQTLREQGFVVVPGLVSAGRCEELKQIAQRQLEEAA
FT                   APIEFEADLQYPGAPESRQAAGGHTVRRLLDAYARHPGFARWATAPEIRGWMELYFGEE
FT                   PRLSRAHHNCMMTKHPAYGSLTGWHRDVRYWSFERDDLVSVWLALGSETVDNGALWMVP
FT                   KSHSAAFTSDRFDQAKFFRSDLEENQEWIRTAVSPELKAGDVVFFHCNTLHSAGKNITD
FT                   QVKFSLVYTYHGASNVPLPGTRSAAKPEVAF"
FT   gene            complement(111929..112135)
FT                   /locus_tag="Bxe_A4368"
FT   CDS             complement(111929..112135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28632"
FT                   /db_xref="InterPro:IPR021521"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V7"
FT                   /protein_id="ABE28632.1"
FT                   /translation="MTKAISIALIVGGIVLLYFGGQAFNSVSSDVSRVFTGSPTNKAIL
FT                   LLVGGVAATIAGLTGMALSGRKR"
FT   gene            112352..113395
FT                   /locus_tag="Bxe_A4367"
FT   CDS             112352..113395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4367"
FT                   /product="Putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28633"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V6"
FT                   /protein_id="ABE28633.1"
FT                   /translation="MAYEAASERYSDMQYRVCGKSGLKLPALSLGLWHNFGDTTPISTQ
FT                   RDILRTAFDLGITHFDLANNYGPPYGSAETNFGRLFKDDFKPYRDELLISSKAGWDMWP
FT                   GPYGQGGGSRKYVLASLDKSLQRMGLDYVDIFYSHRFDAETPLEETAGALASAVQQGKA
FT                   LYIGISSYSASKTLEMAKLLAEYKVPLLIHQPSYNMLNRWIEHELLGALEKAGAGAIAF
FT                   TPLAQGLLTSKYLNGVPEDARVNKPGGGSLKQEHLSPQNIEHVRKLNDIAQRRGQSLAQ
FT                   MALAWALRDPRVTSVLIGASRAEQVRENVGALKNLAFSKDELAEIDRYATEGGINLWEK
FT                   PSTDQAI"
FT   gene            complement(113457..113642)
FT                   /locus_tag="Bxe_A4366"
FT   CDS             complement(113457..113642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4366"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28634"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V5"
FT                   /protein_id="ABE28634.1"
FT                   /translation="MTTYFTIGDFILVIPMALAGALFVGALPCKTEFRHNALRVLGALI
FT                   GVVFAVVLVEGLPALV"
FT   gene            complement(113912..115132)
FT                   /locus_tag="Bxe_A4365"
FT   CDS             complement(113912..115132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4365"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4365"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28635"
FT                   /db_xref="GOA:Q146V4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V4"
FT                   /protein_id="ABE28635.1"
FT                   /translation="MQPASPVPDIPYLERGTRAYWRASIALLFAGYATFSLLYCVQPLL
FT                   PSFSAAFNVTPAQSSLSLSLTTAALALAVFVAGFISEGWSRHKLMTLSLTISALATIGV
FT                   SIAPHWHQLLVLRTLEGLALGGVPAVAMAYLAEEVHPDGLGLAMGLYVGGTAIGGMAGR
FT                   VITGVVADLFSWRVAIGTIGVLGLLSMLAFRALLPPSRHFVPRRGLGFTHHRTALLRQF
FT                   TRPGLPLLFLLGFVLMGSFVTLYNYIGYRLLAPPYRLDQTEIGAIFVVYLTGVVASPWS
FT                   GRMADTFGRARVLTASLLLMAFGLALTMLHPLTAIAAGIACVTFGFFAGHSVASGWVGR
FT                   LAKDAKGQAAALYLLAYYIGSSVVGSYGGHMWTSYGWNGVAGLVGALLVIGLIAAARLR
FT                   KREQPLA"
FT   gene            complement(115383..116912)
FT                   /locus_tag="Bxe_A4364"
FT   CDS             complement(115383..116912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4364"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28636"
FT                   /db_xref="GOA:Q146V3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V3"
FT                   /protein_id="ABE28636.1"
FT                   /translation="MNAPASRRRFVVRPLRRVSLHACALTLASACALTACTVGPDYVKP
FT                   TATTAATYKELDGTGWKPAQPADTFARGAWWSVYADPSLDALEQQVASANQNVQAAEAR
FT                   FRAARATVAQYRSSFFPLVSATGAYSRARSSENVLHKSTAGLTLNDYLVQADASWEPDL
FT                   WGRVSRSVEGAKAEAQASAADTQAALLSMQAELATDYFELRGLDQERQLLDDTIEAYRQ
FT                   ALELTQHRYTGGIATDADVAQAQTQLKTTQAQALDLGVQRAQLEHAIAILIGQPPSTFA
FT                   LPVAPLAAVPVVAAAGVPSALLERRPDIAAAERRVAGMNAQIGVATAAFFPNLVLSVTG
FT                   GLEATNYSQWLLAPSRLWSLGPTLAGTLLDFGGRASVKEQARAHYDESVAQYRQTVLTA
FT                   FGQVEDNLAALRVLEQEASAQDDAVTAAQRALAVVSDRYRNGAITYLDVVVAQTTALTN
FT                   ERDAVSIARRRMAASVALIKALGGGWDESALPTDEQIVHPSPPASDAAAHG"
FT   gene            complement(116909..118312)
FT                   /locus_tag="Bxe_A4363"
FT   CDS             complement(116909..118312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4363"
FT                   /product="RND efflux pump, membrane fusion protein, CzcB
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4363"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28637"
FT                   /db_xref="GOA:Q146V2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V2"
FT                   /protein_id="ABE28637.1"
FT                   /translation="MEGQRPDSSGTTRDPAKTKRARWIAVAVAVAVIALAAQGIWSRHD
FT                   AHAALERDAEHASQTSVEVVRPQKSTAGLDLVLPGNVQAFLDTPIYARTNGYLKKWYAD
FT                   IGAKVKNGQLLAEIDTPEVDDQLRAARADLANAEANYALAKSTAARWTEMLKSKSVSKQ
FT                   ETDEKVGDMLAKKATLDAARFNVARLEKTQSFQKVYAPFDGIVTARNVDVGALIDAGSS
FT                   GGPAKELFHVAQADRLRVYVNVPQAYAQQVRARQTAFLTLTETPSRHYPGTVARTAGAV
FT                   DPQQRTMLVEVDVDNRNGDLLPGAYAQVHFELGTGAAPFTLPGNALLFRPDGVKLATVD
FT                   AQHKVKLIAVSLGTDFGTRVAIASGLQGDEQVILNPQDSIIDGAPVRIVAAKAGTATGA
FT                   SGATGASGSAAGGEGTAGASGAAASRDGAASASGAAAGNDRAAGGSNAVAADTPTTHVA
FT                   ASLSVKASS"
FT   gene            complement(118431..121613)
FT                   /locus_tag="Bxe_A4362"
FT   CDS             complement(118431..121613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4362"
FT                   /product="cation/multidrug efflux pump, AcrB/AcrD/AcrF
FT                   family, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28638"
FT                   /db_xref="GOA:Q146V1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V1"
FT                   /protein_id="ABE28638.1"
FT                   /translation="MWIVRLALRRPYTFVVLALLLLIVGPLTILRTPTDIFPNIDIPVL
FT                   SVIWSYNGLPADEMEKRIVLNYERGLSTAVNDIEHTESTSLNGIAVVKIFFQPHANIDE
FT                   ALAQVTALSQTQLRSLPPGITPPNILRYNASTVPILRLALSSASLTEQELYDFGNNFLK
FT                   TQLATVPGASAPLPYGGKQRQIMVDIDSRKLQERNLSPMDVVNAVTAQNLILPSGTAKI
FT                   GSTEYSVEMNGSPDSLAGLNNIPIQSTANGTVYIRDVAHVRDGFQPQTNIVRVNGQRAA
FT                   LLTINKSGNTSTLEIVDRIKTMMPTLRNLVPASLNIDPVADQSLFVRASVQGVLREALI
FT                   AACLTGLMILLFLGNWRATLIIAVSIPLSMITSIIALSLLGETINIMTLGGLALAVGIL
FT                   VDDATVAIENISHQLEQGKTLEQAILDGAHQIAIPTLVSTLSICIVFVPMFLLTGVAHY
FT                   LFIPLAEAVVFAMLASYFFSRTLVPTLAKYLLRYHHKAADLHHAPTQTRNPFMRAHYAF
FT                   EGGFERLRERYRVFLEARVARPGLFVTLFLVCCGASMLLMPFLGRDFFPAVDAGTIALH
FT                   LRAKTGMRVEETAVVTDRVDTRIRQLIPAGELHSIIDNIGLPVSGINLSYSNTGTIGTS
FT                   DADVLITLNPDHHPSANYVRTLRRTLTDEFPGVQFAFLPADIVSQTLNFGMPSPIDIQI
FT                   VGREVAANRVFAAKLLNRLRTVPGLADARIQQPADLPRIFIDVDRTRAQQAGFSQRDIA
FT                   SNLLITLSGSQQTTPTFWLNPRNGVSYNVITEAPQYTIDSLQSLANIPLNANGRSNILG
FT                   SLATMKREAGNATLTHYNAQTTIDIFGTADGRDLGGVSDDIRKIIDDVKADLPRSSTIE
FT                   VRGQVQTMNDSFSGLFAGLVFAILLVYLLIVVNFQSWLDPFIIVTALPGALAGIVWMLF
FT                   LTHTTLSIPALTGAIMCIGIATANSILVISFAREQLLEHGDAARAAIEAGFTRFRPVLM
FT                   TALAMVIGMVPMAIGLGEGGEQNAPLGRAVIGGLTIGTLATLIFVPVVFSMIYRRLAAR
FT                   RLRAAEHVVQKP"
FT   gene            122066..122278
FT                   /locus_tag="Bxe_A4361"
FT   CDS             122066..122278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4361"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28639"
FT                   /db_xref="UniProtKB/TrEMBL:Q146V0"
FT                   /protein_id="ABE28639.1"
FT                   /translation="MQIGSIVRSVHIAVPQGARGIVMRILGDMAMVAWYAGEPGASLQL
FT                   NTEPFFLEDLIDTGELVRPSSAQMH"
FT   gene            122332..123411
FT                   /locus_tag="Bxe_A4360"
FT   CDS             122332..123411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4360"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4360"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28640"
FT                   /db_xref="GOA:Q146U9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U9"
FT                   /protein_id="ABE28640.1"
FT                   /translation="MCVVTLVFDGGAAHNAGMNDDILDPQDGANSAVPFARLKPEIVLD
FT                   ALDGVLSTVGVRTDGRMLPLNSYENRVYQVGVEDGPPVVAKFYRPERWSDAAILEEHAF
FT                   VADLASREIPAVPARVFEGRTLHSFDGFRFSIFERRGGRAPDLDRPDTLEWLGRFIGRI
FT                   HAVGQTQNYVERPTLDIHTFGYEPRDFLLAHRFVPDNLRTAWETVVNLALEGVERAFER
FT                   AGDIRMLRMHGDCHPSNVLWTDAGPHFVDFDDSRMGPAVQDLWLLLPGERAEASRALAD
FT                   LLAGYEDFCDFEPRELYLVEALRTLRLIHYQAWLARRWDDPAFPAAFPWFNTQRYWEDR
FT                   ILELREQIGAMQEGPLWPV"
FT   gene            complement(123449..125350)
FT                   /locus_tag="Bxe_A4359"
FT   CDS             complement(123449..125350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4359"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28641"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U8"
FT                   /protein_id="ABE28641.1"
FT                   /translation="MRLSSLVCLASFGWLAGIHGAGASVAARLDDPYTNEGETQTFTVN
FT                   ADGSYSKLDSMTLLVNNEAGVARVAQQYVWFNRNMADVQIIEAYTITADGVRHDVQPDQ
FT                   IRDVQEARSFDAPMFQDIQEKVIVFPAVEPGARVHLTYRKTQKQPIVPGQFSDFTPPDL
FT                   APTHNFRLIYDLPAGKPLYADARGFTVVQPVTREGRTRYEYRYDKAHFSRLERGSVAYV
FT                   SYGDRLMVSTFPDYAAFAATYRESAADPSAHDAAVTRLAQQLTAHDRTPRDKAKTLYDW
FT                   VRRNVRYVAINVGRGAVVPHGASAVLANRYGDCKDHVALYGALLDAAGVRNEPALISSG
FT                   TIYTLPSVPGYGVINHIITWLPDLQQYADSTASNVEFGFLPPSDMNRPTVLVGEGVLSR
FT                   TPATALLTRSTDLSIKVEPDGSASFTYRLEAAGASAEQTRAMLRTQTPAQREESIQAEL
FT                   RSANLRGTATLTTNDLTVADGPLTITMKGRLESLVVPGAAASIPALTSLAGGFEADTRY
FT                   WLGERQRTQPFICRNQALHERARIELPANFRVLDVPEAKRTQDRFVDFQSQYTFDPQSN
FT                   VVTMTRDGATHFDSDVCTPDDFAQMRPTIEAIGRDVRAEVIVKSTLAEPSSVASQAP"
FT   gene            125679..126419
FT                   /locus_tag="Bxe_A4358"
FT   CDS             125679..126419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4358"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28642"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U7"
FT                   /protein_id="ABE28642.1"
FT                   /translation="MNAPDSIDMKPAAGHGTQYTAHTRGPGRHLMDDAEQAARRQRSRR
FT                   ANFIKWLRKVHGWVGLWGAVLGLLFGATGFLLNHRGGPLKVSSGEPQVEQMQIPVPQEP
FT                   LRSPVEMAKWLTAELKIDGKPGRTKREPAHPVAWGDRSTMQPEFWQVGIMGPSQSVQAE
FT                   YWVGNGFVAVKRTQNSFLSTMNNLHKGVGLSVGWVLLIDTIAGSMILLSLTGVLLWTEL
FT                   NRRRVVGVVLVGGSVIAAVVCGLM"
FT   gene            complement(126514..127536)
FT                   /locus_tag="Bxe_A4357"
FT   CDS             complement(126514..127536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4357"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis /
FT                   predicted sulfurylase large subunit, molybdopterin cytosine
FT                   dinucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4357"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28643"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U6"
FT                   /protein_id="ABE28643.1"
FT                   /translation="MDSVDLEVLKSSARWLEEGHRALLVTVVKTWGSSPRPEGAMLAVR
FT                   DDGLVVGSVSGGCIEDDLIDRVRQRGIEQTLPEAVKYGITAEEAHRFGLPCGGTIQLVL
FT                   EPLTLQSGIAELCGAVENGRLVAREMDMATGTARLDNAQATDGVHFDGARLLTIHGPRY
FT                   RMLVIGAGQLSRYLCHIAVGLDYQVTVCDPREEYTEEWNIPGTKIVRTMPDDTVIEMKL
FT                   DERCAVIALTHDPKLDDLALMEALKTPAFYVGALGSRRNNQARRERLKEFDLNDTELGR
FT                   LHGPVGIYIGSRTPPEIAVSILAEVTAAKNGVSLPTLLQVEGAKAAREIAASGGTACSV
FT                   "
FT   gene            complement(127509..128207)
FT                   /locus_tag="Bxe_A4356"
FT   CDS             complement(127509..128207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4356"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4356"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28644"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U5"
FT                   /protein_id="ABE28644.1"
FT                   /translation="MELTETHTLPVSQQSAWEALNDTDMLRACIPGCESIDPDGENAYL
FT                   VALSAAVGPVKARFKGRMQLTDIDAPNSYSIVFEGQGGAAGFAKGNAHVSLEADGEAAT
FT                   RLSYTAHAQVGGKLAQIGSRLVDGAARKIAGEFFKRFGARLGGAEAEAEAGGGGGGGGG
FT                   GGGGGGGGGGGGGGGGGGGADGAAAPGAGGNAADQTVPHNTASTDAADGESGGDATKRK
FT                   KSWTAWISKS"
FT   gene            complement(128198..129577)
FT                   /locus_tag="Bxe_A4355"
FT   CDS             complement(128198..129577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4355"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4355"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28645"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U4"
FT                   /protein_id="ABE28645.1"
FT                   /translation="MANSFDAGNGGASAQSARLDAGNSDASGDLSRADRPGRRVVASSS
FT                   SGKSAATPLDGTPTLARNVVHFVRLLRGAGLPMSPAQAVDALAALHWIDLGRRDDVRAA
FT                   LAASLVSAPDERDLFNAAFDLFWRDPDWEGKLRALLLPKVRDGLPPPKRNNRLADALAV
FT                   RAPPSAHNKAPQETGQHELHAHVTFSAEERLRHRDFDTLSADEWRTLRHLIRGQRLPLA
FT                   TEPTRRLKAASHGTHADLRASARHAVRAGGDWTVWKYRAVVERKPPLVLLLDISGSMSS
FT                   YSRAVLYFCHALLQSRERLQVFLFGTRLTNATRALRERDPDVAMAALTEQVVDWSGGTR
FT                   IGAALAEFNRRWARRVLTGRATVLLVTDGLDHEAIDVLDTEMARLHRFAHRIVWLNPLL
FT                   RFSGFSPKARGVQAILPYVDAHRPVHNLDSLTAFGRDLAQLTRAPRRSVGARAAGATSW
FT                   N"
FT   gene            complement(129583..130470)
FT                   /locus_tag="Bxe_A4354"
FT   CDS             complement(129583..130470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4354"
FT                   /product="Putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4354"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28646"
FT                   /db_xref="GOA:Q146U3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U3"
FT                   /protein_id="ABE28646.1"
FT                   /translation="MQPASIDDTLTQLAAQRYFASRELATALYLALRMERPLFVEGEPG
FT                   VGKTELAKAAAGMLGTSMLRLQCYEGLDTASALYEWDYPRQIMALRLAEAAGEHPDNDT
FT                   LYRGEFLLKRPLLQALMPDENHPGARRVLLIDEIDRADEPFEAFLLELLSDFQVSIPEY
FT                   GTVRAEQPPLVVMTSNRTREVHDALKRRCLYQWIGYPERDRELEIVAARAPQTSAELQR
FT                   RAVDFVHRLRGMDLFKAPGIAETIDWCRALEALSVTELDPQSVHDTLGVLLKYQDDLAR
FT                   VDAAQIAHCLAAPG"
FT   gene            complement(130597..131394)
FT                   /locus_tag="Bxe_A4353"
FT   CDS             complement(130597..131394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4353"
FT                   /product="Putative carbon monoxide dehydrogenase, medium
FT                   subunit (CoxM)"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4353"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28647"
FT                   /db_xref="GOA:Q146U2"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U2"
FT                   /protein_id="ABE28647.1"
FT                   /translation="MYSFEYQRATDPKAAAASLTADSDAKFLAGGQSLLPTMRLRLAQP
FT                   SQLIDVTRIPALKSITVDGKTVTIGAAVCHADVADHAELRRVSPALADLAAHIGDRQVR
FT                   ALGTIGGSLANNDPAACYPAAAMALDATIVTDRRRITSGDFFVGMYETALAPDELIVAV
FT                   EFPVPERAAYEKFRNPASHFALVGVFVAKFASGVRVAVTGAAASVFRVPELESALSANF
FT                   APEAARAVTVSGADLNTDMHASAEYRAHLIPVLAARAVTKANA"
FT   gene            complement(131417..133798)
FT                   /gene="coxL1"
FT                   /locus_tag="Bxe_A4352"
FT   CDS             complement(131417..133798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL1"
FT                   /locus_tag="Bxe_A4352"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="Citation: Appl. Environ. Microbiol. 69 (12),7257-
FT                   7265 (2003)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4352"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28648"
FT                   /db_xref="GOA:Q146U1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U1"
FT                   /protein_id="ABE28648.1"
FT                   /translation="MNAPETHLIGASVERKEDYRFLTGNGQYTDDIVLPQQTYAVFLRS
FT                   PYAHAKINTIDTTAAKQSPGVVAIFTGADMAADNVGGLPCGWLIHSTDGKPMNEPPHPV
FT                   IAHTKVRHVGDQVALVIADSIKAAKDAAELIEVDYDVLPAVVDTAHAADAGQPAVHDEV
FT                   PDNVCYNWGHGDKAATDAAFAKAAHVTTLDIVNNRLIPNAIEPRAVNASYSAQDDSYTL
FT                   YVANQNPHVERLLMAAFVLSLPESKLRVIAPDVGGGFGSKIFLYAEDVALTWASKKIRR
FT                   PVKWTAERSEAFVSDAHGRDHVTKAELALDADGRFLAMRIHTTANMGAYLSTFASSVPT
FT                   ILYATLLAGQYATPAIYAEVKAVFTNTVPVDAYRGAGRPEATYVVERLVETAARELKLD
FT                   PAEIRRRNFIREFPYATPVGLTYDTGDYETILARSLELADVKGFAARRQESEKNGKLRG
FT                   LGYSCYIEACGLAPSNIAGALGARAGLFEVGQIRVHPTGSVTVFTGSHSHGQGHETTFA
FT                   QVVAERLGIALESVEIVHGDTGRIPFGMGTYGSRSIAVGGSAIMKALDKIETKAKKIAA
FT                   HLLEAAAEDIEFKDGVFRVAGTDRTKAFAEISLAAYVPHNYPLDVLEPGLEESAFYDPT
FT                   NFTYPSGAYICEIEVDPDTGVCRIQQFTAVDDFGNVINPMIVEGQVHGGLAQGIGQAML
FT                   ERCVYDNESGQLLSGSYMDYAMPHASDLPDFTVETAKGTPCTHNPLGVKGCGEAGAIGS
FT                   PPAVINAILDALAPLGVTDLQMPATPHRVWSAIHAAKQAH"
FT   gene            complement(133809..134339)
FT                   /locus_tag="Bxe_A4351"
FT   CDS             complement(133809..134339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4351"
FT                   /product="Putative carbon-monoxide dehydrogenase, small
FT                   subunit (CoxS)"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28649"
FT                   /db_xref="GOA:Q146U0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:Q146U0"
FT                   /protein_id="ABE28649.1"
FT                   /translation="MAISISLTVNGAPISASIDPGTLLVQFLREQLRLTGTHVGCDTAQ
FT                   CGACTVHLNGRAIKSCNILAVQADGAKITTIEGLAKDGTLHPMQAAFKHCHGLQCGFCT
FT                   PGMVMSAVSLVQRQPDLTGDDVRAQLDGNLCRCTGYHNIVKAVLEGAEGMKSTGTANAA
FT                   ANATAQANAPATA"
FT   gene            134694..135833
FT                   /locus_tag="Bxe_A4350"
FT   CDS             134694..135833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4350"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4350"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28650"
FT                   /db_xref="GOA:Q13U47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q13U47"
FT                   /protein_id="ABE28650.1"
FT                   /translation="MPWNPRDTMNLRLEFVQLASQEGANRRELCRRFGISPKTGYKWLD
FT                   RHAKGGDTALTDHSRRPQQSPARTPPSVEQRVVELRRAHPAWGGRKISRRLCDLGQTDV
FT                   PAPSTVTDILHRHGLIEPAASAAATAWQRFEHAQPNDLWQMDFKGWFDLQDGRHCSPLT
FT                   MLDDHSRYNVTLDACISTDTRIVQHHLERTFRRYGLPLRINADNGSPWGSPSQPGQLTE
FT                   LAIWLIRLGVRLSHSRVAHPQTNGKEERFHRTLKAEVIAGRHFRDLRSAQQAFDEWRSV
FT                   YNHQRPHQALDMATPVTRYRPSPRAYPESLPPIEYGANDHVQYVKWNGELRFRKQRFKV
FT                   SSALHNLPVAIRERVGEENCYDLFFAHHRFGTINLSPQE"
FT   gene            complement(136660..137799)
FT                   /locus_tag="Bxe_A4349"
FT   CDS             complement(136660..137799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4349"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4349"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28651"
FT                   /db_xref="GOA:Q13U47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q13U47"
FT                   /protein_id="ABE28651.1"
FT                   /translation="MPWNPRDTMNLRLEFVQLASQEGANRRELCRRFGISPKTGYKWLD
FT                   RHAKGGDTALTDHSRRPQQSPARTPPSVEQRVVELRRAHPAWGGRKISRRLCDLGQTDV
FT                   PAPSTVTDILHRHGLIEPAASAAATAWQRFEHAQPNDLWQMDFKGWFDLQDGRHCSPLT
FT                   MLDDHSRYNVTLDACISTDTRIVQHHLERTFRRYGLPLRINADNGSPWGSPSQPGQLTE
FT                   LAIWLIRLGVRLSHSRVAHPQTNGKEERFHRTLKAEVIAGRHFRDLRSAQQAFDEWRSV
FT                   YNHQRPHQALDMATPVTRYRPSPRAYPESLPPIEYGANDHVQYVKWNGELRFRKQRFKV
FT                   SSALHNLPVAIRERVGEENCYDLFFAHHRFGTINLSPQE"
FT   gene            complement(138005..139396)
FT                   /locus_tag="Bxe_A4348"
FT   CDS             complement(138005..139396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4348"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4348"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28652"
FT                   /db_xref="GOA:Q146T7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T7"
FT                   /protein_id="ABE28652.1"
FT                   /translation="MSLFRKKSVEHMIAASAQNAGLKKALGALDLTFLGVGAIIGTGIF
FT                   VLTGTGAVQAGPALMISFLIAALACGFAALAYAEFASTIPVAGSIYTYSYATLGELAAW
FT                   IIGWDLMLEYGLATSAVSVGWSGYLQSLLSGFGVSLPVALTAAPGALPGHDTLFNLPAF
FT                   LVMMAITALLSFGVRESARINNIMVAIKVIVVLLVICVGVFHVTPANWHPFMPNGWNGV
FT                   FGAAAVMFFAFIGFDSVSSAAEEVKNPKRDLPIGIIASLGVCAVLYVAVAAVVTGIVPS
FT                   AQFANISHPVSYALQVAGQKWVAGFIDLGAVLGMLTVILVMAYGQTRVIFAMSRDGLLP
FT                   ARLSRVHPRFATPFFTTWLVGIFFGLIGAVVPLNVLAELINIGTLAAFSMVSIAVLVLR
FT                   KTHPELPRAFRCPGVPVVPVLAVASCLFLMINLQAVTWVAFVVWLLVGMVVYFGYSRRH
FT                   SRLSS"
FT   gene            complement(139700..140356)
FT                   /locus_tag="Bxe_A4347"
FT   CDS             complement(139700..140356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4347"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4347"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28653"
FT                   /db_xref="GOA:Q146T6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T6"
FT                   /protein_id="ABE28653.1"
FT                   /translation="MSLRILLVDDHAVVRQGVRQLLLDRGVAREVTEAQSGAEALDAVA
FT                   RFSYDVVLLDISLPDMNGVEVLKRLKRKAPRVAVLMFSMYREDQYAVRALKAGAAGYLS
FT                   KTVDATQMIGALQQVAAGRKYVSPAMAEALADYVSFDGEQMPHEKLSDREYQTLCMLAS
FT                   GKRLTDIAVALSLSVKTVSVYRTRLLEKMKLRNNAELTFYVMSNRLIDLNPAMAG"
FT   gene            complement(140367..141233)
FT                   /locus_tag="Bxe_A4346"
FT   CDS             complement(140367..141233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4346"
FT                   /product="Putative signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28654"
FT                   /db_xref="GOA:Q146T5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T5"
FT                   /protein_id="ABE28654.1"
FT                   /translation="MDTSTVVPFAAHLPASSAREGSGASAAPASSTHLEIERLRARVRE
FT                   LSAELVRAQEAACRHVARELHDGVGAELTATRFALAGVETWLPADAPPQCAAALAVANR
FT                   SLDAACEASRQAVAELHAPSLEAGIVGALAHWSGDFAARTQLRTSFICAADVRLTRLPA
FT                   DAALAVFRVAQEALNNIAKHARAESADVRIETSRRHLTLIVTDDGIGVTRNAGGRHGHF
FT                   GLSGMQARCAAFDGTLRVSARRADAERNGDDSGNGTQSRGTIVRARFAWDAMLAHAPRA
FT                   RRHALQS"
FT   gene            complement(141668..142438)
FT                   /locus_tag="Bxe_A4345"
FT   CDS             complement(141668..142438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4345"
FT                   /product="Ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4345"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28655"
FT                   /db_xref="GOA:Q146T4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T4"
FT                   /protein_id="ABE28655.1"
FT                   /translation="MSNLNSQTVLSVHHWTDTLFSFTCTRDPSFRFENGQFTMVGLEVD
FT                   GKPLIRAYSLASANYEEHLEFLSIKVQDGPLTSRLQHLKVGDEVLIGKKPVGTLVADNL
FT                   LPGKTLWLLSTGTGLAPFMSIIKDPDIYDRYERVVLTHTCRFVDELAYKEYITDHLPAH
FT                   EHLGELVQEKLLYYPTVTREAFQNRGRITELIETEKLFADLGVPGFSLENDRVMLCGSP
FT                   HMLRDTRKLLDDLGFQEGSNNAPGHYVVEKAFVG"
FT   gene            complement(142530..142814)
FT                   /locus_tag="Bxe_A4344"
FT   CDS             complement(142530..142814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4344"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28656"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T3"
FT                   /protein_id="ABE28656.1"
FT                   /translation="MLQRMAGFGIILKMLPARRACPAHAGQPMAAAVRGFRSSPYLPKR
FT                   GRIHANVLRGARFYRPPVPTLPGSVTRLTTLNRRAGATGSRRGKIADCA"
FT   gene            complement(143119..144078)
FT                   /locus_tag="Bxe_A4343"
FT   CDS             complement(143119..144078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4343"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28657"
FT                   /db_xref="GOA:Q146T2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T2"
FT                   /protein_id="ABE28657.1"
FT                   /translation="MKKNLPILLALAALVVFGLVRYEHFGSAYNITSFWRYNSMFALIS
FT                   VGMAFVIITGGIDLSVGTVAALASVVAALTSVYGGWVAALAGCAAGLAVGVLNGLIITR
FT                   LKILPFIVTLATSLGAHGVALLLGKNDAVSISAESNFGNFGQGDLFGLPIPGIVAVVAA
FT                   LAGWLALRSTRFGRHSLAIGGSEEAARLMGLNVDRTLVMAYAVSGLLAGMAGVILAAQF
FT                   GAGQPNEGVGWELFAISAVVLGGTLLTGGEGSIAMTIAGVLLLGLVFNLLNFENGLGFI
FT                   SLSAYWQSVIRGVFLLLVIVLQARVLKQRGKKRVAAPA"
FT   gene            complement(144125..145096)
FT                   /locus_tag="Bxe_A4342"
FT   CDS             complement(144125..145096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4342"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4342"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28658"
FT                   /db_xref="GOA:Q146T1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T1"
FT                   /protein_id="ABE28658.1"
FT                   /translation="MTAAPRATAATTVRKWRHLAMQREVIVLLAMVLFNLFFTPHFWSL
FT                   QTFNVNMTQVVTIVIVGIGMTLVVATGGIDLSVGASMAISGALAPMLFLNIAGPGGIAL
FT                   AFVLPVLAAALCGVFNGLLVTRLSVQPIVATLVLFIAGRGIAQVVTDGSLQAFNTPAFQ
FT                   WIALGKVAGVPFQVLLMLALVALFVWVVRKTLFGQYLLITGGNEKAAYLCGVPTATVKL
FT                   IAYTLCAALAGLAGLISISVNSSSDANVVGLGVELDAIAAVAVGGTALTGGKAYIGGTL
FT                   IGALIIQLLRYTLLAHGIPDAAALVVKAGIIVAAVYVQRRSR"
FT   gene            complement(145152..146786)
FT                   /locus_tag="Bxe_A4341"
FT   CDS             complement(145152..146786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4341"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28659"
FT                   /db_xref="GOA:Q146T0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146T0"
FT                   /protein_id="ABE28659.1"
FT                   /translation="MTESGKETPHSPLTRSPLLDMQDIGISFGGVPALRGAHLSVAAGE
FT                   VHALIGQNGAGKSTMIKILTGAYRRGSGSVRFEGREVDFRTPKQAREAGISTIYQEINL
FT                   VPFRSVAENIFLGREPRRFGLIDWRAVQQRAAALLESFGLQIDVKKPVGRYSTAIQQMV
FT                   ALARAVSSDAKMVIMDESTSSLDEREVELLFTVVRKLRDDGRAVIFVSHRLDELYALCD
FT                   RVTVMRDGQTVAQSAMAEMDKLQLVTTMLGRTLAAVVQEDAEAREANLARRGKQMIAAT
FT                   HLSAHPKVSDVSLEVHAGEAVGLAGLLGSGRTETMRLMFGADPLERGSLAIGGENVALK
FT                   SPQDAISRGLAYLTEDRKAEGIVPELSVRDNLTLVCLRTLAKNGVVDVKKQQAIVDRFI
FT                   ASLGIKLRSPDQPIRELSGGNQQKVLLARWLAAEPSLLLLDEPTRGIDVGAKADVAKIV
FT                   RESRDAGLAVLLSASELEELTAVADRAVVIRDGRTVAELNGADMSETAIMDAIAYGSDG
FT                   HSPLADAAQTATAAHIEDALEGDRHGA"
FT   gene            complement(147164..148183)
FT                   /locus_tag="Bxe_A4340"
FT   CDS             complement(147164..148183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4340"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4340"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28660"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S9"
FT                   /protein_id="ABE28660.1"
FT                   /translation="MASLNTQSRSHVRKQQIRPLAGSLLALAIGFGVATAHADDALPKL
FT                   PSKTPLKVGFAQTESNNPWRLAETKSFKDVAAKCGWQLVLTDANSSNSKQVSDIQNMIA
FT                   QHVDLLVFPPREEKPLAPIVLQAKKAGIPVILVDRDVDQSVAKAGRDYITFIGSDFIDQ
FT                   GHRAADWLVKATGGKAKIIELEGTTGASAANDRKKGFDEIIAKNPGMTIIASQSGDFAR
FT                   DKGRQVMETLLQAHPDVTAVYAHNDEMALGAIAAIKAAGKQPGKDIQIVTIDGTKGGMD
FT                   AIAAGELGASVQSSPFFGPLACDVAQRYAKGEKIPTWVKVSDKFYDKSNVQQNMQYGY"
FT   gene            complement(148298..149419)
FT                   /locus_tag="Bxe_A4339"
FT   CDS             complement(148298..149419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4339"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4339"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28661"
FT                   /db_xref="GOA:Q146S8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S8"
FT                   /protein_id="ABE28661.1"
FT                   /translation="MPQFQRRCSAARTMKKSTQRRPTMTDIAKLTGVSQSTVSLVLNNA
FT                   TGAKFSEATRNKVLKAAHDLGYRLSLREPVSASSDERNLIVYLADEISTSPHPVVNVDG
FT                   ARDAAYASGKMLAVYSTHGNADIEKQVLDATLSNPHVFGVIYATVYTRKVTPPVALSQV
FT                   PTVLLNCYTGEGGFSSVVPAEVAGGHLATDYLLQAGHRRIGYINGEPWQDASKDRLKGY
FT                   RTALATADLPFAPEMVRDGDWSSGLGFELTLSLMREPNPPTAIFCANDLTAIGAIEALK
FT                   QLGLRVPEDVSVLGYDDQEIARHTHPPLSTVVLPNYELGRWAVETLLQEEHNRAAGAPV
FT                   RHRMVKLDGPLVERASVRVITEAKKPITNIISD"
FT   gene            149750..150682
FT                   /locus_tag="Bxe_A4338"
FT   CDS             149750..150682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4338"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4338"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28662"
FT                   /db_xref="GOA:Q146S7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S7"
FT                   /protein_id="ABE28662.1"
FT                   /translation="MWLDDPAIVATVVTLSAGAQRVVIAPEVGGALAAFYETTPDGPLH
FT                   WLRPAAPAAFAERDPLRMASFPLLPYCNRIRDARFEFDGGTIDLAGNDARFAHALHGNA
FT                   WRHPWQVGARTESSVELHFEHEPDSRLRGDWPFRYRAQQRIELSGGALHITLSAQNLAA
FT                   RPMPFGMGHHPYYPRTAQTRVYAEVGAMWHADADVLPTHLGPHPAVAALREGMSADAFD
FT                   LDNNFANWSREATIAWPDEHRRLTMIADAPFDHMVVFAPANEAQLCVEPVTNTTDCFNA
FT                   VGMREQVGGCVLQPGEKIAATVKWTPHKN"
FT   gene            complement(150725..151522)
FT                   /locus_tag="Bxe_A4337"
FT   CDS             complement(150725..151522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4337"
FT                   /product="Putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4337"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28663"
FT                   /db_xref="GOA:Q146S6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S6"
FT                   /protein_id="ABE28663.1"
FT                   /translation="MRNPEELIRESVAPKDFIAVSWNLHKGRTPLGFQAWQAMQRWVQS
FT                   THADAYFLQEAMARRMPAPVLASSFGAPLADPLSDVWHCQATEIARALELEIALGPNVF
FT                   KPSWRHGNAILSPHPLDLGGRWDISAHRFEKRGLLVARATFGGHSVTLLCAHLALTRSA
FT                   RLRQMNWIAHWIAKEAPQGPLVLAGDFNDWRNDSVPLFREHGLQEVATLLGESGRTFPA
FT                   FSPALALDKMFVRGMKPVEWIQPTQETAWLSDHLPYMARLRLE"
FT   gene            complement(151611..152147)
FT                   /locus_tag="Bxe_A4336"
FT   CDS             complement(151611..152147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4336"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28664"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S5"
FT                   /protein_id="ABE28664.1"
FT                   /translation="MWKTSIVAVLLGTSLLANAQQSAQGTQQNTPPRPAQQVVQWQLQV
FT                   MRDGQQIDAFDGTTTVGQARTDTHHKIVQHNVGCKDQPGGSIDLARTLTVSPLLADASG
FT                   VTLSIEAQETFEEDAARQTDTGCKLPPQPRQVSASHPGLKVAPGQWASWTIVDKDPNLV
FT                   YRVRASLADSANTAN"
FT   gene            152417..153394
FT                   /locus_tag="Bxe_A4335"
FT   CDS             152417..153394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4335"
FT                   /product="Putative ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4335"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28665"
FT                   /db_xref="GOA:Q146S4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S4"
FT                   /protein_id="ABE28665.1"
FT                   /translation="MTTAMVKQEIAVASFSRVYDLDQVETALNDLGEGANEALRATYEK
FT                   MLKTGNLRFCVKPNRMPSIDDLIDALPNFSAPLDDIRKQVALCLETEDRLELMPILLLG
FT                   DPGIGKTHFARQLARLLGTAYQYVAMSSLTAGWILSGASSQWKNAKPGKVFDALVNGSY
FT                   ANPVIAVDEIDKATGDSQYDPLGALYALLEHDTAQTFIDEFAEIPINAGHVIWIATAND
FT                   ERSIPEPILNRMNVYEIPAPDRDGARRIAQAIYDGIRSAHNWGLRFPEVLGDAALDALM
FT                   RASPREMRRAILNGFGAARIDGRDRIEAGDIHLDFGNRRKPIGF"
FT   gene            153781..154887
FT                   /locus_tag="Bxe_A4334"
FT   CDS             153781..154887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4334"
FT                   /product="Putative FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28666"
FT                   /db_xref="GOA:Q146S3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S3"
FT                   /protein_id="ABE28666.1"
FT                   /translation="MDQIECVVIGAGVVGLAVARALAARGREVIVLEAAEAIGVGTSSR
FT                   NSEVIHAGIYYPRGSLKAALCVRGREMLYDYCVERKVPHSRCGKLLVATSRNQIPQLEN
FT                   IMAKGRDNGVLDLMRITGDQAQALEPALECVEAVFSPQTGIVDSHQFMLALQGDAERDG
FT                   AVCAFHAPVQGIEASNGRFNIQVGGDAPTTISAACVINSAGLQANALARKIRGLDARHV
FT                   PPLYLARGNYFSISGRAPFSRLIYPMPNEAGLGVHLTIDLGGQARFGPDVEWVDAINYD
FT                   VDPRRAESFYAAIRAYWPALPDNALQPAYAGIRPKLSGPGEPAADFLIQGPAAHGVRGL
FT                   VNLFGIESPGLTASLAIAQRVCELSGRA"
FT   gene            155118..155429
FT                   /locus_tag="Bxe_A4333"
FT   CDS             155118..155429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4333"
FT                   /product="Putative high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4333"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28667"
FT                   /db_xref="GOA:Q146S2"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S2"
FT                   /protein_id="ABE28667.1"
FT                   /translation="MKSSRRTFLITSIGVASTFALSRQAFADAPKVSESDPTAQALGYK
FT                   EDASKVDKAKFAKYAAGQDCGNCSFFQGKPTDAYAPCPMFAGKQVAAKGWCSAYNKKA"
FT   gene            155684..156976
FT                   /locus_tag="Bxe_A4332"
FT   CDS             155684..156976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4332"
FT                   /product="Major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4332"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28668"
FT                   /db_xref="GOA:Q146S1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S1"
FT                   /protein_id="ABE28668.1"
FT                   /translation="MTPASRSLHTRAVVAAVIGNALEWYDFTVFGFLTVVIAQLFFPAG
FT                   NDYASLLLTTATFGVAFVMRPIGGIVFGLYADRAGRKAALSLVIALMTLGILVLAIAPP
FT                   YSAIGIGAPLMIVVGRLLQGFSAGGEFGSSTALLIEAAPFSKRGFYGSWQMASQAAALL
FT                   LGSLMGALITRGLSPEALKSWGWRVPFILGLIIGPIGFYIRRNLADSEAFLLAQKTARR
FT                   ATLGEVFRSHSRDVLCGLGSVIALTVTIYVLISYLPTFAVHQLKLPYAQSFYAVIVGNL
FT                   LLTVLSPLTGAWSDRIGRKGLSLWSLVITLVIIYPLFVWLAAEPSVSKLILVQALLSIT
FT                   LSGYYGPFGALIAELFPANVRSIGLSLAYNIAVMVFGGFGPFIVTWLIDTTGSPLAPTY
FT                   YVMGGLALSIVAVACIPGKRHADLDAQRKPA"
FT   gene            complement(157153..158721)
FT                   /locus_tag="Bxe_A4331"
FT   CDS             complement(157153..158721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4331"
FT                   /product="Amidase"
FT                   /EC_number="3.5.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4331"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28669"
FT                   /db_xref="GOA:Q146S0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:Q146S0"
FT                   /protein_id="ABE28669.1"
FT                   /translation="MQNHADPEFDTEGPSVVHSDYLAHDATGLAELIRKREASARELLD
FT                   IAISRTEAVNPAINAVVLKDYDAARLRASRDDANRAANGAHRVESESAQTALAGVPYLI
FT                   KDLGAPVAGLRMAMGSRHYRHFIPAQDAPVVTLVKAAGLNIFGKTSTSELGQMPYTEPE
FT                   LFGACRNPWNLDHTPGGSSGGAAAAVAAGIVPLAHASDGGGSIRIPASCCGLFGLKPSR
FT                   GRVPRATAAAAGELGVDHAVSRSVRDSALLLDLLAGNADRPPGAPGTFLSASREPCKPL
FT                   NIAYVTEPMLAPSLSADSRAALDDAAQLASSLGHNIEPVSLGIDFAAVRHAFLTLWSVT
FT                   AEDLVLNAERISGRKPLRAEFEISTWAMAHVGRKLGERGLPAALEEQRRITERLTDLLN
FT                   RYDVILCATLAAPPIKIGEMQPTSAERMQMRAVTAMPLEALMKKVLAEASNKAFTWAGC
FT                   TELFNLSGQPAMSVPLYWTARGLPVGVQFAAREGGEAMLLRLATQLETARPWFDRRPPL
FT                   MQARN"
FT   gene            complement(158943..159641)
FT                   /locus_tag="Bxe_A4330"
FT   CDS             complement(158943..159641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4330"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4330"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28670"
FT                   /db_xref="GOA:Q146R9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R9"
FT                   /protein_id="ABE28670.1"
FT                   /translation="MSTTSRWIDIPAGKDSFGGYLALPKGGKGPAVIIIQEIFGVNSHI
FT                   RSVADQYAQDGYIALAPDVFWRVQPRVELTYEGADREKGIELMQKTNVDQAVADIGAAA
FT                   AALRAMPEVTGKIAAIGYCFGGRLAYLAAAQGTLDAAVAYYGGGIQNQLDEAAKIKVPM
FT                   QFHYGELDAHIPVSAIGQIQERFAGRTDAEFHIYPNADHGFNCSDRASYNQRAAALAHG
FT                   RTLTFLGERL"
FT   gene            159653..159898
FT                   /locus_tag="Bxe_A4329"
FT   CDS             159653..159898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4329"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28671"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R8"
FT                   /protein_id="ABE28671.1"
FT                   /translation="MTRARLREVGLNECPRPGYLKRGGQFAIKRNALQSGSKRRKSRKT
FT                   IETFSIIHFSGAEHLGTVQRIGSPVRRAHWRKRNPS"
FT   gene            159895..161001
FT                   /locus_tag="Bxe_A4328"
FT   CDS             159895..161001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4328"
FT                   /product="Putative 2-nitropropane dioxygenase"
FT                   /EC_number="1.13.12.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4328"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28672"
FT                   /db_xref="GOA:Q146R7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R7"
FT                   /protein_id="ABE28672.1"
FT                   /translation="MSEVNFVTPFARRFGLRVPVVQAPMAGGATTPAMVAAVSNAGGLG
FT                   FLAGAALSPEKIASEVAAIRALTDRPFGVNLFVLEPAAPDDATVRTALEAIDPLRRDLG
FT                   LPPGGPLARYAPDFRAQLDMLIELRVPLASFTFGLLPADDVARLHANGLYVIGTATHVA
FT                   EAVAWRDVGADAIAAQGAEAGAHRGTFIGAFEEALVGTMALVPQVVDATGLPVLAAGGI
FT                   MDGRGIVAALALGAQAAVMGTAFLTCHESAIPQAWKTRVRSMSDTSTSVTRAITGRHAR
FT                   GIRNPLMQRLSEAPQKIAPYPVQNALTQELRQTASRAENGDYLSLWSGQGAPLGRARRE
FT                   GLGAAELMSQLEREWREATARIATPNAD"
FT   gene            161380..162588
FT                   /locus_tag="Bxe_A4327"
FT   CDS             161380..162588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4327"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28673"
FT                   /db_xref="GOA:Q146R6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R6"
FT                   /protein_id="ABE28673.1"
FT                   /translation="MLGKRGHRAITLFLGPKLETYMNIKIQKLLPISAAAMLFATLATS
FT                   AAADQVVKIGHVAPLTGGIAHLGKDNENGARLAVEEINAKGLTIGGQKITLQLDAQDDA
FT                   ADPRTATQVAQKLVDDKVVAVVGHLNSGTSIPASKIYSDAGIVQISPSATNPAYTQQGF
FT                   KTTYRVVATDAQQGPALANYAAKGLKVKSVAIVDDSTAYGQGLANEFEKTAKSLGLNVM
FT                   SHDATNDKAVDFRAILTKIKGENPDAIMYGGMDATGGPFAKQAKQLGLRAKVLAGDGVC
FT                   TDKLSDLAGDATDNIVCSEAGMALEKMAGGAAFLAKYQKRFGQPIQIYAPFTYDAVYII
FT                   VDAMKRANSTDPAKILAAMPSTDYKGVIGETTFDSKGDLQHGVISLYNYKAGKKTLLDV
FT                   VKM"
FT   gene            162732..163748
FT                   /locus_tag="Bxe_A4326"
FT   CDS             162732..163748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4326"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28674"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R5"
FT                   /protein_id="ABE28674.1"
FT                   /translation="MTTVTRSFDDAWRRWIAENLLLDAPPSALHGALLGHGFDAADVTR
FT                   EIEAALASPYFHGAARLRNRLRKREWILSVYSELNRMRAASGVIERCERLSRDAFFEQY
FT                   YFQNRPVIITGAFDFWPACSRWNWDYLRRQCGDCEVEVQFGRESDANYEINQPRLTRMM
FT                   RFADYVDLVEQRGPTNDFYMTANNTSRNRAALAALWSDVPPIDAYLDAASPDTGFFWMG
FT                   PAGTKTPFHHDLTNNFMAQVIGRKHIKLVPLSDTPYMANHLHCYSRVDGGAIDFDSFPS
FT                   MRQAQLIECTLAPGELLFLPVGWWHYVEGIDASVTMTFTNFLRSNDFSRRYDTYHEL"
FT   gene            complement(164040..165494)
FT                   /locus_tag="Bxe_A4325"
FT   CDS             complement(164040..165494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4325"
FT                   /product="Putative hemagglutinin-related transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4325"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28675"
FT                   /db_xref="GOA:Q146R4"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R4"
FT                   /protein_id="ABE28675.1"
FT                   /translation="MNRKFKLTAIAMCVTSMIILTGCGSTLTRPGTGSGAGAGAGGGSG
FT                   GGTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSANPIGVVVQNTGNVITATGQTVSAVGS
FT                   QIGLTPIPGANPATTTALGNVVSNLGNGVTAVGTGVANGLGQLGNSTNPLGTTLGSSGN
FT                   LVYDAGQAVNSAGQLVTSLGSGPTAPLSALTTPLGSTVSTVGNAVSGLGTQLGSQLTNG
FT                   PIQQVTQTVSTAITPITSTLAQTTQTVGDTTGLGAPLNGLLSTIGHGLDSAGGKLSGAT
FT                   GNPVGQNLGNVVTKLGDTVTSAGGLLTAGAPSSGNPLGGITGILNPGSGAGTGSPLAPL
FT                   TSILTALPGTLSGGLTGGSGAGGPLAPLTSVVSSLTGSLGGLGGTGSGSPLAPLTGVVS
FT                   SVTGALSGATNSSGNPLAPVTSAVSSLTGALGSATGSGGGGSNPLAPVTGLLTTVTGAL
FT                   SGAATSAGGTTGGGLLGGLGALAIRK"
FT   gene            complement(165759..166970)
FT                   /locus_tag="Bxe_A4324"
FT   CDS             complement(165759..166970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4324"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4324"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28676"
FT                   /db_xref="GOA:Q146R3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R3"
FT                   /protein_id="ABE28676.1"
FT                   /translation="MSDRSSEYAALPAAHRELSDTARQRARIATMAVFFIAGMMYASWG
FT                   VHVPTVRDRFHLNAAMLSFALLAVAGGSIGAMAANASWIARVGTRRACLSGGLVMAVCA
FT                   ALILVVPTYWLLLAVLATFGAGMATLDVAMNAEASAVEKALGKPIMSSLHGMFSVGGMA
FT                   GAAVGGALLSRGMAPAVHLALAAAVSALVLLAACPSVLPHVPHAEHPDSATPRANRWRS
FT                   PALWALGAMALVALIAEGAMYDWATVYMRDVVLASPALASAAYAAFSGGMAAARFAGDA
FT                   VRARFGAPQLVMASATLACVGMVGALLLPNPVAALIGFTMMGLGLANMMPVLFAAAASV
FT                   KGIHAAEGLAHVAGLAYFGLLLGPVIIGAVTQVSSLPIGLSVVAICSALIALAGPKVLR
FT                   RLKI"
FT   gene            167182..167835
FT                   /locus_tag="Bxe_A4323"
FT   CDS             167182..167835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4323"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4323"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28677"
FT                   /db_xref="GOA:Q146R2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014599"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R2"
FT                   /protein_id="ABE28677.1"
FT                   /translation="MNIPAHAPLHLLHTAAVGTLATHARQPEGFPYPSVLPFAPDPQHR
FT                   PTILVSRLAEHTHNLHADPRAGFLAVDAPDGDVLSGQRVTLLGTFEPIDPTPEVVQRYL
FT                   RYHPDAERYLVLGDFTFWAMRLERLRYIGGFGAMGWLDGAELDLLPPLAFDEENALIAQ
FT                   FAGHAEGIHLLGADRYGADLKVNGVRSRFVFDDAKLNIGNLRAALEDCMQRYAN"
FT   gene            complement(168173..169438)
FT                   /locus_tag="Bxe_A4322"
FT   CDS             complement(168173..169438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4322"
FT                   /product="Putative transposase, Mutator family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4322"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28678"
FT                   /db_xref="GOA:Q13JT8"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:Q13JT8"
FT                   /protein_id="ABE28678.1"
FT                   /translation="MSKFTEKEVIGLSGAGLGLDELVRQGARQVIQQAIEAELAELMER
FT                   FANVKTMHGQRAVVRNGYLPEREVLTAAGPIPVKVPKVRDRSGSGVKFNSSIVPPYVRK
FT                   SPRVSAALPWLYLKGISTGDMSEALSVLLGEDAKGLSANVVSRLKAQWTEEHVAWSKRD
FT                   LSKSRYVYWWVDGIHTGLRSENSDGQCLLVIIGVRPDGSKERVAIGDGYRETKASWLEL
FT                   LLELKARGLQAGPLLAVGDGAMGFWAALEEVFPATRGQRCWFHKMGNVLNALPKSQQGR
FT                   AKADMQAIWMAATRAEAHAAFDRFVSIYAAKYPKAAETLKKDRDSLLAFYDFPAEHWQH
FT                   LRTTNAIESTFATVRHRTTRTRNCVSRPTFLGLAFKLIEEAEKTWRRINGPEKIKLLLE
FT                   GIAFKDGEPVQDDRPVQQKRAA"
FT   gene            169671..169973
FT                   /locus_tag="Bxe_A4321"
FT   CDS             169671..169973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4321"
FT                   /product="Putative HNS-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4321"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28679"
FT                   /db_xref="GOA:Q146R0"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:Q146R0"
FT                   /protein_id="ABE28679.1"
FT                   /translation="MSSYKELLAQREKLEKQIEEAKSREYAEVLNEIKQKMADYGISLT
FT                   ELGGGRAAKGAKAARPRAGVAPKYRDPDSGSTWSGRGKPPRWIAGLDREKFLIQK"
FT   gene            170270..171514
FT                   /locus_tag="Bxe_A4320"
FT   CDS             170270..171514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4320"
FT                   /product="Cation (Co++/Zn++/Cd++) efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4320"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28680"
FT                   /db_xref="GOA:Q146Q9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q9"
FT                   /protein_id="ABE28680.1"
FT                   /translation="MPAAAAVQSAGKHRIARKTTFVSIALNAVLMTLQIVIGVFAHSQA
FT                   LVADGVHSLADLISDFVVLIANRHSGAKPDADHNYGHSRYETVASLFLGALLISVGVGM
FT                   LWRAGTRLADLQNIPAVHMSALAVAVLVLVSKESLFRYMLREAQRARSAMLIANAWHAR
FT                   SDAASSLVVAIGIVGSLAGVRLLDPIAAAIVGFMVARMGWMFGWDALQDLSDRALDDAT
FT                   TANMRALLLSTPGVRDVHEVRTRKMGDFALLDAHILVDPLISVSEGHYIAESARLRVLT
FT                   DSRVLDALIHVDPENDAVAHPPVDLPTRERVTAEVNAALAPHGMKAAAVNIHYLSAGLD
FT                   VEVVLPDTPSRAPERDVQRPGRIDLAALKARLGARRLDVLQELGTSSAGTAPAIEPKTS
FT                   TAVDYTKATEPHSAT"
FT   gene            complement(171590..172048)
FT                   /locus_tag="Bxe_A4319"
FT   CDS             complement(171590..172048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4319"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4319"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28681"
FT                   /db_xref="GOA:Q146Q8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q8"
FT                   /protein_id="ABE28681.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGVIQRYTALLDREKLGLHVCALAHIHLTRHTEGGVEQFEREITTCPEVTECYSTTGES
FT                   DYILKIVAPDIKAYDTFLHERIFKIPAVAQVRTSVVLREIKFDTQLPL"
FT   gene            complement(172139..172768)
FT                   /locus_tag="Bxe_A4318"
FT   CDS             complement(172139..172768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4318"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4318"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28682"
FT                   /db_xref="GOA:Q146Q7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q7"
FT                   /protein_id="ABE28682.1"
FT                   /translation="MSSEIYVSTDVEADGPIPGPHSMLSFASAAYTEDKRLIATFSANL
FT                   ELLEGARPHPVQEAWWKTQPEAWEACRKDLQTPVAALTAYVDWVEALPGKPVFVAMPAG
FT                   FDFTYMFWYMMRFVGRCPFSWSALDIKTLAFAMTGLPYRKNIKPRFPKHWFDEHPHTHV
FT                   ALDDAIEQGALFCNMLKDLRASQAITLAAGKDGDGTGQNPAEKPAN"
FT   gene            complement(172765..173409)
FT                   /locus_tag="Bxe_A4317"
FT   CDS             complement(172765..173409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4317"
FT                   /product="Putative metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28683"
FT                   /db_xref="GOA:Q146Q6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q6"
FT                   /protein_id="ABE28683.1"
FT                   /translation="MKVTLIPVTPFQQNSSLLVCEATGRAAVVDPGGDLDVIQGEIARQ
FT                   NVSVEKVFLTHGHIDHCAGAKTLASRYDVPIEGPHPDERFWLDKLPDQSTRFGFPAAEA
FT                   FEPDRWLQNGETVQFGDEILEVYHCPGHTPGHVVFFSRAHRLALVGDVLFAGSIGRTDF
FT                   PRGNHADLVRSIREKLWPLGDDVTFVPGHGPTSTFGAERRTNPYVCDGVEA"
FT   gene            173522..173803
FT                   /locus_tag="Bxe_A4316"
FT   CDS             173522..173803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4316"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28684"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q5"
FT                   /protein_id="ABE28684.1"
FT                   /translation="MKIHQGFQSLVIPKFCFGYNGLHAQGTVLPQGDASPSKMGTRIAT
FT                   QVWAVALMDGHQVSMHSMHTSCPARRHAPATELNTVTLGGAYAAVPAR"
FT   gene            174046..174648
FT                   /locus_tag="Bxe_A4315"
FT   CDS             174046..174648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4315"
FT                   /product="Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4315"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28685"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q4"
FT                   /protein_id="ABE28685.1"
FT                   /translation="MKTRLSRGLGTLFAFFALAGCATPPGAGNTSESGVPQSTKNTQAG
FT                   SFGPQAFGSAPASDVTARGSALADAKPLTDEGSGVSDFHQTGRASWYGRGFHGRRTANG
FT                   ERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGPYARGRVIDLSMAAAAVLD
FT                   MRHAGTARVEIEGLTQQEARAARDEMLASNSDSSAEK"
FT   gene            complement(174762..175640)
FT                   /locus_tag="Bxe_A4314"
FT   CDS             complement(174762..175640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4314"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28686"
FT                   /db_xref="GOA:Q146Q3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q3"
FT                   /protein_id="ABE28686.1"
FT                   /translation="MTPLSELAQGQQYPTAALYVVATPIGNIADVTLRALHVLGLVDRI
FT                   AAEDTRNTGQLLARYGISKPLVAVHQHNERAAALRLIEHLQAGERVAYVSDAGTPGISD
FT                   PGAKLVDAVREAGFPVIPLPGASALATALSAAGDWVATFSFLGFLPPKAKARAATLQSL
FT                   ANHPHAMVFYEAPHRIVETVQALAEAFGGERKLLIARELTKLHEALHRGTLAEGPAWLA
FT                   ADPNRQRGEFVLVVEGAQPETAGEHDHDALLGILLEELTVSSAAKVAAAITGASRNALY
FT                   TRALALKKDEE"
FT   gene            175729..176151
FT                   /locus_tag="Bxe_A4313"
FT   CDS             175729..176151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4313"
FT                   /product="Protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4313"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28687"
FT                   /db_xref="GOA:Q146Q2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146Q2"
FT                   /protein_id="ABE28687.1"
FT                   /translation="MRAVAPIGAFATPDNFSAPVGSKLVGAAFEARAQEFLQRQRLRFV
FT                   ARNVACRGGEIDLVMRERDGALVFVEVRARAQRRYGGAAASIGWRKQQRIVRAAQHYLA
FT                   TRSSQLRDQPACRFDVIAFEAGRLVWLRDAFRADEV"
FT   gene            176369..176956
FT                   /locus_tag="Bxe_A4312"
FT   CDS             176369..176956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4312"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4312"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28688"
FT                   /db_xref="GOA:Q146Q1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q1"
FT                   /protein_id="ABE28688.1"
FT                   /translation="MSVERIQQHFRDSAAVKLEALETLSMPIAAAIDTMFAALANGNRI
FT                   LACGNGGSAADAQHFAAELIGRFERERPGLPAIALSTDTSVLTAIANDYSFEQIFSKQV
FT                   WALGQPGDVLLAITTSGNSANVLAAIEAAHEREMIVVALTGKGGGRMQDVLSDTDIHVC
FT                   VPSDRIARIQEVHLLTIHCLCDGIDAMLLGED"
FT   gene            176983..177777
FT                   /locus_tag="Bxe_A4311"
FT   CDS             176983..177777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4311"
FT                   /product="periplasmic phospholipid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4311"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28689"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Q0"
FT                   /protein_id="ABE28689.1"
FT                   /translation="MSVFRVKKTLVRTVLVVGFAAGLSATLQGCFLAVAGAAGGGALVA
FT                   TDRRTLGAQTEDRELQVKALSQISQNLPDNAHVNVAVFNRRVLLTGEVAGDVSKQRAET
FT                   IVRGLNNVTTIVNELAIMPASSFSSRTNDTYLETRVKTALIAEKNISANNFKVVAERGS
FT                   VYLMGLVTMDEGNRGADVASRVPGVVQVVKVFQYIQPQEAVAAAAAAGTAPVAASQPDA
FT                   GAATVGAIPDSSVSSRPLEQQAPAPVSNSNSVHPGNPKATTP"
FT   gene            177774..178130
FT                   /locus_tag="Bxe_A4310"
FT   CDS             177774..178130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4310"
FT                   /product="Putative cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28690"
FT                   /db_xref="GOA:Q146P9"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P9"
FT                   /protein_id="ABE28690.1"
FT                   /translation="MRRGVAVAVAASVLMGGALTGLGVSAARAADAPRGQLVANANACM
FT                   GCHAVDRKLVGPSFQQIAAKYKGDAQAQAKLARKVKEGGSGVWGMIPMPAHQTMSDADI
FT                   RTVVDWVLAGAPSR"
FT   gene            178219..178294
FT                   /locus_tag="Bxe_AR0019"
FT                   /note="tRNA-Ala7"
FT   tRNA            178219..178294
FT                   /locus_tag="Bxe_AR0019"
FT                   /product="tRNA-Ala"
FT   gene            complement(178230..178856)
FT                   /pseudo
FT                   /locus_tag="Bxe_A4309"
FT   gene            179376..180617
FT                   /locus_tag="Bxe_A4308"
FT   CDS             179376..180617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4308"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28691"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P8"
FT                   /protein_id="ABE28691.1"
FT                   /translation="MKKLLPLLLVASLAACSQKPEVACNGDDAKSVVTSILKDALVKQI
FT                   TSDFAGPNSNVQVNVDGALIRATVDKIGITLDDVLTTKSDPNSTKKFCSATMRLSVPAD
FT                   VVSNADAARSMLSLNSSHQGALQAGVDFDANTVKASLEYGVQPTDDGKKIYGSTEGNNA
FT                   ALTFASTLVEESFVKTALERQKAEQAKQEQQKALQAQQQQAEIAQAQAADNEAALQKAQ
FT                   SDMKMANDAINVVWNAGSKEWRQALLPEQRLWLAQRENDCKIKALDSGTPDTTAFQTNK
FT                   LNCQVQMTVDRTQALKISLQQSLSQQSVAGTSSTSALQPTLTTSFDCSSARSDAEHIIC
FT                   SDPELAADDVELSRIFARAKAAVTDQAAFRERTRQQWNYREQSCHDRNCLVRWYADQKT
FT                   ALTQIAQTGRVDAN"
FT   gene            181239..181883
FT                   /locus_tag="Bxe_A4307"
FT   CDS             181239..181883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4307"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4307"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28692"
FT                   /db_xref="GOA:Q146P7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P7"
FT                   /protein_id="ABE28692.1"
FT                   /translation="MTHHSSRPSITRPRKTPSQARAEETVESIVEAAAQVLEAEGLEGF
FT                   NTNAIARRAGVSIGSLYQYFPGKDALTVALIQRETRRFYHDAAAALTQRSGKAALEYLI
FT                   GASVRQQLQRPMLAKLLDVQESSPALRGEVEKVEFDALVVAIVKRVAPRLEHPEVAAAD
FT                   LLAIVQGLTDAAGQRGERDLESLEHRVRAAAFGYLSRIAKRDKHSPRAGGM"
FT   gene            182052..182459
FT                   /locus_tag="Bxe_A4306"
FT   CDS             182052..182459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4306"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4306"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28693"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P6"
FT                   /protein_id="ABE28693.1"
FT                   /translation="MNDLISNMKLNHLSFPSADTAATAQFFEQYLGFTVSGVWEKSYIL
FT                   KRPGFDVVIDHTGSDVPAWPRAFHAGFELPSLEAVRKLYERFKADGVEMETEVFNNGRG
FT                   SRFFCRAPGGVMFELNTRADAAPEYRDSFQN"
FT   gene            complement(182537..182836)
FT                   /locus_tag="Bxe_A4305"
FT   CDS             complement(182537..182836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28694"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P5"
FT                   /protein_id="ABE28694.1"
FT                   /translation="MRAAEAAGRGLEFWGMRICYGGFPGCGGKPNSLLARVEAVTSALI
FT                   RETLPEERQTIVCDDLLAHVVWMAFDGFVINHRIGDLRDMDAIAELMVKLLFGE"
FT   gene            complement(182823..183716)
FT                   /locus_tag="Bxe_A4304"
FT   CDS             complement(182823..183716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4304"
FT                   /product="Putative dihydrodipicolinate synthetase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4304"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28695"
FT                   /db_xref="GOA:Q146P4"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P4"
FT                   /protein_id="ABE28695.1"
FT                   /translation="MKSTEFRGIISYPVTPFDLHDGSVDVPTLNRLIDRLVDSGSHGIA
FT                   PLGSTGESAYLSDDEWDTVAEASVRRVAKRLPVIVGISDLTTRNAVRRAKFAESVGADA
FT                   VMVLPVSYWKLNEAEIFRHYATIAEAISVPIMVYNNPATSGIDMQPELIVKLAREIDNV
FT                   TMIKESTGDIQRMHRIAQLSDGRVPFFNGSNPLALGAFAAGAAGWCTAAPNLVPQWPVK
FT                   LYEACEKGDMELARAVFYRLLPFLQCIMKGGLPTTVKAGLALRGFSVGAPRRPLQPLAE
FT                   PAVRELAAVLGGLEGG"
FT   gene            complement(183753..184541)
FT                   /locus_tag="Bxe_A4303"
FT   CDS             complement(183753..184541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4303"
FT                   /product="Putative class II aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4303"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28696"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P3"
FT                   /protein_id="ABE28696.1"
FT                   /translation="MADTLTTSKSELVATAERQMQTALPELVWATREKLALTCRILFEQ
FT                   GHDSGLAGQITARTDEPDTYYTQRFGLGFDEITASNLVHVNQDLKLVSGEGMPNPANRF
FT                   HTWIYRARPDVNCIIHTHPLHVAALSMLETPLVVSHMDLCPLHDDCAFLEQWPGVPVGN
FT                   EEGEIISAALGGKRAILLSHHGQLVTGSTIEEACTLALLIERAAQMQLLAMAAGDVKPI
FT                   PAELGREAHDWISTPKRNQATFAYFARRALRSPMHRDCLA"
FT   gene            184708..186273
FT                   /locus_tag="Bxe_A4302"
FT   CDS             184708..186273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4302"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4302"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28697"
FT                   /db_xref="GOA:Q146P2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P2"
FT                   /protein_id="ABE28697.1"
FT                   /translation="MLRTWKLTLRPERNRSESIHLQIVQAIVEDIRRGRLVSGTALPGT
FT                   RALADDLGVNRKTVVLAYDELTAQGWIETEAKRGSFVSSRLPALEFKPEATHERPFPVA
FT                   LSDDGASLYHEAMSPGEANGSGNIAFTDGVPDTRLIPFDVLSRAFRHALVSSARANALG
FT                   YADPRGTPELREAIAAMLRAERALNVSADNICVVRGSQMGIFLAARLLTRPGDTIAFET
FT                   LSYPPARAAFLSCGAELAAIELDQYGLVPDSLEALCRKKPVRAVFTTPHHQFPTTVTMP
FT                   ADRRLRLLDLARRYGFVIVEDDYDPEFHFDYKPVLPLASMNASEQVFFIGSLSKVLAPG
FT                   LRLGYIAASKEAIARCAAQIMLIDRQGSALTEMAVTELMASGELKRHIRRALRTYERRR
FT                   DFCAECVRRELGDKVSFAVPGGGLALWLTLSGQVAAGELVDRAAQAGIRLLAGRQFSPN
FT                   GEDVQGVRLGYGNLDETEMASALARLGRAARRDSRAGAGSRAQGFYFPLRLARRSISKA
FT                   RQLA"
FT   gene            complement(186318..188081)
FT                   /locus_tag="Bxe_A4301"
FT   CDS             complement(186318..188081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4301"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28698"
FT                   /db_xref="GOA:Q146P1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P1"
FT                   /protein_id="ABE28698.1"
FT                   /translation="MHLTIKAKLIAGFGILSLIVVAVSMLALKSLGDSTDGFSTFVHGV
FT                   NARADMVMQVRTAVDRRAIAARNLVLVTKPQDLEIEKADVLRAHEDVHTNLKKLNDMIA
FT                   TSSNVTEKGRRLVAEINRVEALYGPVATDIVNLALTGKHDEAIVKMDDQCRPLLAALIS
FT                   ATNAYTDYAHGRQEQLINEFAMHYENQRNLLIAISLIAVALAIGACVLITRSVTGPLRQ
FT                   AIDIARTVSEGDLRTRIAVSGSDETSRLLRALREMNERLTTIVARVRDSSTSIAGAARQ
FT                   IAAGNMDLSQRTEQQAASLEETASSMEELTSTVKQNADNAQQGSLLATNASSVAQKGSE
FT                   VVGQVVNTMHDISESSTKIADITGIIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAS
FT                   EVRSLAQRSSSAAKEIKDLIATSVDRIRDGSALAGEAGRTMAEVTTAVARVTDIMSEIA
FT                   AASSEQSRGIEQVNLAITQMDNVTQQNAALVEEAAAASRSMEDQGEQLNEAVAFFQILN
FT                   GDAVEASVSAARLQKEKSPREPAVAAPVRRVVRAMSAHGAAPGAAPGCAPVATRPTAAV
FT                   AVGADDGWNQF"
FT   gene            188514..189086
FT                   /locus_tag="Bxe_A4300"
FT   CDS             188514..189086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4300"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4300"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28699"
FT                   /db_xref="GOA:Q146P0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q146P0"
FT                   /protein_id="ABE28699.1"
FT                   /translation="MARPKSEDKRNAILAAAAQVIAEQGLGAPTSRIARVAGVAEGTLF
FT                   TYFDNKDDLLNVLYLDIKGELREVMMTAYPRRAGVRERVQHVWNRFVDWGVAQPHKRRA
FT                   MAQLAVSERLTDHTRSAGMQSFADINAMIQASVASGALRDHPPAFLSAIMGALAETTMD
FT                   FIAREPANAERYRQAGFDAFWNAIARH"
FT   gene            189143..190018
FT                   /locus_tag="Bxe_A4299"
FT   CDS             189143..190018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4299"
FT                   /product="Putative short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4299"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28700"
FT                   /db_xref="GOA:Q146N9"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N9"
FT                   /protein_id="ABE28700.1"
FT                   /translation="MAKVWLVTGSARGLGREIVEAALQAGEQVIATARDPRQLEDLLAR
FT                   HGERIRTVALDVTDPQAARQAVQAALDAFGRLDVVVNNAGFGHLVPFEQTSEDDFRAQI
FT                   DTNFYGVVNVTRAALPVLRQQRAGHIIQISSVGGRVGIAGLSAYQAAKWAVGGFTEVLR
FT                   QELAPFGVHVTALEPGGMKTGWGDQAAGATPELLADYVPSVGAVSDMLSQYIGHEASDP
FT                   AKVAQVVLKLAYHDALPAHLLLGSDALHYCGAGDKARAADAQAWQAVSVSTDFSAPAAL
FT                   PPFPAAAAKA"
FT   gene            190167..190868
FT                   /locus_tag="Bxe_A4298"
FT   CDS             190167..190868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4298"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4298"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28701"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N8"
FT                   /protein_id="ABE28701.1"
FT                   /translation="MKVLIFGATGMVGQGVLRECLRAPDVEAVQTVGRTRSGQLDPRLT
FT                   EVIQPDLTDTRAIEASLKGFDACFFCLGVSSAGLREAEYSRLTYDLTMAVAQTLARLNP
FT                   QMTFVYVSGSGTDSTGQGRSMWARVKGRTENALRRLPFKGVYLFRPGVIEPLNSARSKT
FT                   RSYRLFYTLAKPFLSTLRALLPNQILSTEDIGLAMLAVARHGAGKAVLETADIRALSRS
FT                   ASRPVLDLHAG"
FT   gene            191016..192584
FT                   /locus_tag="Bxe_A4297"
FT   CDS             191016..192584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4297"
FT                   /product="Putative diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28702"
FT                   /db_xref="GOA:Q146N7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N7"
FT                   /protein_id="ABE28702.1"
FT                   /translation="MPERQVMVTRRPNIVIAISIVLASAILAIAVWVLAQMRDDALRRA
FT                   QDSVFNVSLLVERDVSRNLEIYDLSLRAVLDGLKQPGVLDLKPAMRQMVLFDGSASAKD
FT                   MGSILVTDEAGNVRFDSQATPPRQVNLADRDYFKVQRDSPNAGLFISHPFIPKVGGKDV
FT                   SIALSRRITRPDGGFGGVVAGTMRLTYFHSLFAGMNLGVGGSMALMLSDGTMLMRRPYD
FT                   PKMIGINLTGTANYSRFTEQPSGDFFGTAALDGVERWYAFRHIDMYPLILDVALSTRDI
FT                   YAQWRHRAWIIGSLIAALDVTIIALAVLFSQQLRHRRAAEEELRVLACTDGLTGLFNRR
FT                   TYEQQAEGEWRRAQRNARPLSMLLIDVDNFKGFNDLYGHSAGDEALIGVARCISQSVRR
FT                   PGDTAARYGGEEFAVLLPDTDEAGATRIAGKICAAVEALQLRHVASSHCVLTVSIGVAT
FT                   TRGQAFATSRALVDAADEALYEAKDAGRNCVLCFGATTHATHAMHATLGTTSVAGTGTK
FT                   KLLRN"
FT   gene            complement(192581..193210)
FT                   /locus_tag="Bxe_A4296"
FT   CDS             complement(192581..193210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4296"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28703"
FT                   /db_xref="GOA:Q13RK7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q13RK7"
FT                   /protein_id="ABE28703.1"
FT                   /translation="MWFRHSLLATARRVAKGRCLATHSRSVARRTASPWRNRFLACARR
FT                   QLIDSRRAGGKKTGPNPTDRRKLGSKHHLIVDAQGIPLAVILSAANRHDITQLDALVDA
FT                   IPRIRGKRGRPLHKPRIVQGDRGYSSEPHRQRLRERGITPLLAKVGAPHGSGLGKTRWP
FT                   VERSIAWLHSFRRLKIRYERYAHVHEAFLSLACALICWTRLKPLFN"
FT   gene            complement(193619..193867)
FT                   /locus_tag="Bxe_A4295"
FT   CDS             complement(193619..193867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4295"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28704"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N5"
FT                   /protein_id="ABE28704.1"
FT                   /translation="MTMAARSAAARGLQRKHRDGRLLFGALRQIGIALGAAGRIAEERG
FT                   SRKSAQIFWESSDMSSVGEDLNLACCVDPHEQAHAML"
FT   gene            194080..195387
FT                   /locus_tag="Bxe_A4294"
FT   CDS             194080..195387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4294"
FT                   /product="Nucleobase/Cation Symporter, (NCS2) Family"
FT                   /function="xanthine/uracil uptake"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4294"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28705"
FT                   /db_xref="GOA:Q146N4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N4"
FT                   /protein_id="ABE28705.1"
FT                   /translation="MADSYFPRWRAQPAAAEGRIVGTDERLAWPQMFAMGVQHVVAMFG
FT                   STVLAPLLMGFDPNLCIFMSGIGTLLFFVLVGGRVPSYLGSSFAFIGLVIAVTGYGGHG
FT                   PNLNIPVALGGIIACGVVYAVIGLIVSAVGTRWIETLMPPVVTGAIVCVIGLNLAPIAV
FT                   HGVSGSNFDSWMALVTVLCVGAVAVFARGMLQRLLILVGLLMAYVIYAIVTNGLGMGKP
FT                   IDFTIVANAAWFGMPHFTAPVFNMQAMTLLAPIAVILVAENLGHIKAVSAMTGQNLDRY
FT                   VGRAFLGDGLATIVSGFAGGTGVTTYAENIGVMAVTKIYSTLVFVIAAVIALVLGFSPK
FT                   FGAVIQTIPGPVLGGVSIVVFGLIAVTGARIWVVNKVDFSDNRNLIVAAVTLVLGAGDF
FT                   SLKLGGFGLGGIGTATFGAIILYALLRRKPVQGPVA"
FT   gene            complement(195498..197153)
FT                   /locus_tag="Bxe_A4293"
FT   CDS             complement(195498..197153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4293"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4293"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28706"
FT                   /db_xref="GOA:Q146N3"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N3"
FT                   /protein_id="ABE28706.1"
FT                   /translation="MDIVFTVLILLLAVAASGVVIRILPIALPLPLVQIAIGALLAWPK
FT                   LGLHVTFDPEIFMMLFIPPLLFADGWRIPKREFFMARRSILMLALGLVFVTVLVVGYFV
FT                   HALVPSISLPVAFALAAVLSPTDAVALSGIVGKGKIPGRLMHILEGEALMNDASGLVAL
FT                   KFAIAAALTGVFSLRDASISFVIISVGGIATGAAVSWLFSFVSARFLNLTEDGDPAPGV
FT                   VMTLLIPFAAYLIAERFELSGILAAVAAGMTMNYATLANAGPVSSRVRANSTWTMIEFV
FT                   FNGMVFILLGLQFPHILGRALLDAHETSNAQVGLLIGYIAAVAAALYAMRFVWVWLLRW
FT                   VASRGATKRGMANAVPGLRTVAVTTVAGVRGAVTLAGVLSLPEVLPDGVPLPGRDLAIF
FT                   IASGVILLSLLVAVVALPLLLSGWRRGKDPHAAEELLARTLAAQAAIRAVDEVHDTECA
FT                   DLDESASAYAADVTARVMDLYRRRLATLDEEQEPRELARRADALEFRMKLAAMRAERKT
FT                   LLALRSSQAINDETLNKLMREVDLSETALTARRK"
FT   gene            197537..198814
FT                   /locus_tag="Bxe_A4292"
FT   CDS             197537..198814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4292"
FT                   /product="Putative diguanylate phosphodiesterase (EAL
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4292"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28707"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N2"
FT                   /protein_id="ABE28707.1"
FT                   /translation="MTIAQQERTAGAPHGFDVEMTSGLERFTVKHGELTLSSVFQPIFS
FT                   LSHMRAVGYEGLLRAHDALDRPVSPLDVFGEAARLGEVLQVDRLAQTLHLENFKVLGAE
FT                   REWLFLNVHPAALTDPYLAAALLATLKRLDLSPRRIVLEVLEHRAEDLERLADAVRQFR
FT                   ERGFLIALDDFGAGHSNVERIWQLNPDIVKLDRIMLSHAAHRADMATILPGLVALLHEA
FT                   GKLVLIEGVETEHEAQMALACNADFVQGFFFGRPNPGAADALHATTCISELTERYRDQA
FT                   EARERRNASRLAPYLRAFERAAERLAAGEPLEEVCWNFLALDHAARCFLLDAKGRQAGR
FT                   NVVLRADRAAHETRFLPLADAQGANWLRRPYFRDAINAPERVHVTRPYLSINEALPCVT
FT                   LSVATRVGEQTCVLCGDIDWVDEERY"
FT   gene            198939..199637
FT                   /locus_tag="Bxe_A4291"
FT   CDS             198939..199637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4291"
FT                   /product="Putative copper homeostasis protein CutC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4291"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28708"
FT                   /db_xref="GOA:Q146N1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N1"
FT                   /protein_id="ABE28708.1"
FT                   /translation="MSALLEVIATTVADARLAAQAGANRLELVTAMGEGGLTPSLGLIE
FT                   AVVAAVEIPVNVIVRPHSRSFVYDADDYAVMLRDVRAVNAAGANGVVIGMLDAAGGIDR
FT                   EGLARAIDAADGLAITFHRAFDEARDLRESLDVLLGFDAVTNVLTSGGQPSVLHAEATI
FT                   RELVRQASGSHLTVLAGAGLTVDAIAGFVSGTQVEAVHFGSGVRVNGNGLAPVDADKVA
FT                   KVRALLDAQT"
FT   gene            complement(199765..203352)
FT                   /locus_tag="Bxe_A4290"
FT   CDS             complement(199765..203352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4290"
FT                   /product="Putative indolepyruvate ferredoxin oxidoreductase
FT                   alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4290"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28709"
FT                   /db_xref="GOA:Q146N0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:Q146N0"
FT                   /protein_id="ABE28709.1"
FT                   /translation="MTARLPIDGTPALADYKLSDNLTATRGRIFLTGTQALVRLVLMQR
FT                   AADKARGMNTAGFISGYRGSPLGMVDQQLWKAKKLLAASDIRFLPAINEELGGTAVLGT
FT                   QRVESDPERTVEGVFAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSS
FT                   SMPHQSDFALMAWHMPVVNPSNIADMLEFGLYGWELSRFSGAWVGYKAISETVESGSTV
FT                   DLDALRTDWAAPQDFEAPAGGLHNRWPDLPSLTIESRMHAKLDAVRHFARVNSIDKWIA
FT                   PSPHANVGIVTCGKAHLDLMETLRRLDLTVADLEAAGVRIYKVGLSFPLEMTRIDAFVS
FT                   GLSEVLVIEEKGPVIEQQIKDYLYNRTQGTRPIVVGKNAEDGTLLLSSLGELRPSRILP
FT                   VFANWLAKHKPALDRRERVVDLVAPQILSNAADSVKRTPYFCSGCPHNTSTKVPDGSIA
FT                   HAGIGCHFMASWMERDTTGLIQMGGEGVDWASHSMFTKTRHVFQNLGDGTYFHSGILAI
FT                   RQAVAAKATITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKY
FT                   DGHHDLFPKGTTFHHRSEMDTVQRELRDTDGVTVLIYDQTCAAEKRRRRKKGEFPDPDK
FT                   RLFINEEVCEGCGDCGVQSNCLSVEPVETALGRKRRIDQSSCNKDYSCVNGFCPSFVTV
FT                   EGGKLKKAAGAAFDPAALAARVDALPLPATHLDAAPYDILVTGVGGTGVVTVGALISMA
FT                   AHLEGKSASVLDFMGFAQKGGAVLSFVRFAARDEWLNQVRIDTQQADVLLACDMVVGAS
FT                   ADALQTVRHGRTRIVVNTHAIPNATFVTNPDATLHADALLDKMRHAAGAERMSTCDAQA
FT                   LATRFLGDTIGANILMLGYAWQLGLVPVSFGAMMRAIELNNVAVPMNQLAFSIGRLAAE
FT                   DPAALESLWQARHQAKQPVRVDTLDELIAHREGRLQIYGGASYVKRYRALVDAARRAET
FT                   AADANSERVTRAVATTFYRLLAVKDEYEVARLHTDAAFREALEAQFEGVAGKDFGIKFN
FT                   LAPPTLTRPEPGKNPAKKTFGQWMWPVLGTLAKFRALRGTPLDPFGRTLERKMERELAG
FT                   DYETTLQRALAKLGADNLEDVAKLADLHARVRGYGHVKLANLAGVKRGERDLAARLRIE
FT                   AATGESVRKSLEEVKGAGQLRGIPVVVAK"
FT   gene            complement(203585..204556)
FT                   /locus_tag="Bxe_A4289"
FT   CDS             complement(203585..204556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4289"
FT                   /product="Putative inward rectifier potassium channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28710"
FT                   /db_xref="GOA:Q146M9"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="PDB:2QKS"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M9"
FT                   /protein_id="ABE28710.1"
FT                   /translation="MATKPTDRPSAFGNGEARAPTRRPRGSRELRLDDRVIIAHGVPTP
FT                   LWQDLYHRALAVRWPTFFVSLAVLFLLLNTAFATLYMLGSAPIANQFPAGFGGAFFFSV
FT                   ETLATVGYGDMHPQTVYAHWIATLEIFVGMSSIALATGLIFARFSRPHAKIMFARYAVI
FT                   RPLDGRMTLMVRSANARQNVIAEAHARLRLLRQETTAEGYTLRKLYDLTLVRDQHPVFK
FT                   LGWTVMHIVDESSPLFGETAETLKQRDTSLILTLEGVDESTAQTMQARHLWSCDQIRWH
FT                   YRFVDIMSEQDGVSHIDYSHFDEIAPLDEAPIAAARATAPTP"
FT   gene            complement(204870..205115)
FT                   /locus_tag="Bxe_A4288"
FT   CDS             complement(204870..205115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4288"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28711"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M8"
FT                   /protein_id="ABE28711.1"
FT                   /translation="MAEQLFLYGVYSIHVRPLQLNGARWDAEYEIRHREKAVKPWTTVG
FT                   GDNGYDAETEAVAAAHQQAVDDIEHGAGIPRPRAFP"
FT   gene            complement(205200..205430)
FT                   /locus_tag="Bxe_A4287"
FT   CDS             complement(205200..205430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4287"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28712"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M7"
FT                   /protein_id="ABE28712.1"
FT                   /translation="MDDITYTKGIYTAIASTREIEEDTWQGVVTLSRDEGDETADQETT
FT                   VYEVEATSSTPEEALEEAKALAHRILGEIEL"
FT   gene            complement(205552..206469)
FT                   /locus_tag="Bxe_A4286"
FT   CDS             complement(205552..206469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4286"
FT                   /product="Putative carbohydrate kinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4286"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28713"
FT                   /db_xref="GOA:Q146M6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M6"
FT                   /protein_id="ABE28713.1"
FT                   /translation="MSNPGVNSEFPLFVSAGDILTDLVRTGPSQWLSRPGGAGWNVARC
FT                   VARLGLPTACAGSLGVDNFSDELWNASVAAGLDMRFMQRVERPPLLAIVHQTHPPAYFF
FT                   MGENGADLAFDPARLPAGWASHVKWAHFGCISLVRQPLGNTLAALAAQLRSQGVKISFD
FT                   PNYRNLMEHGYEPTLRKMAALADLIKVSDEDLRLLFKTDDEASALAQLRAMNPAATVLV
FT                   TRGPETAVLIDGAVVTEARPPRVEVVDTVGAGDASIGGLLFSLMTAPQRAWPEHLAFAL
FT                   AAGAAACRHAGAHAPSLDEVVALL"
FT   gene            complement(206466..207749)
FT                   /locus_tag="Bxe_A4285"
FT   CDS             complement(206466..207749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4285"
FT                   /product="Putative N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4285"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28714"
FT                   /db_xref="GOA:Q146M5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M5"
FT                   /protein_id="ABE28714.1"
FT                   /translation="MTQSDPLHPANGAAAVPPVESFRSRDFLLSHVQDTLRFYAPNVLD
FT                   PSGGFFHFFRDDGTVYNRTTRHLVSSCRFVFNYAMAYRQFGDPQHLEYARHGLRFLREA
FT                   HWDAQHEGYDWELEWHDGRKRTLDATRHCYGLAFVLLAYSHAAMAGIEEAKPMIGATFE
FT                   LMEHRFWDAAAGLYADEASPGWQVSSYRGQNANMHTTEALLAAHEATGHLVYLDRAERV
FT                   ASNITLRQAKLSQGLVWEHFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLIL
FT                   ERYRPLPWLLPRAIELFDAAMTHAWDEDHGGLYYGFGPDGTVCDHDKYFWVQAETFATA
FT                   ALLGKRTGNERFWDWYDEIWRYSWAHFVDHKYGAWYRILTCDNRKYSDEKSPAGKTDYH
FT                   TMGACYEVLAHALPNGAAAASESAEQTK"
FT   gene            complement(207746..208732)
FT                   /locus_tag="Bxe_A4284"
FT   CDS             complement(207746..208732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4284"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4284"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28715"
FT                   /db_xref="GOA:Q146M4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M4"
FT                   /protein_id="ABE28715.1"
FT                   /translation="MATTIRDVARAASVSIGTVSRALKNQPGLSEATRERVVEAARKLG
FT                   YDAAQLRPRIRRLTFLLHRQHNNFAVSPFFSHVLHGVEDACRERGIVPSVLTAGPTEDV
FT                   IQQMRLHAPDAVAIAGFVEPETLATLVAMQRPLVLIDLWAPGLRSVNLDNAAGATLAMR
FT                   HLFEQQRKRVAFIGGSLAHFSIAQRALGYRRAFFEAGLLFDPSLEVTIDAGLDPASGAA
FT                   RAMHQLLDAPGPRPDAVFAYNDAAALAALRACLARGLRVPEDIAIIGFDDIPAAAHATP
FT                   PLSTISVDKEALGRRGVELLLEDAPAEPEVRLPVHLIARASTLVKTP"
FT   gene            complement(208929..210779)
FT                   /locus_tag="Bxe_A4283"
FT   CDS             complement(208929..210779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4283"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28716"
FT                   /db_xref="GOA:Q146M3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M3"
FT                   /protein_id="ABE28716.1"
FT                   /translation="MQPSPPSRSAAPRIEELIARRDLSAVFQPIIDFEDGAILGYEGLI
FT                   RGPAGTPLEAPFALFSQALAEGCGIALERAAARTCIEAFARLEFDGKLFLNFSAGALRQ
FT                   LAGTRDETLALLRHHGVDPQRLVIELTEQSTIPDVGSFLPVIAALRSDGAQFALDDYGT
FT                   ANASMNLWVRLQPDVVKIDRFFIHDIACDPLKFEAVRAMQHFASASGARLVAEGIENEA
FT                   DLIVVRDMGIGCGQGFFFGRPHAQPARKVTDDARDALRAGHIAVFPETTRTVSSASPSG
FT                   GMASAKMLVHAPALPRQATNNDVLELFNRLPDLHAVAVVEHDEPVALINRRSFMDRYAL
FT                   PYHRELFGKRPCLLFANASPVIIEKSMTVEQMAKLLASDDQRYLADGFVITDNGKYAGL
FT                   GTGENLVRAVTEVRIEAARYANPLTFLPGNIPISSHIARLLGNDAGFYACYVDLNHFKP
FT                   FNDQYGYWQGDEVLKFAALVLADVCDPTRDFLGHVGGDDFLILFQSEDWRERVLRAIHV
FT                   FNEGAQRFYAPADRLAGGIHGEDRRGNPTFFGFVTMAIGCVHVEPGEGPSLYTSEEIAS
FT                   VAALAKRRAKHEASGFVLIDADESVALLRGQAEAVHVSLE"
FT   gene            complement(211067..212095)
FT                   /locus_tag="Bxe_A4282"
FT   CDS             complement(211067..212095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4282"
FT                   /product="Putative sodium/bile acid symporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28717"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M2"
FT                   /protein_id="ABE28717.1"
FT                   /translation="MARPKLLPDNFTLCLVSTVILASFLPVHGQAAVGFNWVTNVAVGL
FT                   LFFLHGAKLSREAIVAGATHWRLHAVVLLSTFALFPLLGLALKPLLSPLVTPALYAGVL
FT                   FLCTLPSTVQSSIAFTSIAKGNVPAAVCSASASSLLGIFITPALVSVVITNQAAGGGAS
FT                   PWHTVGNIVLQLLVPFVAGQLLRPLIGKWIERNRGVLKFVDQGSILLVVYGAFSEAVTE
FT                   GLWHQIPLSALGGLLVVCVVLLALALAVTMFVSKRLGFSRADQITIIFCGSKKSLAAGV
FT                   PMAKVIFASHAVGAVVLPLMLFHQIQLMVCAALAQRWGARDTSGETRAASRERPAAAVA
FT                   RH"
FT   gene            complement(212209..212508)
FT                   /locus_tag="Bxe_A4281"
FT   CDS             complement(212209..212508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4281"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28718"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M1"
FT                   /protein_id="ABE28718.1"
FT                   /translation="MSSQKVLGLARGCNTLLLRRFSTTEHLRERPENACFQDLSEITDR
FT                   ALRMTNRGPVFIWIVKSAWTKQMASPILKTASMPCGFFRKQAPQCAILINRFGK"
FT   gene            212747..213202
FT                   /locus_tag="Bxe_A4280"
FT   CDS             212747..213202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4280"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4280"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28719"
FT                   /db_xref="UniProtKB/TrEMBL:Q146M0"
FT                   /protein_id="ABE28719.1"
FT                   /translation="MPHGGSGGYAHAPTNHAVRGNLHHGGSYNGATAGPAHTTMADRDA
FT                   HLPRGGVNGAGGNYGNGFGIYNPGMRRVAAPAGYAGDGRGGMQYAGAITPVSAESRAVP
FT                   RPPVNAPVRAGSIRADVARYNEERGATRAMQRQADDPRQPEGSPYRN"
FT   gene            213718..214803
FT                   /locus_tag="Bxe_A4279"
FT   CDS             213718..214803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4279"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4279"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28720"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L9"
FT                   /protein_id="ABE28720.1"
FT                   /translation="MKASISSALKTTLKATACAALLASASSAFAQSSVQLYGQVDEWVG
FT                   AQKFPGGKTSVQVSGGGMSTSYWGLKGAEDLGNGYKAIFALEGFFLAQNGQYGRFTGDT
FT                   MFSRNAYVGIESPYGTVTAGRLTTPLFVSTILFNPFIDSYVFSPMVYHTYLGLGTFPTY
FT                   STDQGVTGDSGWSNAVSYSSPNFNGLSATAMYALGNTTENGAKKWSGQVLYFHGPFAAT
FT                   AVYQYVNFNNVPSDLGSFSTSGVPGLKSQSVAQLGLSYDLKFVKFFGQYMYTYNDQQVT
FT                   SWHVNTAQGGASVPFGPGTVMASYAYSRDGGGFDQTRQTAAIGYDYPLSKRTDIYAAYL
FT                   YDHISNQSSGNTYGVGLRAKF"
FT   gene            215009..215947
FT                   /locus_tag="Bxe_A4278"
FT   CDS             215009..215947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4278"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4278"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28721"
FT                   /db_xref="GOA:Q146L8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L8"
FT                   /protein_id="ABE28721.1"
FT                   /translation="MDTLVSMKVFRHVVEVGSFVGAAERMEMSAAMASKHVMHLEQQLG
FT                   ARLLNRTTRRVAPTEAGREYYERLSQVLAELEEAEQAVGAASVVPQGRLRVSSLSAFGL
FT                   SHVMAAVADYAAQYPQVTVDMTLSDRVVELIDEGFDVAIRASPGGLKSSSLIARQIATA
FT                   HLVLCASPAYLKRHGTPKTVADLARHNYLQYAGVSALEIAPATGEASSRVRLTGNLIVN
FT                   HLEAQRVIVLQGAGIAMLGTEVIGDDLAAGRLVPLLVDDVPPRELPIYVVYASRRHLSA
FT                   KVRSFVDFLAERFANESLWPSLEQIKALAVR"
FT   gene            216029..219847
FT                   /locus_tag="Bxe_A4277"
FT   CDS             216029..219847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4277"
FT                   /product="Methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4277"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28722"
FT                   /db_xref="GOA:Q146L7"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR014348"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L7"
FT                   /protein_id="ABE28722.1"
FT                   /translation="MTDLSTPQRAGSHKLPAGRRLRFVTAAALFDGHDASINIMRRILQ
FT                   ASGVEVIHLGHNRSVDEVATAALHEDADGVAVSSYQGGHNEYFRYLVDLLRARGGERIK
FT                   VFGGGGGVIVPEEIAGLERYGVEKIYSPQDGQRLGLQGMIDDMIARCAEGARAAAATGE
FT                   SQVGAWAAEFSEHGLPRFDSRDDVGVDRQGAVARNPSSEASRVAAAGRGDHLDRGVRAA
FT                   STADTADTANTANTANTANTGSVADAADAADAADAADAADAASTASTASTASTASTAST
FT                   AGIPDPASLVFRRLAQLISAFETAAIDVNTRDKLSALAEVTAIPLLGITGTGGAGKSSL
FT                   TDELIRRFRLDYGDALTIAVLAIDPSRRKSGGALLGDRIRMNAIGDWGGGARVYMRSMA
FT                   TREASSEISDSLPDALMLCKAAGFDLIVVETSGIGQGNAAIVPFVDESLYVMTPEFGAA
FT                   SQLEKIDMLDFASFVAINKFDRKGARDALRDVAKQVQRNRADFAKSPEAMPVFGTIASR
FT                   FNDDGVTALYRHVAEALRKHGLRSGGGRLAAPEDLRFSSGRNAIVPPARVRYLADIAQT
FT                   IHAYRERADAQARLARERWQLIEARRMLVETGEAARSTVATSASPGASASSKANACTST
FT                   SSKANASPGANTTANSNASATSGTATPTDALNPTLSQLDTLITQRTASLGERERILLDT
FT                   WPEIVAAYSGTEHIVRVRDREIRTALTVATLSGSEVRKVSLPKFVDHGEILRWLMLDNL
FT                   PGYFPFTAGVFPFRRENEDPTRMFAGEGDPQRTNRRFKLLSEGMPAKRLSTAFDSVTLY
FT                   GEEPHERPDIYGKVGNSGVSVATLDDMKTLYDGFDLCAPETSVSMTINGPAPTILAMFF
FT                   NVAIDQQIARTTQRQGRPLTEDELAATRRTALENVRGTVQADILKEDQGQNTCIFSTEF
FT                   SLKVMGDIQAYFVEHGVRNFYSVSISGYHIAEAGANPISQLAYTLANGFTYVEAYLARG
FT                   MSIDDFAPNLSFFFSNGMDPEYTVLGRVARRIWAVAMRERYGANERSQKLKYHVQTSGR
FT                   SLHAQEIDFNDIRTTLQALIAIYDNCNSLHTNAFDEAITTPTEESVRRAVAIQLIINRE
FT                   WGLAKNQNPNQGSFVIEELTDLVEEAVLAEFDRLTERGGVLGAMETGYQRGRIQDESML
FT                   YEHRKHDGSYPIVGVNTFLSAHPHEAPQPIALARSTDDEKQSQLQRLRAFQAQHRDAAP
FT                   AALERLKRAVIDDENVFAVLMDVVRVCSLGQITHALFEVGGQYRRNM"
FT   gene            complement(220010..220969)
FT                   /locus_tag="Bxe_A4276"
FT   CDS             complement(220010..220969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4276"
FT                   /product="Putative 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4276"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28723"
FT                   /db_xref="GOA:Q146L6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L6"
FT                   /protein_id="ABE28723.1"
FT                   /translation="MALPAVLQKLALPVVASPMFIVSYPELVLAQCKAGIVGSFPALNA
FT                   RPAELLDEWLTQIQTQLAEHKAANPDAIIGPIAVNQIVHQSNTRLEHDVRVCVEHKVPI
FT                   FITSLRAPAREIVDAVHSYGGIVLHDVINLRHAQKALEAGVDGLILVASGAGGHAGTTS
FT                   PFALVGEVRRMFDGPIVLSGSIANGGSILAAQAMGADLAYMGTRFIATKEAHAVDSYKQ
FT                   AIVNSTASDIIYTNLFTGVHGNYIRESIVNAGLDPDALPESDKTKMNFGSDKAKAWKDI
FT                   WGAGQGVGLMDDVPSVSELVQRLSKEYDDAKARLGIAR"
FT   gene            221170..222141
FT                   /locus_tag="Bxe_A4275"
FT   CDS             221170..222141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4275"
FT                   /product="Putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28724"
FT                   /db_xref="GOA:Q146L5"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L5"
FT                   /protein_id="ABE28724.1"
FT                   /translation="MLAWAVPPRADTLASYNAVTPDHKRDVMAFENFTPFRVAVGDVDI
FT                   FGVKGGAGPPLLLLHGHPQSHLIWRKCAARLAKHFTVIATDLRGYGASGKPPSDAEHTP
FT                   YSKRVMAADQVAVMRHFGFERFLVCAHDRGARVAHRMALDHPDAVERLMLLDIAPTLAM
FT                   YEATDRTFATHYFHWFFLIQPEPLPETLIGANPAAYVDAVMGGRHAGLAPFDPAALDAY
FT                   RSALAQPGAVHAMCEDYRASASIDLEHDRADIERGHKIGCPLRVLWGDKGVIEKCFDAL
FT                   AEWRHVARDVSGRALPCGHYIPEEASDELVAEMLSFFEAVEQ"
FT   gene            complement(222507..223427)
FT                   /locus_tag="Bxe_A4274"
FT   CDS             complement(222507..223427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4274"
FT                   /product="Putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4274"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28725"
FT                   /db_xref="GOA:Q146L4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L4"
FT                   /protein_id="ABE28725.1"
FT                   /translation="MITLPESIRVFERGWLSSNNVLLLDDACAALVDTGYATHAPQTLA
FT                   LVRQALGARPLDLIVNTHLHSDHCGGNALLQATWPCRTVIPASEAGAVRDWDDTRLTFR
FT                   ATGQTCERFTFTGTIAPGAQLRLGALDWKVLGAPGHDPHSLMLYCAGERILISADALWE
FT                   NGFGVIFPELEGESGFAEEQAVLEAIAKLDVRLVIPGHGAPFTNVEQALERAFSRVAWL
FT                   RADPARNAKNALKVLIVFKLLEVRAMRFDTLLQMLDDAAVMRAAATMLKPRGEWPALVK
FT                   NIVEELAARNGPLEVDGERVVARAA"
FT   gene            complement(223424..223903)
FT                   /locus_tag="Bxe_A4273"
FT   CDS             complement(223424..223903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4273"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4273"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28726"
FT                   /db_xref="GOA:Q146L3"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L3"
FT                   /protein_id="ABE28726.1"
FT                   /translation="MNAAPRIVTIGETFSSTLELSAESVKSFASLVNDHNPLHHDEAYA
FT                   AQSRFGGLIASGTQPTAHFMALLATHFSTYAQPLGLEFDIKLKKAVRANDTLTITWRVK
FT                   DAYWKPSLNGDLTQLEGTVVNQRGDTMLTGSSTILVMPKSEAAANTHANAAPNSP"
FT   gene            complement(223900..224145)
FT                   /locus_tag="Bxe_A4272"
FT   CDS             complement(223900..224145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4272"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4272"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28727"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L2"
FT                   /protein_id="ABE28727.1"
FT                   /translation="MTVTMTTMTAGLDNEDDRAVPSPCINVCRMDASTGWCEGCLRTID
FT                   EIAGWSLLDGDAKRAVWDAIHVRHAKLVANLPKVPR"
FT   gene            complement(224150..224671)
FT                   /locus_tag="Bxe_A4271"
FT   CDS             complement(224150..224671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4271"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4271"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28728"
FT                   /db_xref="GOA:Q146L1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L1"
FT                   /protein_id="ABE28728.1"
FT                   /translation="MTDHASPETDDLTALPDSARRVALLLRERGHAGRIVMLPETGKTS
FT                   AEAAAGLGCSVAQIAKSILFRRREDDAPVLVVASGANRVDEKKVAAQVGEIGRADAKFV
FT                   REKTGYAIGGVCPIGHATEPVTLIDADLLELDSLWAAAGHPHAVFNLTAQELIALTGAP
FT                   VVDVALRETA"
FT   gene            complement(224738..225667)
FT                   /locus_tag="Bxe_A4270"
FT   CDS             complement(224738..225667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4270"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4270"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28729"
FT                   /db_xref="GOA:Q146L0"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:Q146L0"
FT                   /protein_id="ABE28729.1"
FT                   /translation="MALPQQVKIVEVGPRDGLQNEKEFVPTATKIELINRLSAAGFRNV
FT                   EAASFVSPKWVPQMADGADVMAGIERRPGTIYSVLTPNLRGFEGALAARADEIVIFGAA
FT                   SEAFSQKNINCSIAESIGRFAPVAQAAKEHGVRIRGSVSCALGCPYQGEVPVASVVDVV
FT                   ERFAALGCDEIDIADTIGVGTPKRTREVFEAVTRVFPRERLSGHFHDTYGQALANIYAA
FT                   LLEGIEIYHASVAGLGGCPYAKGATGNVATEDVLYLMNGLGIETGIDLAQVVAIGDFIS
FT                   TSIGRPNVSRAGKALLAKARSEAAANCV"
FT   gene            complement(225734..226675)
FT                   /locus_tag="Bxe_A4269"
FT   CDS             complement(225734..226675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4269"
FT                   /product="Putative 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4269"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28730"
FT                   /db_xref="GOA:Q146K9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K9"
FT                   /protein_id="ABE28730.1"
FT                   /translation="MKILFYMPHADATAWLNDFARALPAADLREWQPGDTAPADFAVVW
FT                   RPPREMLAGRDDLHAIFNLGAGVDAILALEHAQPGTLPRNAQLIRLEDTGMAPQMAEYV
FT                   AHAVLRYLRRFDEYQTLQAERRWQVLEPHPRETFTVGVLGLGVLGAHVAQAVAAFGVPV
FT                   RGYSRSPRQIDGIQTFAGEAQFDAFLDGVKVLVNLLPHTPDTGDMLNARTFAKLARGAY
FT                   LINVARGGHLVEQDLLDALASGQLTAATLDVFREEPLPPDHPFWREPRITITPHVSALT
FT                   LREESVVQVARKITALARGDTVGGVVNLERGY"
FT   gene            complement(226801..227043)
FT                   /locus_tag="Bxe_A4506"
FT   CDS             complement(226801..227043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28731"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K8"
FT                   /protein_id="ABE28731.1"
FT                   /translation="MIVAPGAVWANQVFVLWLWDKYAGKCTDERADKKRDPMHGRIRTR
FT                   MRPQSSARYGPADGKPSPEPHARAQTRAMRVEKVE"
FT   gene            227073..227675
FT                   /locus_tag="Bxe_A4268"
FT   CDS             227073..227675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4268"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28732"
FT                   /db_xref="GOA:Q146K7"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K7"
FT                   /protein_id="ABE28732.1"
FT                   /translation="MLSCTRSTWPPRLVTVPGLHGSEGAHWQTWLERQFARSLRVEQAD
FT                   WDAPDLALWSRSLRDLLARERGPFVLAAHSFGCLAAAHALQQAPYANDVVGVLFVAPAS
FT                   PQKFAFAGAFDARRLGVPSILIGSQTDPWMSLAGARDLAQRFGSAFVNLGDAGHINTAA
FT                   GFGPWPRAKYFVDTLVHCAAPLRFREESIEAAQHAFI"
FT   gene            227809..228834
FT                   /locus_tag="Bxe_A4267"
FT   CDS             227809..228834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4267"
FT                   /product="Putative ABC sulfate transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28733"
FT                   /db_xref="GOA:Q146K6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K6"
FT                   /protein_id="ABE28733.1"
FT                   /translation="MAGKTGTSRWLAAGMTAMTLALAGVPAAHAETSLLNVSYDVTREL
FT                   YKDINAGFIAAYKQKSGETVSIRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAEK
FT                   GQLLPANWRTRLPNDSVPYTTTMVFLVRKGNPKHIKDWDDLARPGVQVIIANPKTSGNG
FT                   RYTYLAAWGYRKQHGGTDAQALDFEKAIFKNVPVLDTGGRGATTTFTQRGIGDVLVTFE
FT                   NEVALMDTGVGGGNFEAVYPSVSLLAAPPVSIVDKVVDKRGTRKEAQAYLDYLWSPAAQ
FT                   EIIAQHHLRPQDKTVLAKHASEFKAIKTFTVEEMFGGWQKAQQTHFSDGGTFDQIIVDK
FT                   K"
FT   gene            complement(228924..230006)
FT                   /locus_tag="Bxe_A4266"
FT   CDS             complement(228924..230006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4266"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4266"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28734"
FT                   /db_xref="GOA:Q146K5"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146K5"
FT                   /protein_id="ABE28734.1"
FT                   /translation="MTQLNIAPASTDTAAASNNNAAAGTKQLARWRVADIVSLYELPFN
FT                   DLMFQAQQTHREHFDANTVQLSTLLSIKTGGCEEDCAYCPQSVHHDTGLQADKLMPVDE
FT                   VLAAAKVAKENGATRFCMGAAWRNPKDRHLEPIKDMIRGVKAMGLETCVTLGMLETHQA
FT                   QGLREAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLERVRDAGINVCCGGIVGLGES
FT                   RRERAGLIAQLANMDPYPESVPINNLVQVEGTPLTGTEAIDPFEFVRTIAIARITMPRA
FT                   MVRLSAGREQMNEALQAMCFLAGANSIFYGDQLLTTSNPQAEADRKLLERLGIRAEAAQ
FT                   QMPLDQSGCEHGCDKHAAPN"
FT   gene            complement(230041..230778)
FT                   /locus_tag="Bxe_A4265"
FT   CDS             complement(230041..230778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4265"
FT                   /product="Dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4265"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28735"
FT                   /db_xref="GOA:Q146K4"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K4"
FT                   /protein_id="ABE28735.1"
FT                   /translation="MSSTSQNALSLFITGTDTEIGKTFVSAALLRGFVREGLQAAAMKP
FT                   VAAGAFELDGALHNEDADQLDAASNVLLPPEIRTPYLLKEPAAPHIAAALENVTLDLGH
FT                   IVDCHAQALKRAEIVVVEGVGGFRVPLTAAQDTADLAVALELPVVLVVGMRLGCISHAL
FT                   LTAEAIAARGLTLAGWVANRIDPDMTFPDENIASIREHLARAYDAPLLGIVPHLNPASP
FT                   ELAAEQLDINRLLQTLRHAHAQR"
FT   gene            complement(230775..231959)
FT                   /locus_tag="Bxe_A4264"
FT   CDS             complement(230775..231959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4264"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28736"
FT                   /db_xref="GOA:Q146K3"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146K3"
FT                   /protein_id="ABE28736.1"
FT                   /translation="MHLLDTLAEGLKEIDARGLRRRRRTADTPCAAHMTVDGRAIIGFA
FT                   SNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGGFVENA
FT                   RALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALS
FT                   AMLEASDADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRG
FT                   AIAQAALRSPNLISIGTLGKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHA
FT                   VSASLRIIGGEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIGANDATLEI
FT                   AATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA"
FT   gene            complement(231959..233317)
FT                   /locus_tag="Bxe_A4263"
FT   CDS             complement(231959..233317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4263"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28737"
FT                   /db_xref="GOA:Q146K2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K2"
FT                   /protein_id="ABE28737.1"
FT                   /translation="MEKSAPPPAPEDWIARSLRAVWHPCTQMKHHERLPLVPVARGQGA
FT                   WLYDRAGHRYLDAISSWWVNLFGHANPRINAALKDQLDTLEHAMLAGCTHEPAIELAER
FT                   LSALTGNTLGHAFFASDGASAVEIALKMSFHSWRNRGFADKQEFVCIANSYHGETIGAL
FT                   GVTDVALFKDAYDPLIRHAHVVASPDARLAQAGETAADVARRALDHVRSLFEARATKIA
FT                   ALIVEPLVQCAAGMAMHDASYIAGLRTLCDQYGVHLIADEIAVGCGRTGTFFACEQAGI
FT                   WPDFICLSKGISGGYLPLSIVLSRDEIFEAFYHDDTARGFLHSHSYTGNPLACRAALAT
FT                   LDLFAADNVIAVNAQKSAKLKAALAPLAEHEQVRNLRQCGTIFAFDALIDDAQQARTFS
FT                   RRFFENALRRELLLRPIGTTVYLMPPYILDDEELALLASRTRETFDATLAETR"
FT   gene            233584..234330
FT                   /locus_tag="Bxe_A4262"
FT   CDS             233584..234330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4262"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28738"
FT                   /db_xref="UniProtKB/TrEMBL:Q146K1"
FT                   /protein_id="ABE28738.1"
FT                   /translation="MGFTGGNWGGGWFFVCAGLCVCVPGGLAFPCIHGGLLALPLCGAA
FT                   PTFFAAAKKVGKESRFTPPTLKRVPWLGGDSGASGICVVAHSALVTRPSYFPPRTACSP
FT                   ERSGKTSVVRVWGVGFGSAWRRKVSRACVQTAHRTTAVMEAPSANSRGRQRLRRLSRKE
FT                   QAATLKARFAPVATGEQRDIARARGNQRFEKRRAQEVSGKISPVREATTGFNELPRRRA
FT                   QRRRKNDGLVTKAECATTQIPDGPLP"
FT   gene            234480..235619
FT                   /locus_tag="Bxe_A4261"
FT   CDS             234480..235619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4261"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4261"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28739"
FT                   /db_xref="GOA:Q13U47"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q13U47"
FT                   /protein_id="ABE28739.1"
FT                   /translation="MPWNPRDTMNLRLEFVQLASQEGANRRELCRRFGISPKTGYKWLD
FT                   RHAKGGDTALTDHSRRPQQSPARTPPSVEQRVVELRRAHPAWGGRKISRRLCDLGQTDV
FT                   PAPSTVTDILHRHGLIEPAASAAATAWQRFEHAQPNDLWQMDFKGWFDLQDGRHCSPLT
FT                   MLDDHSRYNVTLDACISTDTRIVQHHLERTFRRYGLPLRINADNGSPWGSPSQPGQLTE
FT                   LAIWLIRLGVRLSHSRVAHPQTNGKEERFHRTLKAEVIAGRHFRDLRSAQQAFDEWRSV
FT                   YNHQRPHQALDMATPVTRYRPSPRAYPESLPPIEYGANDHVQYVKWNGELRFRKQRFKV
FT                   SSALHNLPVAIRERVGEENCYDLFFAHHRFGTINLSPQE"
FT   gene            complement(235834..237123)
FT                   /locus_tag="Bxe_A4260"
FT   CDS             complement(235834..237123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4260"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4260"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28740"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J9"
FT                   /protein_id="ABE28740.1"
FT                   /translation="MVFSKVLTKCAVICAAATCMVTLAHADPLTDTQAGPLTRARVPRI
FT                   ALDDDVYLPTAGLNEQIIRVPVDAAGTVTLETTIYKPDGAGPFPMIVFNHGKIPGDPRS
FT                   QERSDPLPFAREFVRRGYVVVAPNRQGFGHSDGVYQQDGCDVEKNGIGQAGDVAATIDF
FT                   MSKQPYVDATHIVVAGTSHGGLATMAYGTEAAPGVRALINFSGGLRQDACSDWQGNLTR
FT                   AFGAYGEKTRVPSLWMYGDNDSVWNAPLVAGMYAAYGAHGASAKMVDFGSYKNDAHRLV
FT                   GDRDGVHVWWPAVEAFLARVGMPTGVQYRVADPSMPKASGFAAVDAVDSVPFVDEAGRN
FT                   GYRNFLHQYPSRAFAVSDTGAWSWAEGGDDPMSVAVANCQKQSSAPCRLYAVNNSVVWG
FT                   EQSSQTAEGGAGAGSGAGGVDGRRDVASRE"
FT   gene            237370..237660
FT                   /locus_tag="Bxe_A4259"
FT   CDS             237370..237660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4259"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28741"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J8"
FT                   /protein_id="ABE28741.1"
FT                   /translation="MPGRASCAICGVGMNRLSQRDVMKLRPYPGTTILFCAIKENPRRK
FT                   ICRAPICRLRPLDAGLAGVWCNEAIRRGAGVVASSQHEKMALLSGPYVSAA"
FT   gene            complement(237694..238143)
FT                   /locus_tag="Bxe_A4258"
FT   CDS             complement(237694..238143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4258"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4258"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28742"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J7"
FT                   /protein_id="ABE28742.1"
FT                   /translation="MNKQLLPLQRPSDCPCGGAAPDQRSGARAPRFAQCCGRYIDGGEA
FT                   APRAHELMRSRYSAYVVGATDYLRATWAAHTCPADLDADPAAPDAPRWLGLQIKAFAET
FT                   DAHHATVEFVARYKVGGRAHRLHELSRFVRGEDGRWRYVDGDVSE"
FT   gene            complement(238151..239281)
FT                   /locus_tag="Bxe_A4257"
FT   CDS             complement(238151..239281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4257"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28743"
FT                   /db_xref="GOA:Q146J6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J6"
FT                   /protein_id="ABE28743.1"
FT                   /translation="MVLDQDHLMVRDALRTFVREAITPHAATWDRERTFPKDVHRQLAQ
FT                   LGAYGVLVPETYGGAGMDALALALILEEIAAGDGGTSTAISVNNCPVCSILLTYGNDAQ
FT                   KREWLTPLARGDMLGAFCLTEPQAGSDASALRTTATREGDEYLLNGVKQFITSGRNGHV
FT                   AIVMAVTDKAAGKRGISAFIVPTDTPGYVVARVEDKLGQHSSDTAQIIFEDCRVPAANL
FT                   IGAQGEGYRIALSGLEGGRIGIAAQSVGMARAAFEAALSYAKERESFGVPLFSHQAVQF
FT                   RLADMATQLEAARQLIWHAASLKDAGQPCLTEAAMAKLFASEAAERICSAALQIHGGYG
FT                   YLSDFPVERIYRDVRVCQIYEGTSDIQKILIARGLG"
FT   gene            complement(239446..240123)
FT                   /locus_tag="Bxe_A4256"
FT   CDS             complement(239446..240123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4256"
FT                   /product="Putative short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28744"
FT                   /db_xref="GOA:Q146J5"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J5"
FT                   /protein_id="ABE28744.1"
FT                   /translation="MKTVLIVGASRGIGQEFVRQYKKSGWRALATARDGAALDALNELG
FT                   AETFSLDVSMPEEIAALGWKLDGERLDAAILVSGVYGPRTEGIETITAEDFDHVMHTNV
FT                   RGPMQLMPILLPLVEEAGGVFAVISSKMGSIGDASGTTGWLYRASKAALNDALKLASLE
FT                   AKRAACISLHPGWVRTDLGGAQAAIDPARSVTGMREVLAQAATEHEAFNGRFYQYDGTL
FT                   LDW"
FT   gene            complement(240168..241376)
FT                   /locus_tag="Bxe_A4255"
FT   CDS             complement(240168..241376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4255"
FT                   /product="Putative acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28745"
FT                   /db_xref="GOA:Q146J4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J4"
FT                   /protein_id="ABE28745.1"
FT                   /translation="MSETHMSGTKADPIVIVGVARTPMAAFQGDFATLSAPQLGSVAIQ
FT                   AAVQRAGLKPEQIDEVVMGCVLPAGLGQAPARQAALGAGLPLATGSTTVNKMCGSGMRA
FT                   AMFAHDMLAAGSVDVIVAGGMESMTNAPYLLPKARAGMRMGHGQVIDHMFYDGLEDAYE
FT                   KGRLMGSFAEECAASFDFTREAQDAFAVESLARAKRANEDGSFAWEIAPVKVESRKGEV
FT                   TIDRDEQPFKANIEKIPTLKPAFSKTGTVTAANSSSISDGAAALVMMRESTAKRLGVQP
FT                   IARVVGHSTLAQEPAKFTTAPVGAIRKLFEKNGWRADEVDLFEVNEAFAVVTMAAMKEH
FT                   HLPHEKVNVNGGACALGHPIGASGARILVTLIGALKKRGGKRGVATLCIGGGEATAMGI
FT                   ELV"
FT   gene            complement(241369..242145)
FT                   /locus_tag="Bxe_A4254"
FT   CDS             complement(241369..242145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4254"
FT                   /product="Putaive carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28746"
FT                   /db_xref="GOA:Q146J3"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J3"
FT                   /protein_id="ABE28746.1"
FT                   /translation="MNTNASPPDNPLSHLFDNNEAWVARKLSEDPEYFSRLAHQQTPEY
FT                   LWIGCSDSRVPANQIIGLPPGEVFVHRNIANVVVHTDLNCLSVIQFAVDLLKVKHIMVV
FT                   GHYGCSGVGAALHGRRVGLADNWLHHVQDVRTKHAALIEEWPIGEARHRRLVELNAIEQ
FT                   VMNVCRTTIVNDAWARGQELTVHGWAYGVHDGKVRNLGMTIREPGALDATYQKCVAAVS
FT                   AGGAHNADNDVVAADAAQLGDVPAIVEGVIKELKHE"
FT   gene            complement(242240..244078)
FT                   /locus_tag="Bxe_A4253"
FT   CDS             complement(242240..244078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4253"
FT                   /product="(Isocitrate dehydrogenase (NADP+)) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28747"
FT                   /db_xref="GOA:Q146J2"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146J2"
FT                   /protein_id="ABE28747.1"
FT                   /translation="MNHFPKLLSSQIGFDVAQTMLEGFDRHYRIFRDAAIHAKTLFEQA
FT                   DWHGLQKLARDRITSYDERVEECVELLEDEYDAENIDDEVWQQIKLHYIGLLTTHRQPE
FT                   CAETFFNSVCCKILHRSYFSNDFIFVRPAISTEYIENDEPAAKPTYRAYYPGKDGLAAT
FT                   LERIVTNFQLEPPFEDLTRDVGCVMQAIQDAFGVFDEAPNFQIHVLSSLFYRNKSAYII
FT                   GRIINGDLLMPFAVPLRHVKPGVLALDTVLLKRDQLLIIFSFSHSYFLVDMEVPSAYVE
FT                   FLGTIMQGKPKAEIYTSVGLQKQGKNLFYRDLLHHLSHSSDQFIIAPGIKGLVMLVFTL
FT                   PSFPYVFKLIKDSFPPPKETTRAQIKEKYQLVKRHDRLGRMADTLEYSSVALPVSRLDE
FT                   ALVRELEKEVPSLIEYDGDSLVIRHMYIERRMVPLNLFLQNGNDEDIEHGIKEYGNAIK
FT                   ELMQANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNVRAVPAPRNEEDEMSGEPW
FT                   YSVGPHDIFPETYGTFLLGDPRVRRSFMQHHADFFDPALWQRHKDHLLKGELADFFPYD
FT                   GSVRFCMRYPERFADAAGAASNEQDAPDAGRSVRAA"
FT   gene            complement(244164..244568)
FT                   /locus_tag="Bxe_A4252"
FT   CDS             complement(244164..244568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4252"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4252"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28748"
FT                   /db_xref="GOA:Q146J1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J1"
FT                   /protein_id="ABE28748.1"
FT                   /translation="MNTQYTITELAREFDVTPRAIRFYEDQGLLSPSREGSSGLRRVYS
FT                   GRDRTRLKLTLRGKRLGFTLSEIRDLLDVYESPTDTVPQLHAFLATVARHREVLERQLE
FT                   DLNATLEDLAQYETQARALLETGTREARPA"
FT   gene            244756..245829
FT                   /locus_tag="Bxe_A4251"
FT   CDS             244756..245829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4251"
FT                   /product="Putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4251"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28749"
FT                   /db_xref="GOA:Q146J0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q146J0"
FT                   /protein_id="ABE28749.1"
FT                   /translation="MNALEHQLDYPFNDALPDPGHAMEVAPGVFWLRMPLPFALDHINL
FT                   WLLRDEIDGQQGWTVVDCGIASDTIRENWEKVFDSVLDGLPVLRVIVTHCHPDHIGLAH
FT                   WICAGGDKKRWDVRLWTTLGEYMQARVMAAGDGSNAGGEGAARHFARHGVTDEESLEKL
FT                   RNRKSYYSSLVPEIPGQYRRLREADGVKIGGKTWRVVTGFGHSPEHCALFCEETGVLIS
FT                   GDMVLPRISTNVSVFDMEPEGSPLALYLESLGRYETMPEDTLVLPSHGKPFRGVRTRIR
FT                   QLREHHDARLAEVREACAEQPQSAADIVPLMFKRQLDIHQMTFAMGEALAHLHLLWLAG
FT                   ELKRKQDADGVIRFSPA"
FT   gene            complement(245908..247494)
FT                   /locus_tag="Bxe_A4250"
FT   CDS             complement(245908..247494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4250"
FT                   /product="Putative ABC peptide transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28750"
FT                   /db_xref="GOA:Q146I9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I9"
FT                   /protein_id="ABE28750.1"
FT                   /translation="MRFKLLAAAVLFTAPALVLAKPLTVCTESSPDGFDVVQFNSLVTT
FT                   NASADVIFNSLVSYDEAAKKVVPALADKWDVSADGLTYTFHLRPNVQFQTTDYFKPTRP
FT                   LNADDVVFTFERMLDDSNPWHKVAGASGFPHAQSMGLPKLIKSISKVDDNTVKFELNAP
FT                   DATFVSILTMGFASIYSAEYADQLLKAGKQADLNSKPIGTGPFELKSYTKDAVIRYDVN
FT                   PAYWGPKPKIDRLIYAITPDATVRAQKVKAGECQIALSPKPQDLAEAKSDKSLAIVQTP
FT                   AFMTAFVALNTQKKPLDNQKVRAALNMAFDRTTYLKTVFDNTATPAVNPYPPNTWSYNK
FT                   SVKAWPYDPAKAKKLLADAGYPNGFETTIWVRPNGSVLNPNPKAGAELLQADFAKIGVK
FT                   AEVKVIEWGELIKEAKQGQHDSLFMGWAGDNGDPDNYLSPLFSCNAVKSGINFARFCDQ
FT                   DLDKLIADGKATPDQSKRAKAYEQAQQVIHDQALWIPLGYPTAAAITRTNVSGYHVSPF
FT                   GRQNFGTVSVQ"
FT   gene            complement(247755..248573)
FT                   /locus_tag="Bxe_A4249"
FT   CDS             complement(247755..248573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4249"
FT                   /product="Putative ABC Fe+3/siderophore transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4249"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28751"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I8"
FT                   /protein_id="ABE28751.1"
FT                   /translation="MQPGAVDAAGVAHEPAGPAARIVSLVPSITELLFALGLDRQIVGR
FT                   TGFCVHPHDKARQVRKVGGTKAVNPDAIRALRPTHLIVNIDENERDTVEQLRGFVPHIV
FT                   VTHPQTPRDNLALYTLLGAIFDRAREAERLGEALEARLHEAAAHAFTPQNVLYLIWREP
FT                   WMTVARDTYISAMLRLVNWHTLPDVQGGTAGAGRYPALDFDSAPWLARVERVLLSSEPY
FT                   RFTQTHCDALKRDARLAGKRIELIDGEMVSWYGVRAIEGIAYLLRRAAAA"
FT   gene            complement(248577..249356)
FT                   /locus_tag="Bxe_A4248"
FT   CDS             complement(248577..249356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4248"
FT                   /product="Putative short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4248"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28752"
FT                   /db_xref="GOA:Q146I7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I7"
FT                   /protein_id="ABE28752.1"
FT                   /translation="MSSPLKVFITGASSGIGLALAAEYARRGAVLGLVARRGDALAAFQ
FT                   QSHPQSTVSTYSVDVRDAEALADAAAQFIAQHGLPDVVIANAGVSRGAVTGHGDLRTFR
FT                   EVMDINYFGMVATFEPFAAAMSAARHGTLVGIASVAGVRGLPGSGAYSASKSAALKYLE
FT                   ALRVEMRPHGVGVVTIAPGYIRTPMTEHNPYTMPFLMDADRFAVKVAQAIERQTAFAVF
FT                   PWQMRIVAMLLHVLPRWLYDRAFERAPRKPRTAAEVE"
FT   gene            complement(249372..250010)
FT                   /locus_tag="Bxe_A4247"
FT   CDS             complement(249372..250010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4247"
FT                   /product="Putative thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4247"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28753"
FT                   /db_xref="GOA:Q146I6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I6"
FT                   /protein_id="ABE28753.1"
FT                   /translation="MKKLLSILFLSLGLVAATAHASPAAPVSGKDYTVLPTAQPTDVPA
FT                   GKIEVTEFFWYGCPHCNEFNPYLEAWVKKQAPDVVFKRVPVAFRDDFIPHSRMYHALDA
FT                   LGLATQLTPKVFNEIHVNKDYLLTPEDQSKFLAKNGVDPKKYMDAYNSFSTQSALQKDK
FT                   KLLEDYKIDGVPTLAVQGKYETGPAATNSLPGTIQVLDYLVAQVRAKKM"
FT   gene            complement(250182..250979)
FT                   /locus_tag="Bxe_A4246"
FT   CDS             complement(250182..250979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4246"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4246"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28754"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I5"
FT                   /protein_id="ABE28754.1"
FT                   /translation="MAKPRRTTKQSKQTGGTFLGIVLGLIVGLAIAVVVALYITRAPTP
FT                   FVSKVAPPAASDSGASQPQYDPNRPLQGKTPGQPVPQAAQPAPPNTAPGQTNAQTQSGM
FT                   LEEPQIVEVPPANGNAGNANGTAVAPKPAQDNGTGTAAAPVKKPQAASAPAATAAGAAP
FT                   KGGSSTAANARPGSGAAPAAGDANTGYFLQVGAYKTAADAEQQRARLAFQGFESKVTQR
FT                   DAGGVTYYRVRIGPFSKFEDMNSSRQRLSDAGVDTAVIRFTKQ"
FT   gene            complement(251059..252849)
FT                   /locus_tag="Bxe_A4245"
FT   CDS             complement(251059..252849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4245"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28755"
FT                   /db_xref="GOA:Q146I4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146I4"
FT                   /protein_id="ABE28755.1"
FT                   /translation="MLPAHKHTLETLLADTVKQVALASQGASEAAFVSPTITLERPKVA
FT                   AHGDVACNVAMQLAKPLRANPRQLAQQIVDALLAQPGARDLVEAAEVAGPGFINLRLTA
FT                   AAKQAVIAAVFAEKERFGRSQRDAGKHVLIEFVSANPTGPLHVGHGRQAALGDALSNVL
FT                   ASQGWDVHREFYYNDAGVQIQTLALSTQARARGLAPGDEGWPASAYNGEYIADIAKDYL
FT                   NGATVAASDGEPVTGARDVEDLEAIRRFAVAYLRREQDMDLQAFGVKFDQYYLESSLYK
FT                   EGRVEKTVAALIAAGKTYEQEGALWLRTTDDGDDKDRVMRKTDGTYTYFVPDVAYHVAK
FT                   WERGFTKVINIQGSDHHGTIARVRAGLQGLGIGIPKGYPDYILHKMVTVMRNGEEVKIS
FT                   KRAGSYVTVRDLIEWSGGATPGSEVDVDLIDEETIRRGRDAVRFFLISRKADTEFVFDI
FT                   DLALKQNDENPVHYVQYAHARICSVIAECKARYNMDESTLADVDVTPLTSERAMALLNK
FT                   LAEFPDMLQHAADELAPHAVAFYLRDLAGEFHSFYNDKAERVLVDDAAERNARVALLAA
FT                   TRQVLANGLATIGVSAPVKM"
FT   gene            253307..253633
FT                   /locus_tag="Bxe_A4244"
FT   CDS             253307..253633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4244"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4244"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28756"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I3"
FT                   /protein_id="ABE28756.1"
FT                   /translation="MLITFKCRACPDVMMLENLAQFLVGIVGKRLGERGVITHDELSPA
FT                   IEKLEAAISVDKQERAEHDGHFHEGEDGHEHHEIPPGLAQRAYPFLDMLRAAQKENADI
FT                   VWGL"
FT   gene            complement(254162..256879)
FT                   /locus_tag="Bxe_A4243"
FT   CDS             complement(254162..256879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4243"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4243"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28757"
FT                   /db_xref="GOA:Q146I2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I2"
FT                   /protein_id="ABE28757.1"
FT                   /translation="MTDHTLRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNDQ
FT                   FDDAIAVARQQVENGAQIIDVNMDEAMLDSKAAMVRFMNLIASEPDIARVPIMIDSSKW
FT                   EVIEAGLKCVQGKAIVNSISLKEGEEAFRHHANLIRRYGAAAVVMAFDEQGQADTFERK
FT                   TQICKRSYDFLVNEVGFPPEDIIFDPNIFAIATGIEEHNNYAVDFINATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGQLGVYADLDPELRER
FT                   VEDVVLNRREDGTDRLLEIADKFKTGAAKKEENLEWRNQPVEKRLSHALVHGITNFIVE
FT                   DTEEVRAKIAAEGGRPINVIEGPLMDGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHL
FT                   IPYIEEEKKQLAEAGADVRAKGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMV
FT                   SCNDILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDDYFRIKKIPLLIGGATTSR
FT                   VHTAVKIAPHYEGPVVYVPDASRSVSVASSLLSDEGAAKYLDELKSDYDRIRDQHANKK
FT                   ALPMVTLAEARANKTRVDWASYQPVKPKFIGRRVFRNFDLAELATYIDWGPFFQTWDLA
FT                   GPYPAILNDEIVGESARRVFSDGKSMLARLIQGRWLQANGVIALLPANTVNDDDIEIYT
FT                   DESRSEVALTWRNLRQQSVRPVVDGVMRPNRSLADFIAPKDSGVADYIGMFAVTAGLGV
FT                   DVKEKQFEKDHDDYSAIMLKALADRFAEAFAEALHARVRRDLWGYANDETLSTDELIAE
FT                   KYRGIRPAPGYPACPDHLVKRDMFNVLHATEIGMSVTESLAMLPAASVSGFYLAHPDST
FT                   YFSVGKIGQDQLEDYARRMSLSKTDAERALAPLL"
FT   gene            complement(256884..257588)
FT                   /locus_tag="Bxe_A4242"
FT   CDS             complement(256884..257588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4242"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28758"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I1"
FT                   /protein_id="ABE28758.1"
FT                   /translation="MVELIIVGEGQTEETFVRDVLAPALGANHVYASARLISTSREQRG
FT                   GALSLERVRKFIGHTLRQRADTYVTTLIDLYGLDKSFRGVMASKGQTPATRAAHIERLL
FT                   HEDVVGFAECRPERFIPHVQPHEFESLLFSDVTRLCDVEPEWHEQSDPLIAARAAVDDP
FT                   EWINDSPQTAPSKRLERLQPRYRKVRHGPLAAARIGLDRIREQCPHFRQWYDRIVTLPA
FT                   LQAQQPNIEYTS"
FT   gene            complement(257588..258682)
FT                   /locus_tag="Bxe_A4241"
FT   CDS             complement(257588..258682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4241"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28759"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146I0"
FT                   /protein_id="ABE28759.1"
FT                   /translation="MAGVTKLTIAGFKSIRELRDFELRNLNVLIGANGAGKSNFIGFFK
FT                   LLAEMYERRLQLFVQQQGGSDTLLHFSRKLTDKIEGELNFGTDYDHYRFELVVTNDNRL
FT                   IFTNEQYWLHSRGSRPGEVGLLGGNKDESDLKKLAAQQKSPLIDDILNSTRVYHFHDTG
FT                   EKAKVKQPHALNDTLRLKVDGANLAAYLRMLKTEHAESYRQIVDTIRLVAPFFDDFVFR
FT                   ADSASKIQLEWTERGDPDTPFTAHALSDGTLRFICLGTLLLQPWELMPATILIDEPELG
FT                   LHPYAINLLADLLKRASEQKQLIVSTQSVELLDRLEPEDVIVVDRKDNASTFHRLDAVQ
FT                   LQDWLDDYSLGDLWKQNVLGGRPA"
FT   gene            complement(258714..259793)
FT                   /locus_tag="Bxe_A4240"
FT   CDS             complement(258714..259793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4240"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28760"
FT                   /db_xref="GOA:Q146H9"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H9"
FT                   /protein_id="ABE28760.1"
FT                   /translation="MNQPAQTATPVRPDAAYTRGAALPALLKSRILILDGAMGTMIQRY
FT                   KLDEARYRGERFKDYGRDIKGNNELLSITQPQIISEIHEQYLAAGADIVETNTFGATTV
FT                   AQADYGMEALAVEMNLESAKLARAACDKYSTPDKPRFVAGAIGPTPKTASISPDVNDPG
FT                   ARNVTFDELRAAYYEQARALLDGGVDLFLVETIFDTLNAKAALFALDELFEDTGERLPI
FT                   MISGTVTDASGRILSGQTVEAFWNSLRHAKPLTFGLNCALGAALMRPYIAELAKLCDTY
FT                   VSCYPNAGLPNPMSDTGFDELPADTSGLLKEFAQAGLVNIAGGCCGTTPEHIAAIAQAL
FT                   AGVKPRVWANYRETDTETV"
FT   gene            complement(260087..260344)
FT                   /locus_tag="Bxe_A4239"
FT   CDS             complement(260087..260344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4239"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28761"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H8"
FT                   /protein_id="ABE28761.1"
FT                   /translation="MQMIYNSPNYCVVEFPPQEGPLAMKSGGYEIVDKNMQREIYIDGA
FT                   MAARFREHVQKLIEEEPSLDEVDEFLGQFDSLMHQPVILH"
FT   gene            complement(260463..261251)
FT                   /locus_tag="Bxe_A4238"
FT   CDS             complement(260463..261251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4238"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4238"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28762"
FT                   /db_xref="GOA:Q146H7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H7"
FT                   /protein_id="ABE28762.1"
FT                   /translation="MQVNINGIETRYVLSNEGGGPWLTFAHQLGGDLSVWDQLAGYFRD
FT                   DYTVLRYDLRGHGKTAISGAPFSVADLSHDLAALLDALDAPHTHLVGMSMGGMVAQQFA
FT                   LDHPTRVDTLTIADSSAGTLPEARASWDQRAAAARSDGMAPLVPATLNRWLTADFQSAH
FT                   PEAVEQIRDVLLQTLSEGYARACEALRDFDVRSKLATIRCPTLTVAGRHDTGTPPAATQ
FT                   AIADAIEGARFELLDAAHLAPVEQSHRFAALLETFLERPV"
FT   gene            complement(261435..262736)
FT                   /locus_tag="Bxe_A4237"
FT   CDS             complement(261435..262736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4237"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28763"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H6"
FT                   /protein_id="ABE28763.1"
FT                   /translation="MSTAPAARRSDRTPPSGPRTGWRAGRWIAVLLIVAVLHWIAAQWV
FT                   ERNRATLNPSDDGHVPVQVALLTPERVERNPAAAASSTPEPAPARRTAAHKPREPVLTA
FT                   LQPAKQAAPATPAATSDAVASAPDAAGANAAPNAAAGAASTAASAPAPASAPQASPGVK
FT                   FSVPPSGELQYDTFYNGVRNQPGTIHWTSSAQSYEMVVSVPLPFVGTFVYSSHGRIDAF
FT                   GLAPDQYIEKRGRRAEDIAIFNRTDRKIAFTRTPAALPLPDGAQDRFSMVMQLASLVRG
FT                   DPAAYKPGVTRQFFVVDNDSGENWPVETIGDETIRTDQGFLDTRHFKRLPRRDGDLRRI
FT                   DVWLAPSLGWLPARIVQTEPNGTQFELVWRGKLNAGNAGSPPENNGDAGAASPDNPGGS
FT                   SPSASPAVTPGAAPSSPSPVDSTSPADTPGIIKP"
FT   gene            complement(263031..263930)
FT                   /locus_tag="Bxe_A4236"
FT   CDS             complement(263031..263930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4236"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4236"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28764"
FT                   /db_xref="GOA:Q146H5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H5"
FT                   /protein_id="ABE28764.1"
FT                   /translation="MPPTARSGAIRTDADAAEPLDTPESDDENAETGEEKLRSGIQSIE
FT                   VGFRLLDVLTHEPRAMMLRDLAQRAGMSPAKAHRYLVSFLRLGVVSQDALSGRYELGGF
FT                   ALQLGLARLARVDGVKLARIALSELRDRLDLTVGIAVWGNQGPTMVHWMESSYPAKASL
FT                   KLGDVMPLLSSATGLLFAAYLPSSKTAAMLERELADSRRSSHTGGPRTRDEVEQVLAQV
FT                   RAHQAARVEGMLLPTIHAFSMPVFDSTGELALGLVALGHEGAFDIRWGGEIDTALRECA
FT                   QKLSYELGYSAAPRDEQA"
FT   gene            264072..265055
FT                   /locus_tag="Bxe_A4235"
FT   CDS             264072..265055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4235"
FT                   /product="Putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4235"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28765"
FT                   /db_xref="GOA:Q146H4"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H4"
FT                   /protein_id="ABE28765.1"
FT                   /translation="MKLATLKDGTRDGQLIVVSRDLHTAAIADAIAPTLQRVLDDWTFY
FT                   APQLHDLYDALNQGRARNTFAFDARECMAPLPRAFQWADGSSYVNHVELVRRARGAEMP
FT                   PEFWTDPLMYQGGSDDFIGPKDDVLCASEAFGIDFEAEVAVITTDVPMGVTPDQALRSV
FT                   RLITLVNDVSLRNLIPAELAKGFGFFQSKPATSFAPVAVTPDELGEHWRDGRVHRPMIV
FT                   HWNNKKVGQPDAGTDMVFHFGQLIAHAAKTRNLRAGAIVGSGTVSNKDARRGYCCIAEK
FT                   RCLETIEHGAPQTEFMKYGDTVKIEMFDEAGKSIFGSIDQGIAPLD"
FT   gene            265326..266558
FT                   /locus_tag="Bxe_A4234"
FT   CDS             265326..266558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4234"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28766"
FT                   /db_xref="GOA:Q146H3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H3"
FT                   /protein_id="ABE28766.1"
FT                   /translation="MPQIESLEPRTRRARVSNLRLDQSRDRLARRAVALCAALAGLLPG
FT                   IALAQVKIGLVLSLTGPAASLGIPARDTVALLPRQIGGQSVEYIVLDDASDTTQAVQDT
FT                   KKLISENHVDAIIGSSITPNSLAMIDVVAEGETPMISLASSAKIIEPVDAKRHWVFKTP
FT                   QTDAMMASAIAEHASLHGVKTIAFIGQADALGETFYTEVAKFAQLHHIDMVASERFNRT
FT                   DPSVTGQVLKILATHPDAVVVGAAGTPAALPPKTLRERGYKGLIYHNHGVGNNDFLRVC
FT                   GADCNGTFLPASPVLVAAQLPADHPAKRLALDYIARFEAVRGAGSVSAFGSYTWDAGML
FT                   LGHAVPVALKTAAPGTPEFRRALRDALESTRGLADTNGVVNMSATDHLGLDQRARVMVE
FT                   IRNAKWVYQPR"
FT   gene            266640..267527
FT                   /locus_tag="Bxe_A4233"
FT   CDS             266640..267527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4233"
FT                   /product="Putative Enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4233"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28767"
FT                   /db_xref="GOA:Q146H2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H2"
FT                   /protein_id="ABE28767.1"
FT                   /translation="MSQTPHGNDAFYAHYQSLQLHRHPHGVLEVVMSGEGANRSGLATA
FT                   NARMHFELAEIWRDIDRDPDTRVAIIRGEGKGFSAGGDLQLVEDMATDFDVRARVWREA
FT                   RDLVYNVINCSKPVVSAMHGPAVGAGLVAGLLADISIAAKTARIIDGHTRLGVAAGDHA
FT                   AIVWPLLCGMAKAKYYLMLCEPVSGEEAERIGLVSLAVDENDLLPKAFEVAQKLANGSQ
FT                   TAIRWTKYALNNWLRSAGPAFDTSLALEFMGFAGPDVREGVNSLRERRAPDFGGADPWR
FT                   GQPSGNGTAGGERS"
FT   gene            267610..268425
FT                   /locus_tag="Bxe_A4232"
FT   CDS             267610..268425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4232"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4232"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28768"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H1"
FT                   /protein_id="ABE28768.1"
FT                   /translation="MTTSDTTPPFPGFPGFPPAEMLERMWGMMRMSPFGSAFSGAQPGG
FT                   GLGPSLSMMSDMMAPLTNVEELDKRITDMRAVEQWLKLNLSMLQSAIQALEVQRATLAT
FT                   LRAFGAFAQSSMSQPAAASAAPSPMPATGWPHPAAPAPAPAASASAGSSAEEPSGDEEQ
FT                   APATPPFDASAWWNLLQSQFNQIAQFAMTQPAATADSAATDSAPGEEAASASGGEPTGD
FT                   APQAPAQGAEHTTTRPAAKRASTSAKRASGTTSTSSASSASPRATKKPV"
FT   gene            268434..268790
FT                   /locus_tag="Bxe_A4231"
FT   CDS             268434..268790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4231"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28769"
FT                   /db_xref="UniProtKB/TrEMBL:Q146H0"
FT                   /protein_id="ABE28769.1"
FT                   /translation="MKHGGATCGPGAVCQGEFASVMVLTPIFETLRESRIFLRKVSQAL
FT                   ELRLLRCGFRQVSVLSLCKLHCFWACVENNQSNRPCSIRRRHDRRRAGRCGFHRKLARP
FT                   QARVSLTHGWPRSA"
FT   gene            268987..269859
FT                   /locus_tag="Bxe_A4230"
FT   CDS             268987..269859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4230"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4230"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28770"
FT                   /db_xref="GOA:Q146G9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G9"
FT                   /protein_id="ABE28770.1"
FT                   /translation="MNTMLYPELYKSLESVRWDMEKDIPWDKFDASLLTDEQAATIKMN
FT                   AITEWSALPATEMFLRDNHHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFKPEMCPTEEE
FT                   LHAVRFEFDPAPPLETLMLHFCGEIRLNHWYRRAAEWHTEPVIKHIYETISRDEARHGG
FT                   AYLRYMKKAMAQTGDIARAAFAKIGVLMASARRTEKPLHPTNLHVNQALFPRDTIQSRL
FT                   PDPEWLERWLDEQIRFDDSWEKKVVERILHNLSLLFERTFNTAQELNRYRKEVVARLQA
FT                   EQKSAEQPA"
FT   gene            270016..270498
FT                   /locus_tag="Bxe_A4229"
FT   CDS             270016..270498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4229"
FT                   /product="Cytidyltransferase-related protein"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4229"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28771"
FT                   /db_xref="GOA:Q146G8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G8"
FT                   /protein_id="ABE28771.1"
FT                   /translation="MAATFERKILTRDALVTLRPSLSSPVVFTNGVFDILHRGHVTYLA
FT                   DARALGACLVVGVNSDASVRMLGKGDDRPINNEADRMALLAALESVDYVVCFGEKTPVE
FT                   LISALRPDVLVKGGDYDMDALPESAIVRSWGGKALAIPFEHDRSTTALLKKVRTQG"
FT   gene            complement(270601..270840)
FT                   /locus_tag="Bxe_A4228"
FT   CDS             complement(270601..270840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4228"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4228"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28772"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G7"
FT                   /protein_id="ABE28772.1"
FT                   /translation="MLRWLIAILFLANMLAFVAVRGVFGPTPTAGGREPNHLNRQVHPE
FT                   WLKVQPVTAAEAADQAVVGGPAPVAPIAASALAQ"
FT   gene            complement(270916..271728)
FT                   /locus_tag="Bxe_A4227"
FT   CDS             complement(270916..271728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4227"
FT                   /product="Putative transcriptional acitvator, Baf"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28773"
FT                   /db_xref="GOA:Q146G6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146G6"
FT                   /protein_id="ABE28773.1"
FT                   /translation="MTSGAPCLLIDAGNSRIKWALVQAGGSQIASGALTHGGEHQPDWL
FT                   SLPTPGGAWLSNVAGESVARRIAALLEARWPQLPLTTISACAQQCGVTNSYTAPHMLGS
FT                   DRWAGLIGAHAAFPGEHLLIATFGTATTLEALRADGCFVGGLIAPGWTLMMRSLGEHTA
FT                   QLPTLDASAARGLLDGSTRDAARRGPFFATDTPRSLSAGCTLAQAGLVERMWRDLQDEW
FT                   QVPVRLVVSGGAVDEVASALKVPHTRHDSLVLSGLALIAAGRAAERGA"
FT   gene            complement(271725..272642)
FT                   /locus_tag="Bxe_A4226"
FT   CDS             complement(271725..272642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4226"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4226"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28774"
FT                   /db_xref="GOA:Q146G5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G5"
FT                   /protein_id="ABE28774.1"
FT                   /translation="MNASRTPPPAAAATATQADWRIDRERAVALFGPHAHDWPIEIVEE
FT                   TGSTNADLMARVKALPRKAGALPRPIVRVAYLQTAGRGRRGRPWYAEPGNALLFSVACV
FT                   LPRPLEGLAGLSLAVGVALVDGLRSLPVAGPGQIALKWPNDVLLEGDKLAGILIETAWS
FT                   TENASAVVIGIGTNVKGAAELAAKVDALNAGTPPQARGTMPTALQRALPNANLTDTLAA
FT                   ELNALEPALQRFGAEGFAPFQARWNAVHAYAGREVVLLEQGEEQMRGVAAGVDEQGQLL
FT                   LDTASGRQTVATGDVSLRLADGAA"
FT   gene            272748..273881
FT                   /locus_tag="Bxe_A4225"
FT   CDS             272748..273881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4225"
FT                   /product="Putative ABC transporter, inner membrane subunit"
FT                   /function="resistance to organic solvents"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4225"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28775"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G4"
FT                   /protein_id="ABE28775.1"
FT                   /translation="MNYDTPPGLEVAAGSQGKIVRLSGQWTALALARDRATGHVIPLLL
FT                   SLVGAEGIGGWDLSRIDRMDHVGGQALWRVWGHKMPADTTLTDTQRDIFERIALLDTVR
FT                   ETAEPVIKLDPFTRLGLAIFSFFEHLYGGVAMLGRVVLDLLAIVRKPKITPWTEISANV
FT                   YNAGTQALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAIL
FT                   VAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIA
FT                   LTGGALAARIVLGIDMSYFARALPGVVPVANLWIGLGKGVVFGMLIAIVGCHFGFRIKA
FT                   NSQSLGEGTTTSVVTSITIVILADAVFAILFQNVGLG"
FT   gene            273878..274756
FT                   /locus_tag="Bxe_A4224"
FT   CDS             273878..274756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4224"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4224"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28776"
FT                   /db_xref="GOA:Q146G3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G3"
FT                   /protein_id="ABE28776.1"
FT                   /translation="MIAPLTQAVRGQPVPSIAEPVIEVIDVTKRYGRNIVHQHLNLEVR
FT                   RGEIMAIVGGSGSGKTTLVRQILGLEHPSSGTIKLFGEDLATISPETALLMRSRSGMLF
FT                   QRGALFSSLSVFDNIAQPVRELGKVPEDLLRDIVMLKLEMVGLPCKHASKMPSALSGGM
FT                   IKRVGIARAIALEPELLFLDEPTAGLDPQASDEFVELISALHRALGLTVVMVTHDLDTM
FT                   IALSTRVAVLADRRVLVAAPVEEAAAVDHPFIREYFLGLRGRRALQALPPERRAKLPRA
FT                   ALEPASSELPL"
FT   gene            274773..275735
FT                   /locus_tag="Bxe_A4223"
FT   CDS             274773..275735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4223"
FT                   /product="ABC transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28777"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G2"
FT                   /protein_id="ABE28777.1"
FT                   /translation="MENKSHAFWAGLFTVVLLAAIAVAAFLFNVDRSVRVPYDLIARTN
FT                   VTGLYTDAAVRYRGLDVGKVQSIKFDPDHPGQILIRILVDTHAPITHSTFGSLGFQGVT
FT                   GIAFIQLDDNGRDPSPLPSSDKQVAQLPMRPGLLDQLQQRGDVLLRKLEKVANDVDNLL
FT                   SPEMAAQLQGTAASLQKAADGVATLTQQFAPAAGKLPGTIDQLDRTLASTNQLITGLNR
FT                   PDGPFETNLNKVGTAAQQAGDALTSMNGSLQELSARVGYDTLPRVNSLAEDVRSAARSV
FT                   DRAADTFSTSPRSVLFGAPGAAPGPGEAGFKWPAPRAAR"
FT   gene            275766..276392
FT                   /locus_tag="Bxe_A4222"
FT   CDS             275766..276392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4222"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4222"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28778"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G1"
FT                   /protein_id="ABE28778.1"
FT                   /translation="MSRSIHRLLSSSAALAVLLAFGVLATGCAGTPAAISDIRYDFGPP
FT                   APAASAGTSPAVKVLDVTAPDVLESDKLMYRLSYADAQQTASYANSHWTMTPSQLLTQR
FT                   LRGALSSRGTVLTGADGVSAPVLKVELSEFEQVFDSQSKSHAAVTARATLTQGGKVLGQ
FT                   RTFIARAPSSSGDAAGGAQALATASDDLVAQIGAWLGVQALVAAQ"
FT   gene            276424..277581
FT                   /locus_tag="Bxe_A4221"
FT   CDS             276424..277581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4221"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28779"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:Q146G0"
FT                   /protein_id="ABE28779.1"
FT                   /translation="MSERSWLRRPSVLARQALVLYTALIVYGSWYPFSGWRSLGLGPFA
FT                   YLSDPMPQYLTAFDVVTNVLGYMPFGALVVLAVYPRWRGTLAVALAFVLGGLLSGVMEA
FT                   VQTYLPTRVASNLDLAANALGALLGAAIMSPATGALLDRGLLRRLRLVWFERDRAALAC
FT                   LVAAWPFATMYPAPRLFGLGNWPRALWLRFDSTTQDALLAWTPPGWHVGTWPALVAAWM
FT                   PDDVWEAVITTLNLFAALALASLPVRRHAPRVRLLLLFVFVTLCVKVGATFLQSQSGLA
FT                   FDWATPGALAGLVCGTATALFALRLRRRSRAALAGGALTVTLVFVNLLPVNPYFDAVLA
FT                   DWRQGRYLHFNGLAHWLAWIWPYAALVWLAYVVEQAWLKRRMERV"
FT   gene            277807..278130
FT                   /locus_tag="Bxe_A4220"
FT   CDS             277807..278130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4220"
FT                   /product="Putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4220"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28780"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F9"
FT                   /protein_id="ABE28780.1"
FT                   /translation="MDSFYKYHVFFCLNQREPGAERPSCANCNAQEMQEHAKKRVKKLG
FT                   LAGPGQVRINKAGCLDRCELGPALVVYPEGVWYTYVDESDIDEIVDSHLVNGKIVERLK
FT                   IDQ"
FT   gene            278139..278783
FT                   /locus_tag="Bxe_A4219"
FT   CDS             278139..278783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4219"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4219"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28781"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F8"
FT                   /protein_id="ABE28781.1"
FT                   /translation="MNAYTKKYLIDGPVGKIEVAVDLPDETRESGAAPRGIALVAHPHP
FT                   LFGGTMDNKVAQTLARTLVQLNYATYRSNFRGVGETQGEHDAGIGERDDLRAVLDHMRA
FT                   EPGQADLPLVLAGFSFGTFVLSHVAATLREEGQEIERMVFVGTAASRWDVAPVPENTIV
FT                   IHGETDETVPIQSVYDWARPQELPVVVIPGAEHFLHRKLHVLKRIIVDAWR"
FT   gene            279077..280333
FT                   /locus_tag="Bxe_A4218"
FT   CDS             279077..280333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4218"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4218"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28782"
FT                   /db_xref="GOA:Q146F7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F7"
FT                   /protein_id="ABE28782.1"
FT                   /translation="MYFSARIDPMRFSISGRTSFPSVASFVSPTLARAVTLGVVLPATL
FT                   AASTAFAQVPPPAVNARSWVLVDATSNQVLASGNADERVEPASLTKLMTAYLVFEALQT
FT                   KKINMDQTVMPSEAVRRVRTDESRMFIEANKPVTVHDLVYGMIVQSGNDAAIALAELVG
FT                   GSESQFVNMMNTEAQRLGMKHTHFADVNGMPDPQHYTTAGDLAILSARLIRDFPDYYNI
FT                   FSVKEFTYNKIKQPNRNRLLWIDPTVDGLKTGHTQAAGYCLIASAKRSLPGTTDASRRL
FT                   VSVMMGETKEHDRVQDSLKMLNYGYSAYDTVRLYKANQVVGTPRVYKGAQDTVQIGVKS
FT                   DQYITVPKGMGDKVKPQIEQIDPLIAPLANGQQVGTVKLVADGKVLAQFPVVALQAVPQ
FT                   AGVVGRVWDSLMLMFNKKK"
FT   gene            280347..281312
FT                   /locus_tag="Bxe_A4217"
FT   CDS             280347..281312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4217"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28783"
FT                   /db_xref="GOA:Q146F6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F6"
FT                   /protein_id="ABE28783.1"
FT                   /translation="MTAVSDVSSDPIVYLNGELVPLSEARVPVLDRGFIFGDGIYEVAP
FT                   LYAHPAHAGGRTPFRFQQHLARLARSVDRIGIVNPLNDAGWRALIAQVVAANEAGGGLR
FT                   AGQDAIAYIQVTRGVAKRGHAFPAGIQPTVFVMVTPLSLPDAAQRAQGVRCVTAEDRRW
FT                   LNCDIKSVSLLGNVLMAQYAAENDAFETIQFRDGMLTEGSSSNVWMVKDGVLSAPPRSH
FT                   KILEGIRYGLIEELAGECGIRFEAREISEAELRAADEILVSSATKEVLPVAQIDGQPVG
FT                   EGKPGAVFAALYAAYQRAKTQEAREARQGVENESRERITV"
FT   gene            281341..281553
FT                   /locus_tag="Bxe_A4216"
FT   CDS             281341..281553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4216"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28784"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F5"
FT                   /protein_id="ABE28784.1"
FT                   /translation="MGKSHPEFAETIVTVVQQFDNEVDVSRVEMRPSSGGNYTGLTVTV
FT                   RATSREQLDDIYRALTGHPMVKVVL"
FT   gene            complement(281575..282543)
FT                   /locus_tag="Bxe_A4215"
FT   CDS             complement(281575..282543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4215"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4215"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28785"
FT                   /db_xref="GOA:Q146F4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F4"
FT                   /protein_id="ABE28785.1"
FT                   /translation="MDLRQLPALNAIKAFEAAARHESFSRAADELFVTHGAVSHQIRAL
FT                   EAELGVSLFARDGKRVRLTETGRRYATHVRAALMALADATRQIRAGDRERRLVVSMLSS
FT                   FAARWVTPRIGSFIEAHPQWDLELLSTNALTDFARDDVDVAIRFGLGKYSGLHAELLLE
FT                   EIFFPACAPDFNGGKLPQTPADLANVPLLRSDDELWRPWFDAAGLSDWPEPKRGVLYQD
FT                   SSNLLQAAIDGQGVALTRRSLAMHEIAAGRLVRLFDVDGPSPWQYYFICPPQMLETARV
FT                   RAFRDWVFEEVGRFRQLFDRACEVGPAASADMAANALRVTP"
FT   gene            282642..282968
FT                   /locus_tag="Bxe_A4214"
FT   CDS             282642..282968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4214"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4214"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28786"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F3"
FT                   /protein_id="ABE28786.1"
FT                   /translation="MREISSSIAFEIRNGETVPLKVARSTRLVVRGGAIWVTRSDDTED
FT                   YWLQPGHTLRLRRGERLWLSAEGDTQARVAFSVPTRCDERALNWFARIGERLVARVRGG
FT                   WRTV"
FT   gene            283228..283953
FT                   /locus_tag="Bxe_A4213"
FT   CDS             283228..283953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4213"
FT                   /product="Lipoate-protein ligase B"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4213"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28787"
FT                   /db_xref="GOA:Q146F2"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146F2"
FT                   /protein_id="ABE28787.1"
FT                   /translation="MCATPVSPTPLPATAPLALRWRGTEPYEASFEAMRAFTDGRTAET
FT                   PDEIWLVEHPPVFTLGQAGDPAHLLAADSGIPLVKVDRGGQITYHGPGQVVAYLLLDLR
FT                   RRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVAPGPAAGSHAGAKIAALGLK
FT                   IRNGCSYHGVSLNVNMDLRPFLAINPCGYAGLETVDMATLGVTAGWNDVARTFAACLTA
FT                   NLDGSPAAVAQPQAGALTA"
FT   gene            283967..284971
FT                   /locus_tag="Bxe_A4212"
FT   CDS             283967..284971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4212"
FT                   /product="Lipoate synthase"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4212"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28788"
FT                   /db_xref="GOA:Q146F1"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F1"
FT                   /protein_id="ABE28788.1"
FT                   /translation="MTDVTANLAASPAPDAVPAPAAYDATAKQKAQAKTARIPIKVIPI
FT                   EKLKKPDWIRVKAATGNSRFYEIKQILREHNLHTVCEEASCPNIGECFGKGTATFMIMG
FT                   DKCTRRCPFCDVGHGRPDPLDADEPGNLARTIAALKLKYVVITSVDRDDLRDGGAAHFV
FT                   ECIRQTRELSPQTRIEILTPDFRGRLDRALGILNAAPPDVMNHNLETVPRLYKEARPGS
FT                   DYAHSLKLLKDFKALHPDVATKSGLMVGLGETEEEILQVMRDLREHDVDMLTIGQYLQP
FT                   SEHHLPVRSYVHPDTFRMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV"
FT   gene            285014..285259
FT                   /locus_tag="Bxe_A4211"
FT   CDS             285014..285259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4211"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28789"
FT                   /db_xref="UniProtKB/TrEMBL:Q146F0"
FT                   /protein_id="ABE28789.1"
FT                   /translation="MLQAFLFGRPNIERWNHTRLIRICESPVIPCEQHADRGHRSADDG
FT                   KRNGEFDDAITQLTILHDVVDQIGHLSSPCWTCLKV"
FT   gene            complement(285280..285813)
FT                   /locus_tag="Bxe_A4210"
FT   CDS             complement(285280..285813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28790"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E9"
FT                   /protein_id="ABE28790.1"
FT                   /translation="MPRLGASWPFGRLTSSRPRQDHLCVAKLRIPMIEFFSRLSWLFFN
FT                   VGVPVCAPFALLPLLSFSRFYRQSSKGIAIRSVQDGQLLWVVISMCAGACYEIGSALSG
FT                   ASTKNTLAFMLAGLLWHVLFMVAACILVSFGAADSTPHGGCGDEPPERRLMWTSVIMTA
FT                   TIAATFALSHYSLT"
FT   gene            285994..287016
FT                   /locus_tag="Bxe_A4209"
FT   CDS             285994..287016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4209"
FT                   /product="ABC taurine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4209"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28791"
FT                   /db_xref="GOA:Q146E8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E8"
FT                   /protein_id="ABE28791.1"
FT                   /translation="MNRFRRSLAAFATLLALSAPFASVAHADTKEVVIAYQDMVVPWRY
FT                   AQATGEVEKATGYKVTYRKLGSGADVIRALASGSVQLGEAGSSPIAAGLSQGVDISLFW
FT                   ILDNINDAEALVARDGSNVTSVAGLKGKKIGVPFVSTSHFHTLVALQSAGVNPSDVRIV
FT                   NLRPPEIAAAWERGDIDATYIWDPVLAKVKKNGKVLITSGQVAQQTGKATFDGFVVDRK
FT                   FASQNPEFVTRFVKVLAATDANYRDHTSAWTATSPQVEAVAKESGANAQEVPASLALYA
FT                   FPTPAQQASNAWLGGGAQSGAAKSLAATAAFLKTQGTIQNVLADYSTGVDPQFVQRAAH
FT                   "
FT   gene            287058..287855
FT                   /locus_tag="Bxe_A4208"
FT   CDS             287058..287855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4208"
FT                   /product="ABC taurine transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4208"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28792"
FT                   /db_xref="GOA:Q146E7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146E7"
FT                   /protein_id="ABE28792.1"
FT                   /translation="MSGLEIRQLQVAYEGARGAAPHVALADVDLRIEPGEFVVALGASG
FT                   CGKTTLLNCIAGFIQPTEGEVRLNGEPVLGPGADRGVVFQKYALMPWLDVLDNVALGLR
FT                   FQRVPKAERERIALEMLKLVGLEKHARSQVYALSGGMQQRVGIARALASDPQVLLMDEP
FT                   MGALDAMTRESMQELVLDVWGRTRKTVFFITHSVEEALFLATRLVVMTPGPGRIADSYD
FT                   LPFAQRFLQTRDARAVKSSADFIEWRERLVRRLHERNQEEVVS"
FT   gene            287852..288721
FT                   /locus_tag="Bxe_A4207"
FT   CDS             287852..288721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4207"
FT                   /product="ABC taurine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4207"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28793"
FT                   /db_xref="GOA:Q146E6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E6"
FT                   /protein_id="ABE28793.1"
FT                   /translation="MTASRESLGNVPLAETGKRPQRTARPVRGWRLPGEGPTAALSAAS
FT                   VTTLAALWWLATHLHWLPPLFLPTPEAVWAAFIDAWHGRIQGGLPLSEHLAWSALRVFG
FT                   AFALAAVTAVPVGILMGVSRVARGLLDPPLEFYRPLPPLAYLPLVVIWFGIDETAKIVV
FT                   IYLACFAPIAMAARAGVRSATIEQIHAAYSLGGSFSQIVRHVVLPAALPEILTGLRIAI
FT                   GFGWTTLVAAEMVAATAGLGQMVLNASSFLRTDVVVMGIVLIGLIAWFFDLGMRALERR
FT                   LVPWKGRV"
FT   gene            complement(288777..289460)
FT                   /locus_tag="Bxe_A4206"
FT   CDS             complement(288777..289460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4206"
FT                   /product="HAD-superfamily hydrolase, subfamily
FT                   IB(PSPase-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28794"
FT                   /db_xref="GOA:Q146E5"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E5"
FT                   /protein_id="ABE28794.1"
FT                   /translation="MSRNLALFDLDHTLLPLDSDQAWAHFIAGLGVEGAVRHAQEIDDY
FT                   YRQYVAGTLDMAAYLNYTLAPLARHSREQLNAWHAQFMQQVIAPAILPAARELVQRHLD
FT                   AGDLCCIVTATNVFITEPIGKALGFEHLLGIELGTEGGDPSARFTGTAVGTPTFREGKI
FT                   TRTESWLASLGHRLQDFHESWFYSDSINDVPLLERVTHPVATNPDPRLRAVASERGWPV
FT                   IELFA"
FT   gene            289649..291346
FT                   /locus_tag="Bxe_A4205"
FT   CDS             289649..291346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4205"
FT                   /product="Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28795"
FT                   /db_xref="GOA:Q146E4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E4"
FT                   /protein_id="ABE28795.1"
FT                   /translation="MAAGTDAQCPMLILLNLLAGVALLVWGSHIVRTGILRVLGADLRS
FT                   VLGRSTSSRWRAFLSGVGVTSLVQSSNATAVIVTSFAAQGLLPLASGLAIMLGADVGTA
FT                   LMARVLTLDLSWLSPILILLGVPLFLSRKQTRLGQAGRTLIGLGLILLALRLIVEAAQP
FT                   MMQGAGVRVMFGALTGDTMLDALVGAAFAMLSYSSLAAVLLTATLASSGVISLKVALCL
FT                   VIGANLGSGLLALLGTVAQNAAARRLALGSFAFKLAGALLILPFTSLLARGLPVLIANP
FT                   REATVGFHLIYNALRCCACLSLIDPVARICVRILPNRPVPNGELRPLHLDTAALSTPTL
FT                   ALAHAAREVLRIGDIVRTMLDNVADLIHHNNLDKARETVRMDDDVDELYAAVKTYLTLI
FT                   SREQLDEADSRRWTDIISLTINLEHAGDIIERIVGDIEEKKIAHRLSFSEEGLGELDDL
FT                   QARLVSNLQLGLSVFLNNDLRCAERLLAEKERFRDLERAYSYRHLDRLAGQTLRSIETS
FT                   ALHLDLISDMKRLNSLFCSTAYPVLDAAGALHDTRLRKRALDTMHVKE"
FT   gene            complement(291486..292256)
FT                   /locus_tag="Bxe_A4204"
FT   CDS             complement(291486..292256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4204"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4204"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28796"
FT                   /db_xref="GOA:Q146E3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E3"
FT                   /protein_id="ABE28796.1"
FT                   /translation="MWQEDRHQRIRALLSTLQRVSTERIMADLGVSRETVRRDLLDLEA
FT                   LGELRRVHGGAIKPADEAPIAERVHMRVKSKTAIAKAATGLIASGQTLFIDAGTTTTAL
FT                   AEELAKLANLTVVTNSIDVALKMRGAVDQAEAANEVILLGGSISDRAMATTGATTVLDI
FT                   QRYRADLALLSPVGVDHRHGATNYDHAETEVARAMVANADRVVILADYSKIGQRSRISY
FT                   CPVDRIDVLVTNKKAAEAADFASLKKKLEEIVLA"
FT   gene            292474..292749
FT                   /locus_tag="Bxe_A4203"
FT   CDS             292474..292749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4203"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28797"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E2"
FT                   /protein_id="ABE28797.1"
FT                   /translation="MSDFEHFAAFFGNLTRWCRHHNGSWDPLSARCSCGVTLLDDGTLR
FT                   HPDNDVAMSGAVETRSVYPAIAARALARYYPPGSRVKGQPEACVLH"
FT   gene            292824..293609
FT                   /locus_tag="Bxe_A4202"
FT   CDS             292824..293609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4202"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4202"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28798"
FT                   /db_xref="GOA:Q146E1"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E1"
FT                   /protein_id="ABE28798.1"
FT                   /translation="MGNGINRASSADWPYPRLAAHRCGGSLAPENTLAGFDACVRYGYR
FT                   MVEFDAKLSADNQLFLLHDDTLERTTNGHGAAADHTWQQLATLDAGTWYGPQFAGTRLP
FT                   TLAEAAGRCARDGIAANIEIKPCPGRDEITGTLVASGALTLWQGQTPPLLSSFSFEALA
FT                   AARDAAPSLQRGMLFDEVPADWLRVVRELDCVSFHANHRYLSEPLVAEIHGAGLRVLAY
FT                   TVNDPARAQLLAQWGVDMICTDRIDTLRHDMFSAPANPA"
FT   gene            293714..294829
FT                   /locus_tag="Bxe_A4201"
FT   CDS             293714..294829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4201"
FT                   /product="ABC Polyamine/Opine/Phosphonate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28799"
FT                   /db_xref="UniProtKB/TrEMBL:Q146E0"
FT                   /protein_id="ABE28799.1"
FT                   /translation="MNRTALARILSISAVAGVTAAGVSSSASAAPLDVLIAAAKQEGQL
FT                   TVIALPHDWCNYGELVAGFQKKYGIKINELNPDAGSGDEVEAIKANKGNKGPQAPDVID
FT                   VGLSFGPTAKAEGLLQPYKVATWNSIPKESKDADGYWYGDYYGVLSFEVNADMIDKAPS
FT                   DWSDLLKPDYKNAVSLAGDPRSANQAIQAVYAAGLSQSKGDASKAGQAGLTYFANLNKN
FT                   GNFVPVIGKAASLAQGTTPIIVRWDYNALADRDTLKGNPKVQVVIPKTGVVAGVYVQAI
FT                   SAYAPHPNAAKLWMEYLYSDEGQIGWLKGYCHPMRYTELVSGKKVPQALLDKLPPPSSY
FT                   KNVVFPTLSQQDAYKDTITKHWDEAVGANVK"
FT   gene            294977..295915
FT                   /locus_tag="Bxe_A4200"
FT   CDS             294977..295915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4200"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   innermembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28800"
FT                   /db_xref="GOA:Q146D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D9"
FT                   /protein_id="ABE28800.1"
FT                   /translation="MSASSDAGSVQPELLVPPVPSPTPRVDGPGRASQFLAWIGVVPFF
FT                   TFALLFLILPTGFLMVGAFQDSQGHFTLANFRDLLQPTVMDAYWISFKVSAASSLGGAV
FT                   IGSLLAWAAVQGKLPGWIRPTLMTFSGVASNFAGVPLAFAFICTLGRVGLVTVLLKKYL
FT                   GFNLYSTGFSILSFSGLTLTYLYFQIPLMVLIVTPALDGLKREWREACDCLGGTAFQYW
FT                   RYVALPVLWPSVLGAALLLFANSFGAVATAYALTGSSLNIVTILLYAQIRGDVMHNQNL
FT                   GYALALGMVLVTGLSNGGYIWLRSRAERGRR"
FT   gene            295912..296703
FT                   /locus_tag="Bxe_A4199"
FT   CDS             295912..296703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4199"
FT                   /product="ABC spermidine/putrescine transporter,
FT                   innermembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28801"
FT                   /db_xref="GOA:Q146D8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D8"
FT                   /protein_id="ABE28801.1"
FT                   /translation="MKSQSRVGAWTAMIVGSLYFLIPLIATFEFSLRMKRGAYSFEAYS
FT                   VVLGDPRFQASFGYSILMALLTIVVGVLLVVPTAYWVQLRLPKLRPVVEFITLLPLVVP
FT                   AIVIVFGYLRIYNSSSILPLTGNERATDLLLVFGYVTLSLPYMYRAVDAGLRAVDVRSL
FT                   TEAAECLGASWPTILFKVIFPNIRSGILSGAFLTFAVVIGEFTLASLLDRPAFGPYLQL
FT                   IGANRAYEPSALAIIAFVITWASMGLIQVFGSARAMSGQKV"
FT   gene            296750..297820
FT                   /locus_tag="Bxe_A4198"
FT   CDS             296750..297820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4198"
FT                   /product="ABC spermidine/putrescine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4198"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28802"
FT                   /db_xref="GOA:Q146D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D7"
FT                   /protein_id="ABE28802.1"
FT                   /translation="MAFLEIENLHKSFGANTALHHFDMKIERGEFITFLGPSGCGKTTV
FT                   LRMIAGFETPTRGVIRLDNKDVTHLRTRQRKVGMVFQSYALFPNMTVAENIGFGLKITH
FT                   RPQAEINQRVEEMLQLIKLPQLGGRYPWQLSGGQQQRVALARALAGKPQVLLLDEPLSA
FT                   LDAKIRISLRQDIRALQRELGITSIFVTHDQEEALSISDRIVVMNEGRVEQIGSPSEIY
FT                   NYPRTRFVASFVGTLNILAGHVVDPATGRMVVDGQELTTTQELPSNDAGKKRLLALRPE
FT                   AIVLEPAAPGRNTLNATVEEVNFLGAVVRIRTRVKDAVISLDVFNDPNRGLPERGQPVS
FT                   LGFSHENLLVLEEGGV"
FT   gene            298227..299507
FT                   /locus_tag="Bxe_A4197"
FT   CDS             298227..299507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4197"
FT                   /product="Sodium/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28803"
FT                   /db_xref="GOA:Q146D6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146D6"
FT                   /protein_id="ABE28803.1"
FT                   /translation="MKKPIHKVLYVQVIVAIIIGIGLGHFYPDLAVDMKPLGDGFIKLI
FT                   KMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGVG
FT                   FNIDPATLDGKAVASYAAKAHGQTTVDFLMHIIPDTLVSAFAQGEILQILLIALLFGAV
FT                   LATAGEKGKVVTGFIDGLSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKL
FT                   IGTFYLTSVVFVVVVLGIIARAVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLE
FT                   RLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTS
FT                   KGASGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVS
FT                   AWEKELDRSKLNAALRGDVAIKEPAGV"
FT   gene            299563..301563
FT                   /locus_tag="Bxe_A4196"
FT   CDS             299563..301563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4196"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4196"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28804"
FT                   /db_xref="GOA:Q146D5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D5"
FT                   /protein_id="ABE28804.1"
FT                   /translation="MKPVSARRTSVPSADEACADGTSPYATINDPHRSDIANVTRRLLI
FT                   LFALVAGLVAACGLTYSIAWQSGIDHLRRNAAVRVDRTTSALKSTLERYESLPYLLAEH
FT                   PIVQDVLVDPSAANVARANLYLEDLNRHARATVTYIIPLDGFCVAASNWRGPGSFIGAG
FT                   YQFRPYFLDAVKGGVGRFFGIGTISQAPGYYISQPVRRDGRIVGVAVVKLDLEWFQGAD
FT                   ASEPLVVTDDHGVIFLSSIPAWKYHTIRPLSGPVADSIYQARQYAQQPIPPLPVSIERT
FT                   LEGNAQIVRIGGGRYAPRYLASRRGMGEPDWHLITMSPVDPVDADARKATIVTGFGYVS
FT                   LVLLAFYWRMRRARVREVMRSRALLQKAYAELNRRVAERTADLSQANEQLQKEVAERTR
FT                   AEQELRAAHDELIQASKLAALGQMAAGITHELNQPLAALRGFSDNTRVLLERGDQVSAR
FT                   ENLEAIAALTERMGKITNQLKLFVGRARPRSARAPIVRALRNVVALLQKRLQGVEVELV
FT                   LFDAQSGTRAPLSLADDHPELVAHCDDLRLEQVLINLLGNALDATADINSPRISIEIEV
FT                   ADANLSFAVSDNGPGIADDVLPRLFEPFFTTKEMGQGLGLGLAISSSIARDCGGSLVAR
FT                   NAPGGGALFVLTLRRARVQTSHTPDPLTTGS"
FT   gene            301581..302933
FT                   /locus_tag="Bxe_A4195"
FT   CDS             301581..302933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4195"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, NtrC subfamily, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28805"
FT                   /db_xref="GOA:Q146D4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D4"
FT                   /protein_id="ABE28805.1"
FT                   /translation="MLNHGLQVLYIEDDELVRRASVQSLQLAGFEVIGHASVESAAKTI
FT                   GADFSGVIVSDIRLPGASGLDLLAQCHERAPDVPVILVTGHGDISMAVQAMRDGAYDFI
FT                   EKPFASERLIETVRRALERRKLVLENLALRRELAEQSSVAPRIIGRSPAIEQVRRLIAN
FT                   IAPTDASVLINGDTGAGKELIARSLHELSPRRDKPFIAVNCGALPEPMFESEMFGYEPG
FT                   AFTGAAKRRIGKLEHASGGTLFLDEIESMPLALQVKLLRVLQDGVLERLGSNQPIRVNC
FT                   RVVAAAKGDMAEHVADGSFRRDLLYRLNVVTIALPPLGERREDIVPLFEHFLLDAAVRY
FT                   QRPAPILTDRQRAGLMQRDWPGNVRELRNAADRFVLGVADDPVMSFGDDGAAAQPLKER
FT                   VEQFERAVIAEALEQAGGVVAVAADRLQLGKATLYEKIKRYRLAAKGEGER"
FT   gene            complement(303045..303575)
FT                   /locus_tag="Bxe_A4194"
FT   CDS             complement(303045..303575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4194"
FT                   /product="Putative thiol-disulfide isomerase and
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28806"
FT                   /db_xref="GOA:Q146D3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D3"
FT                   /protein_id="ABE28806.1"
FT                   /translation="MSSTPSTAARRANPLRYIIIAAVAIAIAVAGYFAFAGQQRVPDAT
FT                   FTLLSGQKVSTADLKGKVYLVNFWATSCDTCMKEMPQMVQTYNRFKDQGLEFVAVAMNY
FT                   DAPMYVTNYTQTRQLPFKVAMDDGSAARQFGNVQLTPTTFLVDKDGRILKRYVGEPQFA
FT                   ELDQLLEKALKPA"
FT   gene            303838..304446
FT                   /locus_tag="Bxe_A4193"
FT   CDS             303838..304446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4193"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4193"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28807"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D2"
FT                   /protein_id="ABE28807.1"
FT                   /translation="MTGGSPSPVSVRFAPGAVSRQSKARAAVSALACALALGGALSACS
FT                   PTFDWRTIMNNDNGYTVDLPAKPGNDQRAVQIYGKPMQMAMQTAEAGDAVFAVGTVMLP
FT                   DDSEATQRAALDFLRTGLARNVGAAPEARAVQIPLAAGGQVLGLEMKLSGEAGSQHEAR
FT                   TVYARLVAHGRHVYQAAIISPKPMQQEQVDQFFSSFQLY"
FT   gene            complement(304789..306378)
FT                   /locus_tag="Bxe_A4192"
FT   CDS             complement(304789..306378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4192"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4192"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28808"
FT                   /db_xref="GOA:Q146D1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D1"
FT                   /protein_id="ABE28808.1"
FT                   /translation="MSLAVVRSRAPAAGRAPEVTVEVHLANGLPSFSIVGLPDLEVRES
FT                   RERVRAALQNCNFDFPVRRITVNLAPADLPKESGRFDLPIALGILAASGQIPAESLLHR
FT                   EFAGELSLTGALRPMRGAFAMACGTARGGVSHGGAASGISGELAASEPAAHPVPQLYLP
FT                   AASAAEAALVPGVDVYGAADLPSLCAHLADAPDARLHPLAAPELADCASAADPDMGDVI
FT                   GQRGARRALEVAAAGGHHVLLVGPPGAGKSMLAARLPGLLPPMTDDEALSSAALLSASR
FT                   AGFTPSQWRRRPFRAPHHSSSAAALVGGRNPPQPGEITLAHLGVLFLDELPEFDRAVLE
FT                   TLREPLEAGRITISRAALQADFPAACQLIAAMNPCPCGWRGDPQGRCRCTPEIAARYLR
FT                   KLSGPLLDRIDIQLEIPALTPAELSARSTAVGETSAAIAARVNRARERQLSRQGKTNRE
FT                   LGGREVDEMCQPDAAGEILLREAGERFGWSARAYYRVLKVARTIADLAGAPMPSAAQIA
FT                   EAIQYRRAFGSV"
FT   gene            complement(306498..306752)
FT                   /locus_tag="Bxe_A4191"
FT   CDS             complement(306498..306752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28809"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q146D0"
FT                   /protein_id="ABE28809.1"
FT                   /translation="MKQPNDVFNDFQARMSELFKNSPAKDVERNVKAMLSQGFSRLDLV
FT                   TREEFDTQTQVLVRTRARLEELERRVAELEQKLPVTQTP"
FT   gene            307164..307502
FT                   /locus_tag="Bxe_A4190"
FT   CDS             307164..307502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4190"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28810"
FT                   /db_xref="GOA:Q146C9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C9"
FT                   /protein_id="ABE28810.1"
FT                   /translation="MKLITAIIKPFKLDEAREALSAIGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDIVDQAIEALERAARTGKIGDGKIFVTPIEQVIRIRT
FT                   GETGADAL"
FT   gene            307547..309046
FT                   /locus_tag="Bxe_A4189"
FT   CDS             307547..309046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4189"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4189"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28811"
FT                   /db_xref="GOA:Q146C8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C8"
FT                   /protein_id="ABE28811.1"
FT                   /translation="MRKLLMSLLMAGSLLAGGIGAALADDASAPAAASAPDATASAPAP
FT                   DASAAPAAAAASAPAADASAAPAASAAAAPAASDAAPAAPTAPFSVDSSKINSGDTAWM
FT                   LTSTALVLFMTIPGLALFYGGMVRKKNVLAILMQSFAITCVVTIVWIVIGYSLAFTPGS
FT                   SFIGGFSRVFMAGMSYIKGDKATTLTVSHLAPTIPETVYCVYQMTFAIITPALITGAFA
FT                   DRMKFSAMLVFMTLWSIIVYSPIAHMVWEPTGWLASAGILDFAGGTVVHINAGIAALVC
FT                   ALVLGKRIGYGKEAMAPHNLTLTLIGGAMLWVGWFGFNAGSAVAADGRAGFAMFATQVA
FT                   TAAAALAWMFAEWAAKGKPSVLGIVSGAVAGLVAITPASGFVGTLGSLVIGIVAGVVCF
FT                   WSATWLKHKLGYDDSLDAFGVHCIGGIVGALLTGVFAVKDIGGADGSVILQAKGVLTTL
FT                   IYSGVVSYILLKIIDMVMGIRVTEEQEREGLDVSLHGEHVE"
FT   gene            309285..310574
FT                   /locus_tag="Bxe_A4188"
FT   CDS             309285..310574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4188"
FT                   /product="Putative glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28812"
FT                   /db_xref="GOA:Q146C7"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C7"
FT                   /protein_id="ABE28812.1"
FT                   /translation="MVPHLVTALNGPLLDLERKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGAFNNLPQEVLPLAVQAAMASIEKICPDAKNLLVIPERHT
FT                   RNAFYLENVARLAAIMRQAGLNVRFGTLDETINGPVTIALSDGQKLVLEPLERSPRRLG
FT                   LKNFDPCSILLNNDLSGGIPPVLENLHEQYLLPPLHAGWAVRRKSTHFSCYDDVAKKFA
FT                   KMVEIDPWMINPYFAHVEGVDFQERTGEEALADAIDGVLKKIAKKYREYGISEKPYVVI
FT                   KSDAGTYGMGVMTVHDASEVAALTKRERAKMAATKDGLEVHDVIVQEGVYTFERIGEEV
FT                   AEPVVYMIDRYVVGGFYRVHGSRERDQNLNAPGMHFVPLGFEHTALPDAHAKPGAAPPN
FT                   RFYMYGVVARLGLLAASVELEKTDPEAIQV"
FT   gene            310677..311633
FT                   /locus_tag="Bxe_A4187"
FT   CDS             310677..311633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4187"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28813"
FT                   /db_xref="GOA:Q146C6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C6"
FT                   /protein_id="ABE28813.1"
FT                   /translation="MDILFIADPLTQFKIYKDSTYAMMAEAARRAHVVYTCEPQHLAWT
FT                   GGEVEANVQRVEIVGDGADLQRDVWYSAEAAAPRSLRSFSAVVMRKDPPFDMEYVTSTW
FT                   LLEMAERAGARIFNKPQAIRDHSEKLAIGEFAQFVTPTLVTRDATRLRAFHEEHGDVIL
FT                   KPLDGMGGMGVFRVKADGMNLGSIIEMLSHDGTRSVMAQKFIPEIKEGDKRILLIGGEA
FT                   VPYSLARIPQGNEVRGNLAAGGLGMARPLTEHDRKIAATLAPVLAARGLLLVGLDAIGD
FT                   WLTEVNVTSPTCFREIMDQTGFDVAAMFIDALERAAG"
FT   gene            311956..312516
FT                   /locus_tag="Bxe_A4186"
FT   CDS             311956..312516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4186"
FT                   /product="Putative sugar transport PTS system IIa
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28814"
FT                   /db_xref="GOA:Q146C5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C5"
FT                   /protein_id="ABE28814.1"
FT                   /translation="MGPFFCSKADMAGILIIAHAPFATALRDCISHIYGGLPARIGVID
FT                   VSPDCDPAQQVAFAHAEVERLKEENGALVLTDMFGATPANIAGRLASVPNVRVLCGVNL
FT                   PMLVRAVCYRATPLDTLVDKALAGATKGVHAIGPATPAPVAPTAESGDCLPALPPDAAS
FT                   GGDCLPALPADADLTQKAGPAGL"
FT   gene            312617..312886
FT                   /locus_tag="Bxe_A4185"
FT   CDS             312617..312886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4185"
FT                   /product="HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28815"
FT                   /db_xref="GOA:Q146C4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C4"
FT                   /protein_id="ABE28815.1"
FT                   /translation="MLQQETTIVNKLGLHARASAKLTQLAGNYQAEIWMSRNGRRINAK
FT                   SIMGVMMLAAGIGSTVLIETEGADEKEAMDALLKLIADKFGEGQ"
FT   gene            313061..314866
FT                   /locus_tag="Bxe_A4184"
FT   CDS             313061..314866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4184"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28816"
FT                   /db_xref="GOA:Q146C3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C3"
FT                   /protein_id="ABE28816.1"
FT                   /translation="MSESIAAVCRGITQLEEVRVSFTLHGIPVSRGIAIGRAYLIAPAA
FT                   LDVDHYLIEPAQIDGEVERFRAAQQHVHRELDALRADLAADAPSEMGAFINVHSMILND
FT                   AMLVQETIDLIRTRRYNVEWALTEQLERLSRHFDDIEDEYLRERKADIEQVVERVLKAL
FT                   AGASVALVDGVHGACDEMIVVAHDIAPADMMQFKTQTFQGFVTDLGGRTSHTAIVARSL
FT                   GIPAAVGVQHASALIRQDDLIIVDGDHGIVIVDPAPIVLEEYSYRQSEKALEQRKLQRL
FT                   KFSPTQTLCGTRIELCANIELPEDARAALEAGAMGVGLFRSEFLFMNHKDRLPEEEEQF
FT                   AAYRRAVELMNGLPVTIRTIDVGADKPLDSMGGGDGYETAANPALGLRAIRWSLSEPQM
FT                   FLTQLRAILRASAFGTVKILIPMLAHAQEIDQTLDLIREAKRQLDDAGIAYDPNVQVGA
FT                   MIEIPAAAIALPLFLKRLDFLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLHLIAF
FT                   TLREAKRAGVPVSVCGEMAGDPALTRLLLGMGLTEFSMHPSQLLVVKQEVLRAHLKTLE
FT                   KPVADVLASFEPEEVQAALKRVTLA"
FT   gene            complement(314961..315719)
FT                   /locus_tag="Bxe_A4183"
FT   CDS             complement(314961..315719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4183"
FT                   /product="Putative molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4183"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28817"
FT                   /db_xref="GOA:Q146C2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C2"
FT                   /protein_id="ABE28817.1"
FT                   /translation="MNDDQLLRYSRHILVDEIGIEAQQRFIDAHAIIVGAGGLGSPAAM
FT                   YLAAAGVGRLTLVDADTVDLTNLQRQILHVTASVGRKKVESGRDAIARINPEVVVNAVA
FT                   ERVDDAWLDAQVPHATVVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQISTFDF
FT                   RDEASPCYACVFPEDQPFEEVACSTMGVFAPTVGIVGSMQAAEALKVIGGIGTPLLGRL
FT                   MMLDSLRMEWNTMRIARQPDCPVCGQTHAV"
FT   gene            complement(315918..317498)
FT                   /locus_tag="Bxe_A4182"
FT   CDS             complement(315918..317498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4182"
FT                   /product="Peptidase S41A"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28818"
FT                   /db_xref="GOA:Q146C1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C1"
FT                   /protein_id="ABE28818.1"
FT                   /translation="MRKNLKNIGLIAAGLATGVFATLQLSASAQQPASAASSAVAPLPL
FT                   DQLRLFAEVFGQIKHEYVEPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYEELQEQTKG
FT                   RFAGLGIEISSEDGLIKVISPIEDTPAFRAGIRPGDLITRINDKPVRGMTLDQAVKQMR
FT                   GDPGTKVTLTIFRKTDDRTFPLTVTRAIIKVQSVKMKILAPGYAYVRITSFQERTTPDL
FT                   AAKLQDIARQQPNLKGLVLDLRNNGGGLLQSAVGVAGAFLPPNSVVVSTNGQIPDSKQV
FT                   YRDTYDNYRLQSFDSDPLKDEAPIFKTVPMIVLTNAYSASASEIVAGALQDQHRALIVG
FT                   KTTFGKGSVQTVRPMTADTALRLTTAYYYTPSGRSIQNKGIRPDIAVDQYAEGDPDDAL
FT                   VTREVDYSNHLANTQDPNEKKEAEQREQERMDQLRQLEEQNDKKTPEQRQKDRERKPVE
FT                   FGSADDFMLQQALNKLEGKPVQESKSLTERRLAQNKPPASASAPVAVKPTQPVPGASAP
FT                   ASAPATPSN"
FT   gene            complement(317805..318551)
FT                   /locus_tag="Bxe_A4181"
FT   CDS             complement(317805..318551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4181"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4181"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28819"
FT                   /db_xref="GOA:Q146C0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniProtKB/TrEMBL:Q146C0"
FT                   /protein_id="ABE28819.1"
FT                   /translation="MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNNEAQQAGVLLKD
FT                   SGYTFDIAYTSVLKRAIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAAR
FT                   FGDEQVLVWRRSYDTPPPALEPTDERAPYNDPRYAKVPREQLPLTECLKDTVARVLPLW
FT                   NESIAPAIKSGRQVLIAAHGNSIRALVKYLDDISDNDIVGLNIPNGVPLVYELDENLRP
FT                   IKHYYLGDQEAIAKAQAAVARQGKAG"
FT   gene            318688..319113
FT                   /locus_tag="Bxe_A4180"
FT   CDS             318688..319113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4180"
FT                   /product="Putative rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4180"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28820"
FT                   /db_xref="GOA:Q146B9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B9"
FT                   /protein_id="ABE28820.1"
FT                   /translation="MKFFTDYTNLVLIAIVLISGGLLLWPTISRRGRGGLSAAEATQLI
FT                   NRRNAAVIDLRPSADFAKGHLPAARHLEFAELQAKVAQLVKNKTNPVLLVCQTGQQSNK
FT                   AARIVQDAGYAEVHVLEGGVDAWQKAGMPVVKQGVAK"
FT   gene            319110..319373
FT                   /locus_tag="Bxe_A4179"
FT   CDS             319110..319373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4179"
FT                   /product="Putative glutaredoxin 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28821"
FT                   /db_xref="GOA:Q146B8"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B8"
FT                   /protein_id="ABE28821.1"
FT                   /translation="MNKVIMYSTQVCPYCQMAERLLKSRGVEHVEKVLIDKDPARREEM
FT                   MTRTGRRTVPQVFIGETHVGGYDDLSALDRAGGLMPLLEATA"
FT   gene            319526..319996
FT                   /locus_tag="Bxe_A4178"
FT   CDS             319526..319996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4178"
FT                   /product="protein translocase subunit secB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28822"
FT                   /db_xref="GOA:Q146B7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146B7"
FT                   /protein_id="ABE28822.1"
FT                   /translation="MSDENNQPFFNIQRIYLKDMSLEQPNSPGIFLEQEMPSVEVEVDV
FT                   KAERLAETVFEILVTGTVTAKVSDKVAFLIEAKQAGIFDIRNIPAEQIDPLVGIACPTI
FT                   LFPYLRSNIADAITRAGFPPIHLAEINFQALYEQRLAQMGGQDGAAQNGVTH"
FT   gene            320010..321017
FT                   /locus_tag="Bxe_A4177"
FT   CDS             320010..321017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4177"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4177"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28823"
FT                   /db_xref="GOA:Q146B6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146B6"
FT                   /protein_id="ABE28823.1"
FT                   /translation="MPAMKVAVLGAGAWGTALAGHLAVRHDTVLWARQPALIADLRASH
FT                   ENARYLAGVALPPALRYETDLNAALDHALADNALCVVATPVAGLRGLFRAMRDAGKVPA
FT                   HVVWLCKGFEADSQLMPHQVVAAELPEHGSNGVLSGPSFAREVGQGLPVALTIASASAA
FT                   CRERTVAAFHHGAMRIYTGDDVVGVEVGGAVKNVLAIATGIADGLGLGLNARAALITRG
FT                   LAEMSRLGVTLGGRAETFTGLTGLGDLILTATGDLSRNRTVGLQLAAGRTLDDILGGLG
FT                   HVAEGVRCAQAVLAIARAHAIEMPITQAVCAVLFDGVAPRDAVSALLRRDSKAE"
FT   gene            321115..321663
FT                   /locus_tag="Bxe_A4176"
FT   CDS             321115..321663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4176"
FT                   /product="Putative appr-1-p processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4176"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28824"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B5"
FT                   /protein_id="ABE28824.1"
FT                   /translation="MLRFNRCTLEARVVDITELAVDAIVNAANTSLLGGGGVDGAIHRA
FT                   AGKELIRECETLGGCATGDAKLTRGYRLPARYVIHAVGPRWRGGGHGEADLLASCYQRS
FT                   LEVAREAQCTSIAFPAISCGIYHFPADEAVRIALGTVLATLPRTPQIEQVVFACFDDAM
FT                   FARYEAELMRRQAPPSKPV"
FT   gene            complement(321636..322106)
FT                   /locus_tag="Bxe_A4175"
FT   CDS             complement(321636..322106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4175"
FT                   /product="RNA methyltransferase TrmH, group 2"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4175"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28825"
FT                   /db_xref="GOA:Q146B4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B4"
FT                   /protein_id="ABE28825.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGARLHLIEPLGFPLDDARMR
FT                   RAGLDYHEYAQMNVHADWAAFIAKESPDPARMFAFTTRGSGRFHERAFQSGDWFVFGAE
FT                   TRGLPDPVLGQFADEQRVRLPMRPGNRSLNLSNTVAVVVFEAWRQTGFEGGA"
FT   gene            complement(322125..322910)
FT                   /locus_tag="Bxe_A4174"
FT   CDS             complement(322125..322910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4174"
FT                   /product="Putative competence protein f-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28826"
FT                   /db_xref="GOA:Q146B3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B3"
FT                   /protein_id="ABE28826.1"
FT                   /translation="MPLRSISSFSGSRFARFARAVHSAWPRVAQVALPNLCALCGNLSH
FT                   TTICAGCDAAYWNEERLRCTVCAVPLSVTQWAARTQYRCADCAGEPPPFDATFALADYR
FT                   APLDTLAVGLKFRARLMLAHEFGQRLARLAQDSWLELAEWPDVIAPVPLARKRLVERGY
FT                   NQAWQIARPLARALHVRSDATLLHRVIHTAPQSRLDLDARRLNVGRAFKVAGSVQGLHV
FT                   GIVDDVMTTGATLEALARTLKAAGARQVTNFVALRTPKN"
FT   gene            322944..323960
FT                   /locus_tag="Bxe_A4173"
FT   CDS             322944..323960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4173"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4173"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28827"
FT                   /db_xref="GOA:Q146B2"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B2"
FT                   /protein_id="ABE28827.1"
FT                   /translation="MEGNERVYFGLYASTTLMSPTPAQSGRPAYDSQRLRRIFDRRAST
FT                   FSEVAFLPREIAQRMRERLDYIKVTPSSVLDAGCGMGEDIPALRERFPEAPVFGSDLSH
FT                   GMLTRALQHDSGDTSWRRFLPATLGKALGARGPRFAQADFSALPFAAGAFEFIWSNLAL
FT                   HWHSRPDLVFPEWQRVLKVNGLLMFSTLGPDSLKELRGAYAEVEAAHGVASRKHVIDFV
FT                   DMHDLGDMLVESGFEIPVMDQEVLTITYKSPESLLADVRRWGAYPFEREASSGAVARRL
FT                   HKALLAALEARRRADGTLALTFEVIYGHAWKAVPRTTAEGHGIVRIEDIGRGSARNR"
FT   gene            324264..324737
FT                   /locus_tag="Bxe_A4172"
FT   CDS             324264..324737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4172"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4172"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28828"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B1"
FT                   /protein_id="ABE28828.1"
FT                   /translation="MEASDLLTDSEPVLKDWTMKRNCSISPRQFICFYVSLAFFSLAIA
FT                   FMLVLVGAWLVLPFTGIELLAVGVAFAIYARHAVDYERIRLFQNRLVIEQVSAEQLTQF
FT                   EFNPRWVRIEAGATPRDRIKLVSRGQTIMIGQHLAQYRRAQFAGELRMWLTRC"
FT   gene            324804..326420
FT                   /locus_tag="Bxe_A4171"
FT   CDS             324804..326420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4171"
FT                   /product="Putative cytochrome c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4171"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28829"
FT                   /db_xref="GOA:Q146B0"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="UniProtKB/TrEMBL:Q146B0"
FT                   /protein_id="ABE28829.1"
FT                   /translation="MEILGKEAMKTIKRALMGVLAMSGLLFAGAALAVGDVPGGPAVNE
FT                   INLQPPATKIAEELFSLHMFMLVLCTVIFVGVFAVMFYSIFAHRKSKGHKASNFHESTT
FT                   VEIIWTIVPFIIVVLMALPATKTVVAMKDTTNADLTIKVTGYQWKWGYDYVKGPGEGIS
FT                   FLSTLATPRAETDGRQPISTTYLQEVDNPLVVPVDKKIRIITTANDVVHSWYVPAFGVK
FT                   QDAIPGFVRDTWFKAEKVGTFRGFCTELCGKEHAFMPVVVEVLSADDYAKWVDAQKKKM
FT                   AAGQDDPNKTYTMAELMERGGKVYAANCAVCHQPTGKGAGAFPALDGSKIANGPIAEHV
FT                   SLVLKGKNAMPSWAPTLNDVEIASVITYERNSWGNHTGDILQPKQVADARNGKLPEGGN
FT                   HLADAGAAASGAEAASGASGAETAAAGSDSAAAQATLPASIYFDTGKSTLPAEAKAAVE
FT                   AAAAYAKSHPDAKFTLSGFTDATGSADLNAKLAKSRAEAVRDALKAAGIAEDHIILKKP
FT                   ETITGGSDAKEARRVQISPAA"
FT   gene            326465..328078
FT                   /locus_tag="Bxe_A4170"
FT   CDS             326465..328078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4170"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4170"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28830"
FT                   /db_xref="GOA:Q146A9"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A9"
FT                   /protein_id="ABE28830.1"
FT                   /translation="MSSIGHDVVAGHEHVHGDHAHETPHGWRRWLFATNHKDIGTLYLI
FT                   FSFTMFLSGGVMALMIRAELFEPGLQIMRPEFFNQLTTMHGLIMVFGAIMPAFVGFANW
FT                   MVPLQIGASDMAFARMNNFSFWLLPVAAVLLVGSFFAPGGATAAGWTLYAPLSTQMGPG
FT                   MDFAIFAVHLMGASSIMGGINIVVTILNMRAPGLTLMKMPMFVWTWLITAYLLIAVMPV
FT                   LAGAITMVLFDRHFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIVSQVIPA
FT                   FARKPLFGYSSMVYATSSIAILSFMVWAHHMFATGMPVTGQLFFMYATMLIAVPTGVKV
FT                   FNWVATMWRGSLSFETPMLFAVGFLLVFTFGGLSGLMLAMAPLDIQYHGTYFVVAHFHY
FT                   VLVAGSLFALFAGWYYWAPKWTGWMYNETRGKIHFWASMFFFNLAFLPMHFVGLAGMPR
FT                   RYADYPAQFTDWNQVITIGAFGFGLAQVYFLFAVALPAYRGGGELEKAGDKPWDGATGL
FT                   EWTVPSPAPFHTFENPPTVE"
FT   gene            328368..328982
FT                   /locus_tag="Bxe_A4169"
FT   CDS             328368..328982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4169"
FT                   /product="Putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28831"
FT                   /db_xref="GOA:Q146A8"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A8"
FT                   /protein_id="ABE28831.1"
FT                   /translation="MSTQPPAQADRSFNRPMLIKLFIVALMMFGFGFALVPMYRAICQI
FT                   TGINNLVQRDVTVREAKNTQVDMSRTISIEFDANARGPLGFKPEQRSLDVHPGEVTTVM
FT                   YEVSNEQARTIQAQAIPSYAPKQATEYFRKIECFCFTQQTLTANQTKRMPVVFVVDPKL
FT                   PKDVKTITLSYTFFELNTPVSATAGSAAPTANTAATAANPA"
FT   gene            329018..329227
FT                   /locus_tag="Bxe_A4168"
FT   CDS             329018..329227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4168"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4168"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28832"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A7"
FT                   /protein_id="ABE28832.1"
FT                   /translation="MSDNGGSPRRSSFGQSMRAVFWSFFGVRKRRDLEADATQLNPLHV
FT                   IAAALICAAIFIVVLILIVRAVVG"
FT   gene            329359..330216
FT                   /locus_tag="Bxe_A4167"
FT   CDS             329359..330216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4167"
FT                   /product="Putative cytochrome c oxidase, subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28833"
FT                   /db_xref="GOA:Q146A6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A6"
FT                   /protein_id="ABE28833.1"
FT                   /translation="MSGQNESPYYFVPHPSRHPISAAAGLLVMLGSLAAWINEHDWAPI
FT                   GVVAGLLWLLFTLWHWFGDAIAESEGGMYGKNVDKSYRWSMSWFIFSEVMFFGAFFGAL
FT                   FYAREIALHQLGSLDYKLIWPDFSAVWPNNGPAALVSTFKSMQPWPVPTINTALLLSSG
FT                   ATLTVSHHALRENHRKKAIIWLAATLVLGVCFLFLQGFEYFHAYNELNLTLSSGVYGST
FT                   FFLLTGFHGFHVFLGGTMLAVVLVRMIRGHFTADHHFAFEGAAWYWHFVDVVWLGLYVV
FT                   VYWL"
FT   gene            complement(330380..330589)
FT                   /locus_tag="Bxe_A4166"
FT   CDS             complement(330380..330589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4166"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4166"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28834"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A5"
FT                   /protein_id="ABE28834.1"
FT                   /translation="MHILVPIAFVLIIASMVSALYFMMHDKGKTKRMVWSLATRVGLSI
FT                   SLFLFILFAHWMGWIQSTGIPYGR"
FT   gene            330701..331417
FT                   /locus_tag="Bxe_A4165"
FT   CDS             330701..331417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4165"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28835"
FT                   /db_xref="GOA:Q146A4"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A4"
FT                   /protein_id="ABE28835.1"
FT                   /translation="MKIRLVPALLILLVIVVTVRLGFWQRDRAHQKEALEARITQFENA
FT                   PAQPVSAAPVELKDIEFHHVKARGSFVADKVVYLDNRPYNDQPGFYVVMPFKLADGGYV
FT                   LVNRGWLPRNMNNRETIAPYTTPQGEIEIEGIARADASRAFELGQGGSAEHQLIRQNLD
FT                   TAAYAAETGLPLQSFVIQQLSDDGDQLVRDWPAPTNGVERNYGYMFQWWGMAAAALVFG
FT                   LYAARRAAKKEHAPGV"
FT   gene            331487..332149
FT                   /locus_tag="Bxe_A4164"
FT   CDS             331487..332149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4164"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28836"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A3"
FT                   /protein_id="ABE28836.1"
FT                   /translation="MSTQSPRSPQAGKPAAPKVMPGQPNGKGSWERGRWILLLLAIICA
FT                   APIAVSYFTYYVIKPTGGSTSYGTLVEPQRPIPDSLVVTGEDGKPVKFATLRGHWLLIS
FT                   VDNTACDKACVTKLYFMRQIRAAQGPERERVVEVWLRTDAGNVADVIQKAYPDTNMMIA
FT                   DPAQVAAWLPTESGTKITDHIYMVDPNGNLMMRFPKDPNPSKIKGDVTKLLKWSSIG"
FT   gene            332172..333281
FT                   /locus_tag="Bxe_A4163"
FT   CDS             332172..333281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4163"
FT                   /product="Putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28837"
FT                   /db_xref="GOA:Q146A2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A2"
FT                   /protein_id="ABE28837.1"
FT                   /translation="MFVLQLALIGLCIALLPLSYVWVKADDNKFRKLVWLTTFLTLDLV
FT                   MFGGFTRLTDSGLGCPDWPGCYGTSSPFIAHAAITAAHQAMPTGPVSMTKAWIEMIHRY
FT                   FAMAIGVLIIAQTIIAWTARVKRRPLHVSPWWPTSLLLLILVQGAFGAWTVTMKLQPVI
FT                   VTTHLLLGLALLGTLGWLAARQTPLPAYEPEAARWRAAALAGLVLLIAQIALGGWVSTN
FT                   YAVLACTDFPTCNGQWVPPMDFAHGFHLWRALGMTGDGDVITQDALVAIHWTHRTFAIV
FT                   VVAYLVWLTLKLRRFESLRRPANGVLLVVLIQFITGLSNIVLQWPLPIAVAHNGGAAIL
FT                   LLLLVMLNFRIAYSRPGRAVFPARDAAPA"
FT   gene            333288..334193
FT                   /locus_tag="Bxe_A4162"
FT   CDS             333288..334193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4162"
FT                   /product="Protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4162"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28838"
FT                   /db_xref="GOA:Q146A1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q146A1"
FT                   /protein_id="ABE28838.1"
FT                   /translation="MDSTTLSQTPGSRVSQYIALTKPRVTQLAVFCAVIGMFLSTPGMV
FT                   PWTPLIGGTVGIWLLAGAAFAINCLVEQKIDAKMRRTSWRPSARGEITTAQILLFSAVL
FT                   GGLGMWTLYTFANPLTMWLTLATFVGYAVIYTLLLKPATPQNIVIGGASGAMPPALGWA
FT                   AVTGHVPGDAWILVLIIFVWTPPHFWALALYRRKDYENAGLPMLPNTHGEKYTRLHILL
FT                   YTVILFAVTMMPFISGMSGVVYLAAAVLLGALFLAYAWKIYREYSDDLARKTFRYSIVY
FT                   LSLLFAALLIDHYARVLIGA"
FT   gene            334198..334815
FT                   /locus_tag="Bxe_A4161"
FT   CDS             334198..334815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4161"
FT                   /product="Electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4161"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28839"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q146A0"
FT                   /protein_id="ABE28839.1"
FT                   /translation="MLKNRFARTARAAVIACALGGALLVAGCGKQPPAFQNLDITGNTQ
FT                   FASNFSLPDTSGHIRTMADYKGKVVVLFFGYTHCPDVCPTTMAELSQALQQLGPEDAKR
FT                   VQVLFVTVDPERDTPALLAQYVPAFNPTFVGLRPADQAQLTRITKDFRVYYAKVPGKTP
FT                   DSYTMDHTAASYVFDTDGKLRLFARDGQGATPWVHDIKLLLD"
FT   gene            complement(334882..335172)
FT                   /locus_tag="Bxe_A4160"
FT   CDS             complement(334882..335172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4160"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4160"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28840"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z9"
FT                   /protein_id="ABE28840.1"
FT                   /translation="MYVIDLIYTASLDRIDDALEAHRAFLARQFEAGVFVAAGPKVPRD
FT                   GGIILAVRIERDKMDEILASDPFAQQNLARYEVTEFRTTRLAAGLNLPIPA"
FT   gene            335435..337270
FT                   /locus_tag="Bxe_A4159"
FT   CDS             335435..337270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4159"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4159"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28841"
FT                   /db_xref="GOA:Q145Z8"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z8"
FT                   /protein_id="ABE28841.1"
FT                   /translation="MSLNRKLWLSLALVWLGLLGVGVWSAVETRGTMLAERKAGMVNLV
FT                   DAAQGIVSGYYALSQSGRMSEADAQREALARLAAMRYGESGYLFVMDSKPVVLMHPTLP
FT                   QMTGKAVGDFKDPDGKLLYVAIVDAAKASGRGFAQYRGRLPHSETAVPKLSYVVRFAPW
FT                   DWNITSGVFIKDIDTAYYETLLGHLAVVLVIGAVISLAMLLIIRNVRASLGGEPGQAAR
FT                   LAASIAQGDLTQVVEVRPHDKTSMMAAMNEMQNRLQRTIGEIRRSAESIASATQQIAAG
FT                   NSDLSQRTEQQAASLQETAASMEELTATVKQNADNARQASGLAHNASEIATRGNDVVSR
FT                   VIGTMGEINDSSRQIAEIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRS
FT                   LAQRSGTAAKEIRQLISASVERVHNGSTLVQQAGTTMGEILQAVQRVTDIMGEIAAASE
FT                   EQSSGISQVGRAVTQMDEVTQQNAALVEQAAAAAASLQDQAGRLREAVNAFRVDGAEDG
FT                   AQGSAVVAARRVTATVTQAATARDIGAGSQSAPASARAEPKLPASARAAGASASVSALA
FT                   SASATPVASAKPAAAPRAAAETARATQSDDDWTAF"
FT   gene            337532..338344
FT                   /locus_tag="Bxe_A4158"
FT   CDS             337532..338344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4158"
FT                   /product="ABC transporter, periplasmic ligand binding
FT                   protein, YaeC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4158"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28842"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z7"
FT                   /protein_id="ABE28842.1"
FT                   /translation="MQRRNILKALSAVIAGAAIVTSFGAHADDKVIKVGTIGGPDAQIW
FT                   EVVTKVAKREGLNVKVVEFNDYVQPNAALDAGDLDANSFQHQPYLDSQIKQRGYRIVNV
FT                   GLTYISPLGIYSKKLKSLKDLPQGAKVAVPNDPSNENRALLLLQTQGVIKLKAGAGTNG
FT                   NNATPLDVAENPKKIKLIELDAAQLPRSLSDVDAAAINTNFALAAGLQPTRDAIALEDV
FT                   HSPYANLIAVRTQDKDKPWVRKLVAAYQSEDVRQFIKTQFKGSVVPSF"
FT   gene            complement(338359..339285)
FT                   /locus_tag="Bxe_A4157"
FT   CDS             complement(338359..339285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4157"
FT                   /product="transcriptional regulator, MarR family with
FT                   acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4157"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28843"
FT                   /db_xref="GOA:Q145Z6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z6"
FT                   /protein_id="ABE28843.1"
FT                   /translation="MTDSEARRRAQAVRHFNRFYAQHIGALHEHLAKSAFSLTEVRVLH
FT                   ELHRGRAQTASVLGRALGLDSGYLSRLLTSFERRNLITRRPSDTDARQSLIALTDNGYA
FT                   AYAPLDTAAIEEVSTLLAGLSPLSQDQLIAAMKVIERLLGTEPRHELVTLRQPRAGECG
FT                   WLVYRQAQWFAAQYGWDQSFEGLLARIVADYTQRNDPLREMCWVAEQEGVVVGSVCIVG
FT                   VSTTVAGVRLLWVEPDVQRLGIGSQLLSECMRFARRAGYTKLTLTTATSLEQPRRLCER
FT                   AGFRLASAAAERRFGRDLTIERWELDL"
FT   gene            339660..340394
FT                   /locus_tag="Bxe_A4156"
FT   CDS             339660..340394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4156"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4156"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28844"
FT                   /db_xref="GOA:Q145Z5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z5"
FT                   /protein_id="ABE28844.1"
FT                   /translation="METRWSALMPDARNVTPLYLQLARNLATAIHCGVWSAGEALPSER
FT                   TLSDAIGVSRITARKAIELLVEQGLIRRARGAGSFITPRVEDPLSRLTGFTKKMQQRGF
FT                   RPDSVWLERDIRAANRDELVHLGLSPGAAVASLRRLRRADGIVMAVEHSALPAAIVPDP
FT                   QAIGDSLYSYLEHRGAAVVRALQHFRAVNASSEIAALMDIEPRSALLVITRIGYSADQR
FT                   AIELTDTYCRDDYYDFVAELRT"
FT   gene            340510..341613
FT                   /locus_tag="Bxe_A4155"
FT   CDS             340510..341613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4155"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4155"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28845"
FT                   /db_xref="GOA:Q145Z4"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z4"
FT                   /protein_id="ABE28845.1"
FT                   /translation="MLTGNILTTDGWIHGTLEYENGRITALAGDRVDPSTNDAPYILPG
FT                   FIDLHVHGGGGADVMEGDRAIETITRTHARYGTTSLLATTMTAPRDELMSVVAGLGHNA
FT                   RIRTPGGARVLGVHLEGPYINPGKLGAQPDAAVSAVMDEVLKYLSIAPIRVVTLAPEIA
FT                   GHMEIISEMAARGVRVQLGHSLGTYDDAVAALKHGACGFTHLFNAMSPLHHRNPGLVGA
FT                   ALAHAEFAEIIPDLLHVHPGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKC
FT                   LGGVRLADGTLAGSTLTMDQALRNLVSIGLPIADVSNRLSRYAADYLGIEDRGRIARGA
FT                   WADVVVFDRELALSATYVEGEAIVEYA"
FT   gene            341606..342613
FT                   /locus_tag="Bxe_A4154"
FT   CDS             341606..342613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4154"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4154"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28846"
FT                   /db_xref="GOA:Q145Z3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z3"
FT                   /protein_id="ABE28846.1"
FT                   /translation="MLKEALASAETVAAQLMDTSRVEALAAKLAQQPRHVALTVARGSS
FT                   DHAASYFASLTMSRLGVPVASLPMSVATLQQAPLQVCDQLALAFSQSGKSPDLVGTMEA
FT                   LRKAGALTVAAVNVSGSPLADACEFELPLVAGPELSVAATKSYIAMLSISAQLVAHWQK
FT                   DAELLAALKTLPEALRAAGKLDWSNAVEELRGVERMIVIGRGLGLAIAQEAALKLKETS
FT                   GIQAEAFSSAEVRHGPMELIDRDYPLLVFAPRGPEQAGLLQLARDMQARGARVLLAAPA
FT                   DVPEATLPLAITAHAALDPIAAILSFYVMAAGLAAARGRNPDAPRHLNKVTETH"
FT   gene            342652..345216
FT                   /locus_tag="Bxe_A4153"
FT   CDS             342652..345216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4153"
FT                   /product="PTS system IIA component, Glc family /
FT                   Phosphocarrier protein HPr"
FT                   /EC_number="2.7.3.9"
FT                   /note="TC 4.A.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4153"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28847"
FT                   /db_xref="GOA:Q145Z2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z2"
FT                   /protein_id="ABE28847.1"
FT                   /translation="MSHSEGHIVLLAPMTGPVVPLANVPDPVFSGGMFGDGIGIDPLEG
FT                   RLVAPCDGTVTHLARTGHAVTLATAEGAEILLHIGIDTVALNGKGFAPMVAQGAHVRAG
FT                   QVLIEFDQDQVALNAPSLVSVVAIANSDAFEIVERVQGGLLKAGETPLLVLRARGGAAA
FT                   EASRQASATNVAEEARQQVTLVHAGGLHARPAARAREAARGFDARVEVRYEGRKAAIES
FT                   VVGLLGLGAGEGATVELLGIGPQARAAIEAIAHELTREAQGEAEEKPARESSPAPQAVG
FT                   HAADEALAPNTLAGVCAAPGVAVGKLVRWDDADIDPPEKAAGTSAAESRLLDKAIATVD
FT                   ADLGTTVRDASQRGAVGEAGIFAVHRVLLEDPTLLDAARDLISLGKSAGFAWRAAIRAQ
FT                   IAILAKIEDALLAERAADLRDIEKRVLRALGYTNAASRTLPEEAVLAAEEFTPSDLSTL
FT                   DRSRVTALVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVVVNATTGRLEFA
FT                   PTELDVERARLERSRLAGVREANRRTSQQAAVTSDGRAIEVAANIATLDDAKTAVENGA
FT                   DSVGLLRTELLFIHRAAAPTTDEHRQSYQAIVDALSGRTAIIRTLDVGADKEVDYLTLP
FT                   PEPNPALGLRGIRLAQVRPDLLDDQLRGLLAVRPLGAVRILLPMVTDVGELIRIRKRID
FT                   EFARESGRTEPIEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTLAMDRCQADLA
FT                   AQADGLHPAVLRLIAATVQGAGKHGKWVGVCGALAGDPLAMPLLIGLGVTELSVDPVSV
FT                   PGIKARVRNLDYQLCRQRAQDALALESAQAVRAASRETWPLD"
FT   gene            345301..347088
FT                   /locus_tag="Bxe_A4152"
FT   CDS             345301..347088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4152"
FT                   /product="PTS system N-acetylglucosamine-specific IIC
FT                   component, Glc family / PTS system
FT                   N-acetylglucosamine-specific IIB component, Glc family"
FT                   /EC_number="2.7.1.69"
FT                   /note="TC 4.A.1.1.2; TC 4.A.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4152"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28848"
FT                   /db_xref="GOA:Q145Z1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z1"
FT                   /protein_id="ABE28848.1"
FT                   /translation="MDGNPFLKIQRLGRALMLPIAVLPVAGLLLRLGQPDVFNIKMIAD
FT                   AGGAIFDNLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLVEVAVMKDINDKLNMGVLSGI
FT                   VAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLALGIVFGYVWQPVQAVIDT
FT                   AGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWFVFGTFTPPGGAPVTGDLHRFF
FT                   AGDPTAGTFMTGFFPVMMFGLPAACLAMFHEAPKERRAVVGGLLFSMALTSFLTGVTEP
FT                   IEFSFMFLAPVLYVIHALLTGLSLAICSALGIHLGFTFSAGAIDYVLNYGLSTRGWWAI
FT                   PIGLVYMVVYYGLFRFFIRKFNMATPGREPAAADEQVDSFSAGGFVSPVAGAAVPRAQR
FT                   YIAALGGAANLSVVDACTTRLRLSVVDSNKVSENELKTIGARGVLKRGSTNVQVIIGPE
FT                   ADIIADEIRTVIAQGGGHAVTPAAAATATAAAAVAPVAAAGDQARGGPLDPDPLRWLAV
FT                   FGGAGNVVSLDAVAATRLRVVVRDPSAVDRQRLATLDTAWVSADTFHIVVGEAAQRYAE
FT                   KLATRLSPGTGAGAAPQPA"
FT   gene            347329..348651
FT                   /locus_tag="Bxe_A4151"
FT   CDS             347329..348651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4151"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4151"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28849"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Z0"
FT                   /protein_id="ABE28849.1"
FT                   /translation="MSMRSAICLMFFLPAGVAYAGGQFNVQCAYSHTLPDDAIIYPGQP
FT                   GRAMVHDFFGNTGADAYSTYYSLNDNKVSTCNVAADPSSYWVPQLKRASGIVVPGYQKT
FT                   YYKNDQPVVPLHTIPAGLEMLAGDHRSSSPKPQINYLCRGGSYTQIAPTRCPVVTDSSG
FT                   TYAQLDISVHFPDCWDGRTLVPSMASHIMNMAYRQADGKCPAAYPVKIPELQLNVAYDL
FT                   GQDPDLSTAQLSMDPILVNGTWVPQWGSLYTAHADFINAWKIDSLQYAVDNCSNADIAC
FT                   SNSIPTYYSKASADVWMDGSGVAHASDSTMISDAASTVLIKFPTPTDLKDYPYTNSYLQ
FT                   TLAQNVTDTSAVTLDIYAASTNWNDTANLPTTAACNTNQRIGGIYLDNALQPRINDITR
FT                   YVASQVAAGASQIGVCIRNATGRTVQISSRDGTRTPALFMK"
FT   gene            complement(348772..348888)
FT                   /locus_tag="Bxe_A4150"
FT   CDS             complement(348772..348888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4150"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4150"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28850"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y9"
FT                   /protein_id="ABE28850.1"
FT                   /translation="MWYFSWILGIGVALAFGIINVMWLESRRPLEAGKPKTH"
FT   gene            complement(348917..350053)
FT                   /locus_tag="Bxe_A4149"
FT   CDS             complement(348917..350053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4149"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4149"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28851"
FT                   /db_xref="GOA:Q145Y8"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y8"
FT                   /protein_id="ABE28851.1"
FT                   /translation="MDYATLKLIWWVLIGVLLIGFALTDGFDMGAAILLPFIGKTDAER
FT                   RIVVNTVGATWEGNQVWLITAGGAMFAAWPLVYAASFSGFYFAMLLVLFSLFFRPVGFD
FT                   YRSKREDPRWRSAWDWALFVGGFVPALVFGVAFGNLLQGVPFSFDTDLRVTYHGGFFAL
FT                   LNPFAVLCGLVSVSMLAAHGAAFVKMKADDIVAERASLALRIASFAAVVLFLIAGALIA
FT                   TMIGGYQLVDAAPLDTVANPLLKSVTGAPGLWLANYATYPWMVAAPVAGLAGGVLATLL
FT                   ARSRFEKSAFLATSLMIIGVILTAGFSMFPFIMPSSLDGRSSLTVWDSTSSRMTLQIML
FT                   IAVIVFLPLILIYTSWVYRVMRGKVTAAALEENHHSMY"
FT   gene            complement(350089..351696)
FT                   /locus_tag="Bxe_A4148"
FT   CDS             complement(350089..351696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4148"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4148"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28852"
FT                   /db_xref="GOA:Q13XY2"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q13XY2"
FT                   /protein_id="ABE28852.1"
FT                   /translation="MPVSEVVELSRLQFAITALYHFLFVPLTLGLSWLLVIMESVYVMT
FT                   GKQIYKDMTQFWGKLFGINFAMGVTTGLTLEFQFGTNWSYYSHYVGDIFGVPLAVEGLM
FT                   AFFLESTFVGLFFFGWKRLSRVQHVIVTFLVALGSNLSALWILVANGWMNNPVGATFNY
FT                   QTMRMELDSIFSVLFNPVAQVKFVHTVSAGYVTASMFVLGVSSWYLLKRRDTEFALRSF
FT                   AIAAGFGLASTLCVIVLGDESGYRTGEVQQVKLAAIESEWETAPAPAPFTIIGIPNQKE
FT                   ERTDYAIRVPYALGLIATRSLDEPVVGLKDLMVRNEARIRNGMLAYAALQKLKQGDVTD
FT                   EAKAAFDAHKQDLGYGLMLKQFTANVTDATPDQITQAAKKTIPPVAPVFFSFRLMVGLG
FT                   ILFLATFVLAFWFCAQRSLLLEKRRWFLRWALWAIPLPWLAAEFGWIVAEVGRQPWTIA
FT                   GILPTNLSASSLTAGDLYLSIGGFVVFYTVLFIIEIMLMFKYARLGPSSLHTGRYHHEQ
FT                   PSPDQPLDNRPLPTSTVA"
FT   gene            complement(351686..351946)
FT                   /locus_tag="Bxe_A4147"
FT   CDS             complement(351686..351946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4147"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28853"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y6"
FT                   /protein_id="ABE28853.1"
FT                   /translation="MTIALNRNTIRRPSLRKRFDGWVRGPTLARDIAIVLAIKFALLMV
FT                   LKYTFFNHPQAENMSLPPEQVAQALLSVPASHPSQGDQHAR"
FT   gene            complement(352292..353215)
FT                   /locus_tag="Bxe_A4146"
FT   CDS             complement(352292..353215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4146"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4146"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28854"
FT                   /db_xref="GOA:Q145Y5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y5"
FT                   /protein_id="ABE28854.1"
FT                   /translation="MTLPSTLSPSSAKAASAGALALSHSSLLPGQLGNIDAYIQAVNRI
FT                   PMLTPAEERQFATEFREQDNLESARRLVLSHLRLVVSIARNYLGYGLPHADLIQEGNIG
FT                   LMKAVKRFDPEQNVRLVSYAMHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLRSHKQ
FT                   GLGAFTPDEIEGLAKELNVKREEVSEMETRLSGGDIALEGQVEDGEESYAPIAYLADSH
FT                   SEPTAVLASRQRDKLQSDGIASALDALDARSRRIIEARWLKVEDDGSGGSTLHELADEF
FT                   GVSAERIRQIEASAMKKMRGALTEYA"
FT   gene            353591..354154
FT                   /locus_tag="Bxe_A4145"
FT   CDS             353591..354154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4145"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28855"
FT                   /db_xref="GOA:Q145Y4"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y4"
FT                   /protein_id="ABE28855.1"
FT                   /translation="MNNKKNVLRDLALKITAGAVLVGASGVASADQFGVQVAGGLGDRH
FT                   VKKLDLGFVWDPDLNWWQIGDWHFSLIGEAHVAWWHTNEGNVHDNIGEVGVTPIIRFIK
FT                   ESGPIRPYAELGAGIRLLSSPRISSTFTLGTAFQFADMAGVGMQFGNRQQYQAGYRFQH
FT                   ISNGGIKEPNPGINFHQLYLQYNF"
FT   gene            354198..354581
FT                   /locus_tag="Bxe_A4144"
FT   CDS             354198..354581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4144"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28856"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y3"
FT                   /protein_id="ABE28856.1"
FT                   /translation="MAAKIIEAIRGLERERFRAMVDGDGQSLDTLLAENVSYVHTNGKR
FT                   ETKRQFIDGIVAGRRRYRQIEVQSQDVLPVGRETCVVTGRALIEMEANNGALLFPIAYT
FT                   AIHTQADGQWRLIAWQATRCAIE"
FT   gene            complement(354822..355793)
FT                   /locus_tag="Bxe_A4143"
FT   CDS             complement(354822..355793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4143"
FT                   /product="Putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4143"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28857"
FT                   /db_xref="GOA:Q145Y2"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y2"
FT                   /protein_id="ABE28857.1"
FT                   /translation="MTDSADTANLFPCARFIKEIGRGPNGARALTAEDTRALYTAMLDG
FT                   RVADLELGAVLLAYRVKGETADELAAMLAGAHASFEPVHLPHGAFRPVSIPTYNGARKQ
FT                   PNLVPLLALLLAREGVPVLVHGVTEDPGRVTSAEIFTHLQIPHAQSHADIEDGLAERRL
FT                   AFAPIDVLAPKLARLLALRRRMGVRNSTHTLVKILQPFAPAGLRLVNYTHPPYRDSLTQ
FT                   LFNTHPDAAAGGALLARGTEGEAVADTRRQVQVDWLHDGICETRVPHERSSPDAPEVDL
FT                   PDARDAPTTAAWISAVLRGEAPVPSAIERQVELIVDVAKTPV"
FT   gene            356022..356720
FT                   /locus_tag="Bxe_A4142"
FT   CDS             356022..356720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4142"
FT                   /product="Putative fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4142"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28858"
FT                   /db_xref="GOA:Q145Y1"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y1"
FT                   /protein_id="ABE28858.1"
FT                   /translation="MSYVFAPAPVVAVPVVGSSEQFAVRRIYCVGRNYEAHAREMGHDP
FT                   DREPPFFFTKPADAVLYVAPGATGEFPYPPQSKNVHFEMEMVAAIGKGGKNIAAESALD
FT                   HVYGYALGLDMTRRDLQAEAKKLGRPWDTAKGFDHSAPLGPIHPAATVGHVGKGAIWLS
FT                   VNGEEKQSSDVSQLIWSVAETVAYLSTLFELQPGDLIFTGTPEGVGAVVPGDLMKGGVD
FT                   GLGEFSVRVV"
FT   gene            356750..357394
FT                   /locus_tag="Bxe_A4141"
FT   CDS             356750..357394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4141"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="Homogentisate pathway; Citation: J Bacteriol. 2001
FT                   Jan;183(2):700-8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28859"
FT                   /db_xref="GOA:Q145Y0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y0"
FT                   /protein_id="ABE28859.1"
FT                   /translation="MKLYSYFRSSASYRVRIALNVKNLPYEYVPVHLVREGGEQLKPEY
FT                   RKVNVDCVVPTLVEGNDVMPQSLAIIEYLEETHPEPPLLPKAPVDRAYVRALALQVACE
FT                   IHPLNNLRVLKYLKHTLGVDDYAKDAWYRHWVEAGFATFEAHLAGDSRTGKLCFGDTPT
FT                   IADTCLIPQVFNAQRFKVDTAKFPTIQRIYDHAMQLDAFARAAPDVQPDAE"
FT   gene            complement(357484..358641)
FT                   /locus_tag="Bxe_A4140"
FT   CDS             complement(357484..358641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4140"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /function="Cell division transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4140"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28860"
FT                   /db_xref="GOA:Q145X9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X9"
FT                   /protein_id="ABE28860.1"
FT                   /translation="MFSFFKRFKGSKESDNAPEESQSAPEGSTPEAAVQAPAPVAPVAP
FT                   RPAAAPARVETAAAPAIGPEPEESAPGTVEIVPPPLPDAGAKRSWLTRLKTGLSKTSSS
FT                   LTGIFVGTKIDEDLYEELETALLMSDAGVDATEYLLEALREKVRTERLTDPQQVKAALR
FT                   TLLVDLLKPLEKSLMLGRAQPLVMMIAGVNGAGKTTSIGKLAKHLQSFDQSVLLAAGDT
FT                   FRAAAREQLAIWGQRNNVTVVSQESGDPAAVIFDAVGAARARKIDVMMADTAGRLPTQL
FT                   HLMEELRKVKRVIGKAQEGAPHEVLLVIDANTGQNALAQVKAFDDALGLTGLIVTKLDG
FT                   TAKGGILAAIARQRPIPVYFIGVGEKVEDLQPFSAEEFSDALLGS"
FT   gene            358883..359497
FT                   /locus_tag="Bxe_A4139"
FT   CDS             358883..359497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4139"
FT                   /product="Conserved hypothetical protein 95"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28861"
FT                   /db_xref="GOA:Q145X8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X8"
FT                   /protein_id="ABE28861.1"
FT                   /translation="MPRSAPSRAQGASSKGGKPHAIRIIGGDWKRTPLPVLDLDGLRPT
FT                   PDRVRETLFNWLGQNLEGQRCLDLFAGSGALGFEAASRGAARVLMVERNARAAGQLRAN
FT                   QERLSARTIEIAEADGLRLAASLAPGSFDVVFLDPPFGTDLLGKALALAAPLVSANGFL
FT                   YVEAGEALELEGNETLAGWEIVRQGKAGAVHFHLLQRENKE"
FT   gene            359609..360124
FT                   /locus_tag="Bxe_A4138"
FT   CDS             359609..360124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4138"
FT                   /product="Coenzyme A biosynthesis protein,
FT                   Cytidyltransferase-related protein"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4138"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28862"
FT                   /db_xref="GOA:Q145X7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145X7"
FT                   /protein_id="ABE28862.1"
FT                   /translation="MVVAVYPGTFDPLTRGHEDLVRRASSIFDTLVVGVADSRNKKPFF
FT                   TLEERLDIAHEVLGHYPNVQVMSFKGLLKDFVRSNNARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVEQWLKEKVAALDPA
FT                   NGASAAQP"
FT   gene            360188..360445
FT                   /locus_tag="Bxe_A4137"
FT   CDS             360188..360445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4137"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4137"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28863"
FT                   /db_xref="GOA:Q145X6"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X6"
FT                   /protein_id="ABE28863.1"
FT                   /translation="MALMITDECINCDVCEPECPNDAISMGPEIYVIDPKKCTECVGHF
FT                   DEPQCIQVCPVECIPRDPEHLETPGELMAKYHALQAAKGE"
FT   gene            complement(360527..361606)
FT                   /locus_tag="Bxe_A4136"
FT   CDS             complement(360527..361606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4136"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4136"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28864"
FT                   /db_xref="GOA:Q145X5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X5"
FT                   /protein_id="ABE28864.1"
FT                   /translation="MSRYWSDIVHRLTPYVPGEQPVVTHPVKLNTNENPYPPSPRVLEA
FT                   IRQELGDAAESLRRYPDPTAQKLRETVAAYHGIRAEQVFAGNGSDEVLALTFQALLKHD
FT                   KPLLFPDVTYSFYPTYARLFEVDYRTIPLDDSFTIHVDDYMSPNGGILFPNPNAPTGRP
FT                   LPLADIERLVASSPDSVVVIDEAYVDFGAQSAIGLIDRYPNLLVVQTVSKSRSLAGMRV
FT                   GFAFGNPDLIGALNRVKDSFNSYPLDRLAQAAAAAAYEDDAWFRDTCAKVVASRERLAA
FT                   GLTALGFEVLPSAANLLFARHEGYDAATLALRLRDKEIFVRHFKAPRIDQHLRISVGTD
FT                   AECDILLDALRDIFSAYVG"
FT   gene            complement(361676..362278)
FT                   /locus_tag="Bxe_A4135"
FT   CDS             complement(361676..362278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4135"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4135"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28865"
FT                   /db_xref="GOA:Q145X4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145X4"
FT                   /protein_id="ABE28865.1"
FT                   /translation="MIKLIVGLGNPGAEYTATRHNAGFWLVDQLAREAGTTLRDERRFH
FT                   GFYAKARLHGEEVHLLEPQTYMNRSGQSVVALAQFFKILPDEILVAHDELDMPPGSVKL
FT                   KLGGGSGGHNGLKDITAHLSSQQYWRLRIGIGHPRDLIPESARAGARPDVANYVLKPPR
FT                   REEQDVIDASIERALAVMPQVIKGELERAMMQLHRNP"
FT   gene            complement(362427..363050)
FT                   /locus_tag="Bxe_A4134"
FT   CDS             complement(362427..363050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4134"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4134"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28866"
FT                   /db_xref="GOA:Q145X3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145X3"
FT                   /protein_id="ABE28866.1"
FT                   /translation="MKVVAFERSLQGTGASRRLRNSGKTPGIVYGAGAETQLVELDHNA
FT                   LWHALKKEVFHSSILDLEVAGKSQQVLLRDVQYHPFRQLVLHVDFQRVDAKKKLHTKVP
FT                   LHFLNQETNPAVKLSSAVISHVINEIEIECLPSALPEFLEVDLATIEAGHSVHAKDIKL
FT                   PAGVTLVAHVEAENPVIAAATIPAGAIAEGEAAAAEGEGETPAA"
FT   gene            complement(363214..364170)
FT                   /locus_tag="Bxe_A4133"
FT   CDS             complement(363214..364170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4133"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4133"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28867"
FT                   /db_xref="GOA:Q145X2"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X2"
FT                   /protein_id="ABE28867.1"
FT                   /translation="MSSHDGLMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQV
FT                   EIQENVRGKDVFVLQSTCAPANDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRP
FT                   RSARVAISAKIVANMLEIAGVERIITMDLHADQIQGFFDIPVDNIYATPVLLGDLRKQN
FT                   YENLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMD
FT                   DMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAGERIAASALDELVVTDTIPLGE
FT                   EARSCAKIRSLTSAGLLAETFSRIRRGDSVMSLFAES"
FT   gene            complement(364217..364293)
FT                   /locus_tag="Bxe_AR0020"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(364217..364293)
FT                   /locus_tag="Bxe_AR0020"
FT                   /product="tRNA-Gln"
FT   gene            complement(364346..365227)
FT                   /locus_tag="Bxe_A4132"
FT   CDS             complement(364346..365227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4132"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28868"
FT                   /db_xref="GOA:Q145X1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145X1"
FT                   /protein_id="ABE28868.1"
FT                   /translation="MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGD
FT                   TLHFTRRDDGLITRRTEIADVPPEHDLTVRAATLLKTHTGSPEGVDIEIDKRLPMGAGL
FT                   GGGSSNAATTLLALNRLWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVV
FT                   QLPPRHFLVVTPRVHVPTAAIFSEKALTRDSKPLTITDFPAELSCNTEWPESFGRNDMQ
FT                   QVVVGKYAEVAQVLRWFENVAPARMSGSGASVFAAFRSKAEAEAVQAKLPAEWNSAVAA
FT                   SLDQHPLFTFAS"
FT   gene            complement(365318..365953)
FT                   /locus_tag="Bxe_A4131"
FT   CDS             complement(365318..365953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4131"
FT                   /product="Putative outer membrane lipoprotein carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4131"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28869"
FT                   /db_xref="GOA:Q145X0"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X0"
FT                   /protein_id="ABE28869.1"
FT                   /translation="MRLSRLISFPRAPRGAALGFAAAAVVALAGCASVKPQGPSTSNAA
FT                   TSVTAQTSRSYQGRFAVQYNDQNGQQRNAYGNFAWQETGDTVTLELRNPLGQTLAVVTS
FT                   SPASATLELPNRQPLTADNVSTLMQNALGFALPVEGLRYWLQPSPAPTSRARTEKDPDQ
FT                   PSRLKEITQDGWTIDYLAYVEPPATGVKRVNLTRSEPPLDIKLVLDHQ"
FT   gene            complement(365953..367794)
FT                   /locus_tag="Bxe_A4130"
FT   CDS             complement(365953..367794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4130"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28870"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W9"
FT                   /protein_id="ABE28870.1"
FT                   /translation="MNLSFVKLFLKRPASAFRVPHAVSARRMLGAAALAVWALAAVPAH
FT                   AQDSSPDSDDTSVTLPDPLGPASAEDQKSLPGVPLTSQIVFQVLAAEVALQRDQPAPAY
FT                   QTYLALARDTHDPRMAQRATEIALAAQSPSDALAAAQLWQQYAPNSERAAQLDASLLVL
FT                   SGRPDDAEPILARELARVPADNRGSAILALQLLLSRGPNRIGGLHVLQDLLKNDLNRPE
FT                   AQLALARQQLVSDDAPGARKSLEQALALKPDYLPAALMLSQMGPEERKEGIASLEKYVQ
FT                   QNPKSHDARLALAQMYLASDRLDDAQKQFEIMHRNNANDLTPLMALALIKIQQKNFNEA
FT                   QTYLTQYAQQAEKTPGADPGQAYIYLAQLSLEQKNDAAASDWLNKISPSSQQYVPAQIT
FT                   RAQLLAKQGKADDARKLLANLPAPDPRDQALIARTDAAILFDARRYPEAETRLQQATAQ
FT                   FPDDPDLTYDYAMSAEKTGHYDVMETQLRKLIQTQPDNPQAYNALGYSLADRNQRLAEA
FT                   DKLVEKASSLAPNDAFIMDSVGWVKYRMGDTSDAIKLLRKAYDMQPNAEIGAHLGEVLW
FT                   KTGNQDQARAAFRDARKLEPDNDTLVKTLQRLQVNDL"
FT   gene            367882..368712
FT                   /locus_tag="Bxe_A4129"
FT   CDS             367882..368712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4129"
FT                   /product="Formamidopyrimidine-DNA glycosylase /
FT                   DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4129"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28871"
FT                   /db_xref="GOA:Q145W8"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145W8"
FT                   /protein_id="ABE28871.1"
FT                   /translation="MPELPEVEVTRRGIEPYVSGRKVERVEVRTPALRWPIPADLAKTL
FT                   RGRVVRKVERRGKYLLFEIDAGWFIVHLGMTGTLRVLRHVPHPPAAAKHDHVDWIFDEF
FT                   ILRYRDPRRFGAVLWHPREAGDVLEHPLLAGLGVEPFSPAFSGALMHRLTRGRKVSVKQ
FT                   ALLAGEIVVGVGNIYASESLFRAGIRPATAAGRVSLVRYDLLADAVRVTLAAAIEKGGS
FT                   TLRDFVGSNGESGYFQLDYFVYDRAGLPCRVCGTPIKQIVQGQRSTYFCPTCQR"
FT   gene            368720..369847
FT                   /locus_tag="Bxe_A4128"
FT   CDS             368720..369847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4128"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4128"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28872"
FT                   /db_xref="GOA:Q145W7"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W7"
FT                   /protein_id="ABE28872.1"
FT                   /translation="MPSRLTPRSTSSGAPAAPAFPVMSDFSARLIAWQRQHGRHDLPWQ
FT                   NTRDPYRIWLSEIMLQQTQVSTVIPYYAKFLARFPSVAALAAAPSDDVMALWAGLGYYT
FT                   RARNLHRCAQVVVEQHGGGFPTSVEELAELPGIGRSTAAAIASFAFGARATILDGNVKR
FT                   VLARVFGVEGFPGEKKVENAMWTLAESLLPSNASDAEVSAYTQGLMDLGATLCVRGKPD
FT                   CLRCPFAVDCVANVTGRQRLLPTARPKKTVPTRRTWMLVLRDGNAVMLEKRPPSGIWGG
FT                   LWSLPEAADETALAERARAFGGDGAVSPLAPLTHVFTHFKLDIEPRLAELDRGVGALAA
FT                   LGDADTAWVALSDLDSFGVPAPVRKLLDSLQGSLI"
FT   gene            complement(369878..370510)
FT                   /locus_tag="Bxe_A4127"
FT   CDS             complement(369878..370510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4127"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28873"
FT                   /db_xref="GOA:Q145W6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W6"
FT                   /protein_id="ABE28873.1"
FT                   /translation="MSSSTVLADVPLFPLHTVLFPDGLLPLKIFEARYLDMARDCLREK
FT                   TPFGVCLLKSGAEVAREEEPSVPESIGCLAEIEECDVEAFGMLLIRARGTRRFRLLSHR
FT                   VESSGLLVGMAEPLGEDRPLEGNEQLARFGACAEVLERIIATIRERDPESLPFAEPFRL
FT                   DDPSWVSNRLAEVLPIALRARQKLMELQDAGARIDVVHHYMQQHQLL"
FT   gene            complement(370550..371488)
FT                   /locus_tag="Bxe_A4126"
FT   CDS             complement(370550..371488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4126"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28874"
FT                   /db_xref="GOA:Q145W5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145W5"
FT                   /protein_id="ABE28874.1"
FT                   /translation="MGTRCYDEIYGFDDSMRIILITGISGSGKSVALNALEDAGYYCVD
FT                   NLPPRFLPQLASYLAEDGQDRLAVAIDARSSASLDEMPAMIRDLSRAHDVRVLFLNAST
FT                   QSLIQRFSETRRRHPLSGSTSHDADVGLLNSLAEAIERERELVAGLAEFGHQIDTSNLR
FT                   ANVLRAWVKRFIEQKDSGLVLMFESFGFKRGVPLDADFVFDVRTLPNPYYDHELRPLTG
FT                   LDKPVIDFLDALPVVHEMIDDIEKFLAKWLPHFRDDNRSYLTVAIGCTGGQHRSVFIAE
FT                   TLAARLAASANVIVRHRDAPVEAGESSKLVA"
FT   gene            complement(371540..372508)
FT                   /locus_tag="Bxe_A4125"
FT   CDS             complement(371540..372508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4125"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4125"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28875"
FT                   /db_xref="GOA:Q145W4"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145W4"
FT                   /protein_id="ABE28875.1"
FT                   /translation="MDTSSINAQSIFDDNAATLKLSWLTGHEGWERGFSSESVANATSS
FT                   ADLVGHLNLIHPNRIQVLGDAEIDYYKRQTDEDRSRHMAELIALEPPFLVVAGGVPAPP
FT                   ELVLRCTRSSTPLFTTPMSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVL
FT                   VEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLI"
FT   gene            complement(372648..373163)
FT                   /locus_tag="Bxe_A4124"
FT   CDS             complement(372648..373163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4124"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4124"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28876"
FT                   /db_xref="GOA:Q145W3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W3"
FT                   /protein_id="ABE28876.1"
FT                   /translation="MERHSNAPARRTQATFSPVNMNRLAKFLPLENVVVGLSVTSKKRV
FT                   FEQAGLIFENQNGIARSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKQPLAAFVRLA
FT                   EPIPFESPDGQPVSLLIFLLVPEQATQQHLEILSEIAQLLSDRETRERLHTEQDRETLH
FT                   RLLTQWQP"
FT   gene            complement(373453..373812)
FT                   /locus_tag="Bxe_A4123"
FT   CDS             complement(373453..373812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4123"
FT                   /product="SSU ribosomal protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4123"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28877"
FT                   /db_xref="GOA:Q145W2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W2"
FT                   /protein_id="ABE28877.1"
FT                   /translation="MNLQISGHHLEVTPALREYVITKLDRVLRHFDQVIDGSVVLSVDN
FT                   NHKEKEKRQKVEINLHLKGKDLFVESCDSDLYAAIDLMIDKLDRQVIRHKDRLQGHAHE
FT                   AIKYQPAPQLDVPPQ"
FT   gene            complement(374061..375578)
FT                   /locus_tag="Bxe_A4122"
FT   CDS             complement(374061..375578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4122"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28878"
FT                   /db_xref="GOA:Q145W1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W1"
FT                   /protein_id="ABE28878.1"
FT                   /translation="MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVAMAISQNP
FT                   LLENEDDWIASPLRVAADGSLIAQAPNSSAPPDQMGGSTSSSSTSSSERAENGEPQGVD
FT                   EYNGLAGDSNGDASQWNLDDYGRSGNASDDDDLPPLQIHESSTSLRDHLMAQLRVTQAS
FT                   PRDRALVTFLIESLDDDGYLAATLEEVLADLPEELEVDLDELNAALALLHSFDPAGVGA
FT                   RSASECLKLQLLRLDASPTRTLALEIVAHHLELLAARDFTRLRKHLKASDDDLRDAHVL
FT                   IRSLEPFPGAAYGKAEADYVVPDIMVRKTAQGWQAELNPEVVPKLRINHLYANILRNNR
FT                   GDPGSGSLRQQLQEARWLIKNIQQRFETILRVAQAIVERQKSFFVHGEIAMRPLVLREI
FT                   ADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIG
FT                   AENPKSPLSDSRIAELLAEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(375786..376571)
FT                   /locus_tag="Bxe_A4121"
FT   CDS             complement(375786..376571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4121"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4121"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28879"
FT                   /db_xref="GOA:Q145W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W0"
FT                   /protein_id="ABE28879.1"
FT                   /translation="MSTSASLPNRKPAGTSSSLVVRNLKKRYGSRTVVKDVSLDVKSGE
FT                   VVGLLGPNGAGKTTSFYMIVGLVPLDAGEIDLDGKSISLLPIHKRASLGLSYLPQEASV
FT                   FRKLSVEENIRAVLELQHEDNGKRLSKDTITSRTEALLDELQIAHLRANPALSLSGGER
FT                   RRVEIARALATNPSFILLDEPFAGVDPIAVLEIQKIVKFLKQRNIGVLITDHNVRETLG
FT                   ICDHAYIISDGSVLAAGAPAEIIENESVRRVYLGEHFRM"
FT   gene            complement(376568..377239)
FT                   /locus_tag="Bxe_A4120"
FT   CDS             complement(376568..377239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4120"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4120"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28880"
FT                   /db_xref="GOA:Q145V9"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V9"
FT                   /protein_id="ABE28880.1"
FT                   /translation="MNESFPRFDTGRSRSLSACRAGLAALIVALPLAGFAPLAHADRAD
FT                   KDKPLNIEADNMTYDDLKQVNIFTGHVVATKGTIVIKAERVEVTQDPQGYQYATGTSSG
FT                   GNLSYFRQKREGLDEYIEGTAVRIDYDGKQDLTTLTTNATVKRLQGLSTVMDQVHGSVI
FT                   TYDGQSDFYTAKAGKDVAGPGNPTGRVRAMLAPRNGGAAPLNGAPATLAPSTTIQGAPN
FT                   Q"
FT   gene            complement(377260..377868)
FT                   /locus_tag="Bxe_A4119"
FT   CDS             complement(377260..377868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4119"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4119"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28881"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V8"
FT                   /protein_id="ABE28881.1"
FT                   /translation="MNQFRLTSLIPLVAMAALAGITWWLLQATLPRQNEGVVRPKEHTP
FT                   DYFADNFSISELDQSGSTQYRLTAQSLIHYEDDELSDLVKPAMRAFQPGKPIVTATGDT
FT                   GKVNGDASIVDLYDNARILRAPGYGDPQMQADSQHFRVLVNDDVIETEKPVKLQRGMSV
FT                   MTASGMNYNNVTRVMQLFGNVKGSIAPSETGGSSPKQPG"
FT   gene            complement(377865..378425)
FT                   /locus_tag="Bxe_A4118"
FT   CDS             complement(377865..378425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4118"
FT                   /product="Phosphatase YrbI"
FT                   /EC_number="3.1.3.45"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28882"
FT                   /db_xref="GOA:Q145V7"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V7"
FT                   /protein_id="ABE28882.1"
FT                   /translation="MALAPATATERASRVKLMIFDVDGVLTDGGLLFTAEGDTMKGFNS
FT                   MDGHGMKLLRQAGIETAIITGRKSGIVAARAKEMNITHVYQGVQDKPQAFADLLQQTGM
FT                   TAEECGYMGDDWVDLGVMLKVGFAAAPANSHPEVIARAHWVSEARGGRGAAREVCDTLL
FT                   RAQHKYEALLAAACSGEQRGLVG"
FT   gene            complement(378425..379408)
FT                   /locus_tag="Bxe_A4117"
FT   CDS             complement(378425..379408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4117"
FT                   /product="KpsF/GutQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28883"
FT                   /db_xref="GOA:Q145V6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V6"
FT                   /protein_id="ABE28883.1"
FT                   /translation="MIAKINGDRALALARDVLDIEADAVRALRDQLDDGFVGAVDFILG
FT                   CRGRVVVSGIGKSGHVARKLAATLASTGTPAFFVHPAEASHGDLGMVTAEDVFIALSNS
FT                   GETEELMAILPLIKRLGAKLIAMTGRPSSSLAQLADVHLNSGVAKEACPMNLAPTASTT
FT                   AALALGDALALAVLDARGFGRDDFARSHPGGALGRRLLTYVRDVMRTGDDLPKVTPEAT
FT                   VRDALFQLTAKRMGMTAIVDHDDHVAGIFTDGDLRRVLEREGDFRQLPIASVMTAGPRT
FT                   IGPDQLAVEAVELMERHRINQMLVVDEAGKLIGALNMHDLFSKKVI"
FT   gene            379570..381570
FT                   /locus_tag="Bxe_A4116"
FT   CDS             379570..381570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4116"
FT                   /product="Kef-type potassium/proton antiporter, CPA2
FT                   family"
FT                   /note="TC 2.A.37.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4116"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28884"
FT                   /db_xref="GOA:Q145V5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V5"
FT                   /protein_id="ABE28884.1"
FT                   /translation="MISPLEMTLFLLLASVAGVVTFRFLNLPPMLGYLTVGIVVGPHAF
FT                   GLIPDSAGAQNLAEFGVVFLMFSIGLEFSLAKLRSMRRLVFGLGLLQVLGTIAVAVTLG
FT                   FVLERWVHITWQASVALGGALAMSSTAIVSKMLAERLEIETEHGRNIFGVLLFQDLAVV
FT                   PLLIVIAALGGSSKDLVSSLGVAAIKIVVALSLLLIVGQRFMTRWFNVVARRRSQELFI
FT                   LNLLLVTLGCAFITDKFGLSLALGAFIAGMLIAETPYRHQVEEDIKPFRDVLLGLFFIT
FT                   TGMLLNPRVIWEHPLIVLGFLVGPILLKAVMITGLSRLFGASPGVAMRTGIGLAQAGEF
FT                   GFVLLNLILDKHLVDATLLQAILAAMLLSMLAAPFLIQNADRIVLRLSSTEWMMQSLQM
FT                   TRIATQSLKQSGHVIICGYGRAGQNLARMLEHEGLSYVALDLDPDRVAAAAAAGESVVF
FT                   GDAGRRESLLAAGIHRAAAIAITYANTPSALRVLHNIHELEPTLPVIVRTVDDADLEKL
FT                   LAAGATEVIPEIVEGSLMLASHTLVVMGVPMRRVVRRVEEMRDERYALLRGYFHGADDV
FT                   DDDDGHEQVRLQSVPVDENSDAVGRTLAELGLFEVGVEVTAIRRHGIRGVEPDPSTKLR
FT                   SSDIVVLRGLPEQLAEAEERLSKHRRAGAAA"
FT   gene            381657..382223
FT                   /locus_tag="Bxe_A4115"
FT   CDS             381657..382223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4115"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4115"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28885"
FT                   /db_xref="GOA:Q145V4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145V4"
FT                   /protein_id="ABE28885.1"
FT                   /translation="MSNALPSAPLDAADYIKSHIRTVPDWPEPGVQFRDITPLLQEPKS
FT                   LRVLIDLFVQRYIDAKLDYIAGLDARGFIIGPILAYELNLGFIPIRKAGKLPYNRLAQS
FT                   YELEYGCATVEIHEDACKPGDRVVIIDDLIATGGTMMAGKILLERLGAVVVEGAAIIDL
FT                   PELGGSKLLRDSGLALYTVTGFEGH"
FT   gene            382283..382897
FT                   /locus_tag="Bxe_A4114"
FT   CDS             382283..382897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4114"
FT                   /product="amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4114"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28886"
FT                   /db_xref="GOA:Q145V3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V3"
FT                   /protein_id="ABE28886.1"
FT                   /translation="MPDFLLFLATSIAITVAPGPDNLQVLARGISQGRAAGFVAALGFA
FT                   AGITFHTTLAALGVAALLRSSPTAFTAIKLAGAAYLIWIGIKALRSQGLATAHERAPQP
FT                   LMAVFRQSVLGNLLNPKVTLFFVVFLPQFVQPNGTQSVTLQMLELGVLFMLQTVVVFSL
FT                   FGVCAGMVGGYLKRRPRVGVWLDRLAGATFIAIGIRVALRD"
FT   gene            382972..383820
FT                   /locus_tag="Bxe_A4113"
FT   CDS             382972..383820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4113"
FT                   /product="Putative NTP pyrophosphohydrolase"
FT                   /note="including oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4113"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28887"
FT                   /db_xref="GOA:Q145V2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V2"
FT                   /protein_id="ABE28887.1"
FT                   /translation="MTLPCITAARRFDVQAHVPFWIDAEQVGWIRASDVPSLARWPDVF
FT                   DLDNARVTLTPTFNTVDLRSAALGSVIGALAAEGRIPGWRNETYAIRNAFDAPPLAYIE
FT                   RAASRFFGTMTYAVHLNGVVEYADGAPQLWIARRSDTKATDPGMLDNVVAGGIGWGFGV
FT                   EATIIKECWEEAGIPEEIAARAVAGRTAHVLQSLPEGTQAEQIFIYDLALPADFAPRNQ
FT                   DGEVGEHRLARIDEVARWIEEGAMTVDASLATLDCLLRRRWIDEDACAGIEALFVPPVF
FT                   A"
FT   gene            383922..384791
FT                   /locus_tag="Bxe_A4112"
FT   CDS             383922..384791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4112"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4112"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28888"
FT                   /db_xref="GOA:Q145V1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V1"
FT                   /protein_id="ABE28888.1"
FT                   /translation="MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRT
FT                   GEFFMRVHFQQVGGDPGLEALRASFATLAEQFGMRWELHDASVKPRVVIMVSKIGHCLN
FT                   DLLFRYRTGQLGIEIAAIISNHKEFYQLAASYDIPFHHFPLMGATPEAKAAQEARVLEV
FT                   IDEHQADLVVLARYMQILSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIG
FT                   ATAHYVTTDLDEGPIIEQEVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLN
FT                   GSKTVVFR"
FT   gene            complement(384870..386096)
FT                   /locus_tag="Bxe_A4111"
FT   CDS             complement(384870..386096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28889"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V0"
FT                   /protein_id="ABE28889.1"
FT                   /translation="MRRQLVRLHRWFGVATALFLFVAGLTGAVIAWDHELDAALNPSFF
FT                   KARTAGTALSGLELARRVEAADPRLQVTYLPLAAEPGHTLQMMVLPRTDPATRQPYPLD
FT                   FNQIAVDPATGEIQGRREWGAVSLARLNLIPFIYKLHYTLQLPFTGGVDIGTWLMGIVG
FT                   IVWLFDSVIALWLSFPSVKVWRKSFAFRFGRGGYALTFDLHRSGGVWIWGLLLIVALTS
FT                   ISMNLSAPVVRPIVSLFSPLTPDPVNNPEIRRAPQPGDTVLSRERIVQLAEQAGKARNL
FT                   GVAPGGIYYAEFMHAYGVGFYATGNDHGDIGLGNPWMYWDAATGRQLAAQIPGKGTAGD
FT                   IFLQVQFPLHSGRILGLGGRILISAVGVAVAVLSATGLLIWLKKLNARRRSAQNASAAR
FT                   DAGRSAARP"
FT   gene            386422..386706
FT                   /pseudo
FT                   /locus_tag="Bxe_A4110"
FT   gene            complement(386688..387773)
FT                   /locus_tag="Bxe_A4109"
FT   CDS             complement(386688..387773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4109"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4109"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28890"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U9"
FT                   /protein_id="ABE28890.1"
FT                   /translation="MTKRNQASEDGQVQDLRPRPVRLTSDMSLPRLSAVEIGSYVVMLF
FT                   GMWAVIELKLLGALLAGLLVFQLVHTIAPRIERHMSSRRARWLAVVILATVIVGALTGL
FT                   TLGIIEHFENDVPSVQKLLDQAMQLIDQARGRIPQFVANYLPVDTEQMKTRAAELMQTH
FT                   ANMLQQSGKTAARAFTHILIGMIIGAIIAVGAQKHMQRLPLSTAFVTRVTRFADAFRRI
FT                   VFAQVKISAINAVFTGIFLLVILPIFHDTLPLSKTLVLVTFIVGLLPVIGNLISNTIIV
FT                   AVALSVSFPAAVMSLVFLILIHKLEYFLNARIVGGQIEARAWELLIAMLIMEAAFGIPG
FT                   VVAAPIFYAYIKRELIYLRLV"
FT   gene            complement(387807..390680)
FT                   /locus_tag="Bxe_A4108"
FT   CDS             complement(387807..390680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4108"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4108"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28891"
FT                   /db_xref="GOA:Q145U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U8"
FT                   /protein_id="ABE28891.1"
FT                   /translation="MEQIRIRGARTHNLKNVNLDLPRHKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLFARVGTPYCPDHEIPLEAQSVSQMVDAALALPDETKLMILAPVVANRKGEHV
FT                   ELFEEMQAQGFIRFRVRSGGGTANEGVAKIYEVDSLPKLKKNDKHTIDVVVDRLKVRPD
FT                   MKQRLAESFETALRLADGRAIALEMDTDKEHLFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPECDGLGQITFFDPKRVVAHPSLSLAAGAVKGWDRRNQFYFQMLQSLAAFYEFDI
FT                   DTAVEDLPEKVRKILLFGSGKQEIPFSYINERGRTSVREHVFEGIIPNLERRYRETDSV
FT                   AVREELAKYQNNQPCPACAGTRLRREARFVRIGTDSDARGIFEISGWPLRDALGYFQTL
FT                   RLEGSKREIADKVVKEIVARLMFLNNVGLDYLSLERSAETLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIATLKHLRDLGNSVIVVEHDEDMIRMADYVVDMGPGA
FT                   GEHGGMVIAEGTPKQVQANAASMTGQYMSGARNIEFPDERKAPDERRLRIVEAYGNNLK
FT                   HVSLDLPVGLLTCVTGVSGSGKSTLINDTLYHAVAHHLYGSATEPAPYESIEGLEHFDK
FT                   VINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPAAKERGYEAGRFSFNVKGGRCESC
FT                   QGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLDVQYKGRNISEVLDMTVENAYEFFKP
FT                   VPVVARKLKTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPTT
FT                   GLHFHDIALLLEVIHRLRDQGNTVVIIEHNLDVIKTADWVIDLGPEGGAGGGQIVAQGT
FT                   PEQVAKSKASFTGKYLAPLLKRAASKK"
FT   gene            391066..392223
FT                   /locus_tag="Bxe_A4107"
FT   CDS             391066..392223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4107"
FT                   /product="major facilitator superfamily (MFS) multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4107"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28892"
FT                   /db_xref="GOA:Q145U7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U7"
FT                   /protein_id="ABE28892.1"
FT                   /translation="MSAPELRATVSLAAIFALRMLGLFMIMPVFSIYAKTIPGGDNVLL
FT                   VGIALGAYGVTQSMLYIFYGWVSDKVGRKPVIATGLLIFALGSFVAAGAHDMTWIIVGR
FT                   VIQGMGAVSSAVIAFIADLTAEENRTKAMAMVGGSIGVSFAVAIVGAPIVFQWVGMSGL
FT                   FTLVGIFSILAVGVVLWIVPDAPKPVHVRAPFAEVLHNVELLRLNFGVLVLHATQTALF
FT                   LVVPRILEAGGLPVASHWKVYLPVMGLSFVMMVPAIIAAEKRGKMKIVLLSAIALILIG
FT                   QLLLGVAPHTILSVAAILFVYFLGFNILEASQPSLVSKLAPGTRKGAAAGVYNTTQSIG
FT                   LALGGVVGGWLLKADGQSAVFFTCSGLVFCWLIIAAKMKQPPRKA"
FT   gene            392359..392892
FT                   /locus_tag="Bxe_A4106"
FT   CDS             392359..392892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4106"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28893"
FT                   /db_xref="GOA:Q145U6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U6"
FT                   /protein_id="ABE28893.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EMKEATEWHRVSFFGRLAEIVSEYLKKGSSVYLEGRIRTRKWQAQDGTDRYSTEIVAEQ
FT                   MQMLGGRGGSMGGGGDEGGYSRGEPSERSGGGGRAASGGGSRGGSGGGAGGGASRPSAP
FT                   AGGGFDEMDDDIPF"
FT   gene            complement(393031..394344)
FT                   /locus_tag="Bxe_A4105"
FT   CDS             complement(393031..394344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4105"
FT                   /product="Major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4105"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28894"
FT                   /db_xref="GOA:Q145U5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U5"
FT                   /protein_id="ABE28894.1"
FT                   /translation="MESIRRRSRFSATTGVLVVLCIMSFLMYVDRTNISTAALAIRRDL
FT                   HLSNSQLGIVFSAFALTYALAMIPGGFIGDRLGARKMLAVCGVLWGLGTLLTGFAGGLA
FT                   TLLLARFVVGLGESPIVPASARALTAWMEPERRGFSQGITHACARLGNASTPILVAGLI
FT                   TAFSWHIAFILLGAASLAWVVLWVWYYRDNPADHPGITPEDIARLPAKVGKTRVPMRWA
FT                   PLLRALWPATVVSFCHGWILWFFLNWMPSFFAQAYHLNIRHSAVFSSGIFLSGVVGTTL
FT                   GGWLSDLMFRKTGNIRRSRQTLITIGFLAPIVFFVPMFLHPSATLAAFSLAAALFLSEL
FT                   VTAPLWAVAMDLAPNHAATSSSIMNTGLGIAASVSPPLVGWLVDTMHSWEPVFALSMFF
FT                   LVLGPIAAHWIRPDRPYLGEPEAETEEAGGFAAQMDAY"
FT   gene            complement(394477..394908)
FT                   /locus_tag="Bxe_A4104"
FT   CDS             complement(394477..394908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4104"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28895"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U4"
FT                   /protein_id="ABE28895.1"
FT                   /translation="MPNFIKHIAFKVEDVEKERAFYENVFGYKHVNTVRRKGKNGDHIS
FT                   HHLTDGYMDLTLIHYESSDSDEADFAGPAPCIHHIGMEVEDLDAFIEQIKENGGEILTA
FT                   PGHLPVKFRSPNGPVAEVVPMQRWEKKTLAAGVHGEVLE"
FT   gene            395251..395991
FT                   /locus_tag="Bxe_A4103"
FT   CDS             395251..395991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4103"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4103"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28896"
FT                   /db_xref="GOA:Q145U3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U3"
FT                   /protein_id="ABE28896.1"
FT                   /translation="MPGFRTPGEQPLYEIVRARILERLRTGQWTAGDKIPAEPQLAEEF
FT                   GVGIGTIRRAVEELVAERLLIRRAGRGTIVAKFADEHAFDQYFSFVDTTGELMKVTARL
FT                   LRFGKERASPALASTLRLERGARLATADNLRLHDDVPVMLDRLWMPLDVFPDLDAGKFE
FT                   ARRGSIYGFYQEHFGISVVRVVEDLGGAAADEEAARALNIEVGAPVLRIERTAYTFKDQ
FT                   PVEFRVRLVDSSRCSYRNVRGLQD"
FT   gene            complement(395996..397381)
FT                   /locus_tag="Bxe_A4102"
FT   CDS             complement(395996..397381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4102"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28897"
FT                   /db_xref="GOA:Q145U2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U2"
FT                   /protein_id="ABE28897.1"
FT                   /translation="MSVEKPEGPGVIAEKLGAWIADVHASALPDRTVEIARLLLLDVTG
FT                   LCIAGRGESYVRATLQATDPGGACTALGHAGSFSAFDAALINGTAAHGEDYDDTFEGGP
FT                   VHSGAVVVPAVLAACEREGLGGEALLRGIAVGAELMCRLSLVAPRAIHSAGFHPTAVIG
FT                   ALAAAGGVAAALRLEARQTTSALGIAGSMAAGIIEYLAEGTSTKRMHAGWAAQSGIRAA
FT                   LMARGGFDGPRTVLEGKHGFFKAFAPSRAPDFSPVLETLGESWIMETIAFKPYACGTMT
FT                   QPYIDCAIALAERGVQAEQIRDIVCEVGEGTVHRLWEELAVKHRPPTAYAAKFSTPFCM
FT                   AVGFFDRKAGFGQFTEARIHDPAVLALAGKIRYVIDPDNEYPDNFTGHLRATLNDGTVQ
FT                   EVRQPHMRGGAREPLTGAELAQKFVDNAQHGGWNAALADEARGWCETVFGEPALGTIAR
FT                   FRQ"
FT   gene            complement(397464..398207)
FT                   /locus_tag="Bxe_A4101"
FT   CDS             complement(397464..398207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4101"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4101"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28898"
FT                   /db_xref="GOA:Q145U1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U1"
FT                   /protein_id="ABE28898.1"
FT                   /translation="MPRPTSSLELLRSVTLSGLVQEEILRRIKTGELEAGMKLNEMDLA
FT                   EHLKISRSPVREAFRALEEAGLVWLEKNRGVYIREISDAEAAELYEVRAGLDELAGRRL
FT                   ASRITDTQLQDLHAMLDQLEASSIHGELNNYFTLNIAFHDRLMELSGNATMLGLYRQVV
FT                   NRMHLLRRRGFSIAGSSQASHTEHRLILDALARRDPEAVAQAMRQHVQAGFQRAIAAHN
FT                   ADDTASAAEVPAGEAAQTTLADGSR"
FT   gene            398490..399773
FT                   /locus_tag="Bxe_A4100"
FT   CDS             398490..399773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4100"
FT                   /product="Major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4100"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28899"
FT                   /db_xref="GOA:Q145U0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U0"
FT                   /protein_id="ABE28899.1"
FT                   /translation="MSSSIDLAVVVARPYRVFIATWAGWMLDGFDNAIYIYVIVPALTE
FT                   LLPKSGFVADHAHIARLGGLMFSLFMLGWACSMFWGWCADRFGRVPTMCATILIYSIFT
FT                   GACGLAPGIVSFAIFRFLTGFGIGGEWAAGAPLLQESVPEHLRERLSGWLHTGTPIGFL
FT                   LASAAALVILPLGGWRVLFLIGSAPALLTIWLRLGVPESRRWQEQRRVQGPRARVRDLF
FT                   ARDMARTTWSAALMMTCLIFGLWSSTFWIPTLVITWQRAGGASVADAQYLGSLSGLILS
FT                   VGTLAGCVAMPWIVRWIPRRKSVASVFFSGALICNVASYFGIVVLLKSLPLFLITLPLL
FT                   GFFTSGVFSLFTIWLPEMFPTMQRALGSGFAFSFGRVLGAAGPSIVGALAAMFGSYPLA
FT                   ITAVSLIYLVGLFCVKWAPETAHRALRQ"
FT   gene            399879..401180
FT                   /locus_tag="Bxe_A4099"
FT   CDS             399879..401180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4099"
FT                   /product="Major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28900"
FT                   /db_xref="GOA:Q145T9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T9"
FT                   /protein_id="ABE28900.1"
FT                   /translation="MKSKAGMFTGTTGRVFLLICAMYFIEYVDRVNLSIAAPLLKSEMH
FT                   LSNTQLGIALSAFGYCYAIFQVVNGYLGDRIGPRRMLAFSGILWALGTLATGVTGGLAT
FT                   LVLSRALVGLGEAGTIPNATRAMANWVPLAKRGFAQGFTHSAARAAATVTPPLIVLLIP
FT                   LLGWRGAFIALGCVSAIWVVVWALYFRDDPRTHPSITAGEVDTLPPYAGPRHRTAVPWW
FT                   ALIRRILPVTLVFFCHAWTLWLYLSWLPSFFVGVYGIDLKSTALFTSGVFLAGVVGDTA
FT                   GGLLTDAIYRRTGNLNTARRNVIIMGFAGSLLFLTCVLFVRDRTVIALCLAAALFCLES
FT                   TEGPIWAVPMDIAPAFAGVASGFISTAAGLAAVVSPVAFGLITDMTGSYRLPFVMSIAL
FT                   LLVGIGLSFWIRPDRPLQAGAKPTLSTKSLGVHS"
FT   gene            401177..401929
FT                   /locus_tag="Bxe_A4098"
FT   CDS             401177..401929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4098"
FT                   /product="Putative short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4098"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28901"
FT                   /db_xref="GOA:Q145T8"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T8"
FT                   /protein_id="ABE28901.1"
FT                   /translation="MKGEVSSVAVVTGAARNIGREIALQLAAAGNAVIVNARSSAAEAA
FT                   EVVREIEAAGGRAAAHLADVSEPAGARSLMEAAIDHFGQIDILVNNAAVRREVPFAELD
FT                   FARWREVMSVILDGAYLCAHAALPYLRQSKAGAIVNIGGMSAHAGSAGRAHVIAAKAGL
FT                   VGLTRALAHDLGPDGITVNCVVPGLIATVRGGSAGNTEPAHHAERTTLLGRRGQPDEVA
FT                   SLVQFLCGPTARYLTGQAIHANGGAFLG"
FT   gene            402133..403302
FT                   /locus_tag="Bxe_A4097"
FT   CDS             402133..403302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4097"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28902"
FT                   /db_xref="GOA:Q145T7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T7"
FT                   /protein_id="ABE28902.1"
FT                   /translation="MRKSLFALSILSTFAASAHAQSTMTLYGILDEGVMINTNAKNVVN
FT                   GKNVGGRQFSIDSNAGTQGSRWGLRGAEDLGGGMKAIFVLESGINVSTGAFGQGGTAFG
FT                   RQAFVGLASSSLGSVTLGRQYDSINDYVGNYGFAAAYGGSTTEHPGDLDNVNHTFRANS
FT                   TVKYASPNFNGLTFGGTVSLGGVAGEVSQSSGYSLGANYGHGPVGIAVAYELFRNPSAL
FT                   GSILNSNASATTFNSLNSGYLGTKPANSLQIITTGGSYDFGPAKIGAVYSNTRYMNIGA
FT                   FGGASATFNSYELNGLYRFTPALSIAGEYNYTKGNAVRGDIGDQKYNQFSLLIDYALSK
FT                   RTDVYFLGTFQTASGTSSTGAAAVADIGSLGDSSNNHQAVARIAIHHKF"
FT   gene            complement(403410..404753)
FT                   /locus_tag="Bxe_A4096"
FT   CDS             complement(403410..404753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4096"
FT                   /product="Putative cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4096"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28903"
FT                   /db_xref="GOA:Q145T6"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T6"
FT                   /protein_id="ABE28903.1"
FT                   /translation="MNMIPDRLKQYLIPVFALICSGTPGAANAQAPGTVPAPTTVDAQL
FT                   AQGAYLAKAGDCAACHTANKAQPFAGGLPLATPFGTLYSTNITPDASTGIGSYSYDDFA
FT                   TALRQGIAKDGHRLYPAMPYPSYAKIDDADMHALYRYFTQGVKPVEQTNRASALRFPFN
FT                   VRVLMSIWDRWYAHDHPAYRADPHQSVEWNRGAYLVQGLAHCGACHTPHGMLGQETALD
FT                   DKDNTVFLSGNTLAGWYAPNLRGHPLQTSDSSKVSGKADLVAYLRSGRLHDGAAFGPMT
FT                   EVIDDSTQYLHDDDLNAIATYLTSPALQARATPTVAPQTTYTDRTASALRAGHVDSAGA
FT                   RLYLDNCAACHRTDGTGAMPAFPSLNGNAAVLSDDPASLIHIVLSGSHMPSTAAAPTPL
FT                   AMPDFGWRLTDRQIADLLSFVRGSWGNRATDVSAAEVAKVRAVTVGAK"
FT   gene            complement(404763..406547)
FT                   /locus_tag="Bxe_A4095"
FT   CDS             complement(404763..406547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4095"
FT                   /product="Putative gluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4095"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28904"
FT                   /db_xref="GOA:Q145T5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T5"
FT                   /protein_id="ABE28904.1"
FT                   /translation="MANISQPKVDAVVVGMGWSGSIMAIELADAGLTVVGLERGENRDT
FT                   YPDFAYPKIADELTYVQRYKLMQSLAHETVTIRRQANEVALPLRQYGAFLFGDGVGGSG
FT                   VHWNGFTYRATDADLKLRSHYEQRYGKQFIPDDMTIQDWPVSAAELEPFYDRFEYVAGT
FT                   SGRAGNLNGRPISGGNPFEAPRSRDYALPPLPTAYPSMLFEQAAREVGYHPYPTPASIA
FT                   SKAYKNPYGMQLGPCNFCGYCELFGCYMFSKASPQTCILPALARKPNFELRERSAVIKV
FT                   NLDPTGKRATGVTYIDAQGRTVEQPADIVALCAYQMHNVRLLLLSGIGKPYDPATGEGT
FT                   VGKNYAYQKNSKIPVFFDKDVAINPFIGSGSGGVVYDDFNADNFDHGPVNFIGGAITFA
FT                   TVTGGRPIAQALVPPGTPKWGSGWKKAVKDHYLHSFAISTQGSVMSYRDNYLDLDPTYK
FT                   DAYGLPLLRMTFDWKDNEGRMTQFVSHKAAEVARAMNPKPASVAINAGKPGDHFDVGPY
FT                   QSTHTTGGAIAGDRPDNSVVNKYLQSWDVPNVFVAGACSFPQNLGINPTGTIGAMTYYA
FT                   AKAIRETYLKNPGPLVEA"
FT   gene            complement(406611..407369)
FT                   /locus_tag="Bxe_A4094"
FT   CDS             complement(406611..407369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4094"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28905"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T4"
FT                   /protein_id="ABE28905.1"
FT                   /translation="MDDKPAAASTTTSIVPSRRRFLINTVAVLPVAGSLAACQRPADAV
FT                   ASASGEAGTDSASPAAYQPKFFKPDEWRLIQAAIDRLIPADAEGPGALELDVAAFIDRQ
FT                   MEGAFGHAAGWYMKGPFHPDATPLAGYQSPMSPRDLYRTGIAALDGYCKAHFGGKGFVQ
FT                   LSAAQQDALLHGMDTGKVRFGQTSAGHFIALLWQNTKEGYFSDPIHGGNRHAASWTMIG
FT                   FPGARADYLDWVAQPGKVYPLGPATIEGKT"
FT   gene            complement(407468..408019)
FT                   /locus_tag="Bxe_A4093"
FT   CDS             complement(407468..408019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4093"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4093"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28906"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T3"
FT                   /protein_id="ABE28906.1"
FT                   /translation="MTNKRMIKASLLALFSLGAALGVALGDANAQTPASQPSAGGLPAR
FT                   SPFDIPYGMPISLQNANQALQAAEAEAARHGWPEAIAVTDPSGELVAFAKMDDTQNSSP
FT                   NIALRKAATAARFRRDTRTFYNGFEAGHTYSATLDPSVVASPGGYPLVIGGKIVGAIGC
FT                   SGGSGDQDADICKAGADALK"
FT   gene            complement(408125..408862)
FT                   /locus_tag="Bxe_A4092"
FT   CDS             complement(408125..408862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4092"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28907"
FT                   /db_xref="GOA:Q145T2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T2"
FT                   /protein_id="ABE28907.1"
FT                   /translation="MHNAAQHSVVSDALAGFAVAALPASAESALGAARDALTHARLLTD
FT                   PATRSTAQITALLQSQGSATTDSRTRAWILGTSLATQAAASPAMPVLAAVIATGDKLGS
FT                   SESDAIAAVAIGTEAATRILAAVDSDEFRARWNVASSVGLLGAVLAVSRLLRLDEAHTR
FT                   HALGIAATQAAGLAHNADHAMEAIEIGKAAADALEAAMIAKHGFTSAAASIDGRRGFAA
FT                   LMAYRFDASAITDALGTRWTSLD"
FT   gene            complement(408865..410220)
FT                   /locus_tag="Bxe_A4091"
FT   CDS             complement(408865..410220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4091"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4091"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28908"
FT                   /db_xref="GOA:Q145T1"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T1"
FT                   /protein_id="ABE28908.1"
FT                   /translation="MSSIAAAFAHGLFALAQRPLPVPVAEEARRSLINVIGTSIGASRH
FT                   PGVDAILAAAAELGVAPVAPVPGRSEKVDLHFSALATGFAGHLDDFDDTHLATVIHPAA
FT                   SVLAVLTALAPSARPTGAAALTAFTLGCEAQLRVGVSISPEHYDRGWHITGTCGVIGCA
FT                   VTAALLLGLDEAQLAQAVSIAASMFVGQREAFGTMTKPYHPGKAAANGIAAARLAQQGQ
FT                   RAAADIFEAAGGYSHSLSTKVDFDLMNGAFGERWELLFNTYKPYPCGIVAHPAIDAGLA
FT                   LAPRIADVQSIESITLRCHPLVPELMGNPQPKDGLQARFSAIHGVAAALCDGQVGLAQY
FT                   EDARVVRDDVTAVRALTKLAPDAAVNRDEVFITATLKDGTLVEHHVEHARGSLARPLTN
FT                   DELMHKVRLLVDSQLGDGTAAQLAAAVATLDTAANLDALFALCAPTRSRNGN"
FT   gene            complement(410217..411632)
FT                   /locus_tag="Bxe_A4090"
FT   CDS             complement(410217..411632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4090"
FT                   /product="Major facilitator superfamily (MFS)
FT                   metabolite(sugar)/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28909"
FT                   /db_xref="GOA:Q145T0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T0"
FT                   /protein_id="ABE28909.1"
FT                   /translation="MYMEKEIAGTAGVQASVSARLDRLPPTRYFSGLVARIAIGGWFEF
FT                   YEMFMAAYISLGLISSGLYRATTAGLFDVDGFASFLGSFFAGMFVGTVALGGFTDRFGR
FT                   RAVFTCAMLIYSVATFAAAFQHSPQAMDLWRFVAGLGIGVQLITVDTYISELTPHHTRG
FT                   RYSAFSILVILTSVPTVAVLSFLLVPHTILGLEGWRWVMIIGSAGAVLIWFMRRGLPES
FT                   PRWLESKGRLDEARAIVDAIEARVVAETGRALQAPAQRAPQPLTGEHGGSWSEMWKGRY
FT                   LSRTIMLSFFNFFQTFGVYGFGAWVPVLLYTKGITITHSLLYTMVIAFATPLGALGAMA
FT                   CAERIQRKWQLVGCAIVVAVAGVLFGMVREPLLILLFGSAVTIANNWLIGIFHTYQAEL
FT                   YPTRIRARAVGFVFSWSRLSSIFVGFWVAALLKHSGVPAVFVLISSAMFVIVVMVGLLG
FT                   PKTNGIRLEELSQ"
FT   gene            411854..412546
FT                   /locus_tag="Bxe_A4089"
FT   CDS             411854..412546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4089"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28910"
FT                   /db_xref="GOA:Q145S9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S9"
FT                   /protein_id="ABE28910.1"
FT                   /translation="MDETVDTRDDEEQGDASPVGEIVDWVARGIIEGRLQPGDDLNSVD
FT                   LAKRFNVSRTPVREALFVLNRERLVDWSPRRRPRVSSMSLTEVREIYQLRVLLYGQVSL
FT                   AIAEQATAGDIDSLWRAHARLADAAARADVDGYFWANVAFRDEELRISRNGIFKEVLDS
FT                   MRMRTNRLRHLSTSLPGRMQRSCSDHQRLCEAYAERDGTLAAALNRSIVLTALQAIEQV
FT                   WESESGKG"
FT   gene            412775..413275
FT                   /locus_tag="Bxe_A4088"
FT   CDS             412775..413275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4088"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28911"
FT                   /db_xref="GOA:Q145S8"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S8"
FT                   /protein_id="ABE28911.1"
FT                   /translation="MESDVAVKTRIRASYGRYLEDFQVGDIYEHRPGRTITEADNIHFS
FT                   LLTMNFHPMHCDAAYAARSEFGRLLVNSGLTVAVVLGLSVNDVSGKAIANLGWKEIRLT
FT                   GPVFCGDTIYAESEVLDKRESKSRPGQGIVTVQTRAFKQDGTPIMDFVRSALVPARGHG
FT                   VGD"
FT   gene            413450..414856
FT                   /locus_tag="Bxe_A4087"
FT   CDS             413450..414856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4087"
FT                   /product="Major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28912"
FT                   /db_xref="GOA:Q145S7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S7"
FT                   /protein_id="ABE28912.1"
FT                   /translation="MHAKETKVAIGIVNSGARLDRLPIASFHWKILGLISAGAFLDAFD
FT                   IYLAAGALGAMVKAGFSDLKLNALFISVTFLGMLIGAGFAGYLGDRFGRRSSYQTNLLI
FT                   FGIASIAACFVPNMMWLIVLRLIMGVGLGAELVVAAGTLCEFIPPASRGRWTALLALII
FT                   NSGLLVSTAVGYVVIPHLGWRYMFAIAGVGAIIVWVLRHRMPESPRWLESVGRSDEAEA
FT                   TVSAIEHEVQRQKGSLPPVERIENLEVPKAPFSALFSHAMLGRTLVAILTAVAVNISVY
FT                   GFVAWLPTFFVKEGLTIVQSLGFTTLMAFGAPGGALIGFLCADRVGRARGLVIFAIATI
FT                   VVGFIYPNMHAGWAISSVGFVLVTCIYTVTTLGLFAYIPELFPTELRLRGTGTAGVCGR
FT                   AASMTTPYLAVVLYNSFGVSGVLAMVSGVLALLVLGILLLRVETNQHALERISPSLDTD
FT                   SDPMPATQQG"
FT   gene            414863..416275
FT                   /locus_tag="Bxe_A4086"
FT   CDS             414863..416275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4086"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4086"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28913"
FT                   /db_xref="GOA:Q145S6"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S6"
FT                   /protein_id="ABE28913.1"
FT                   /translation="MTSLDSSVTLSGQYARFGVGLQLRDVPHAVQTRARHLILDAVGIA
FT                   LASRGYPYADVSFAAFSEFGGGTSPVIGYGRRLGLRDAAMMNGVLIHGLDFDDTHSRGV
FT                   IHSTASALSCVLALADRDAVSGADLLAAYIVAMEVSTRVASAARGGFHDAGFHPTGLVG
FT                   AFGCAVAAARLLQLDEARAAHAQGIVLSMAAGSLEFLEDGAWTKRAHPGFAAASAITAA
FT                   TLAKHGFTGPRLAYEGRFGLYASHLGKPLDAADRELASEGLGSSWQIDEVAIKPLPACH
FT                   FTHAVADAAMALHREHRFSAESLDSIRRVVARVPRGTVEIVCEPVDAKRKPVTAYDAQF
FT                   SVPYIVATALLKGRFTLDELEPAALADPAVLALAARVDYEIDPDTTFPRHYTGEVVVER
FT                   SDGSRVAHREAINRGCADRPVSNDDIVAKFHANAQRSVSRSAAEQIAQAVLQLDERPAR
FT                   ALADTLAGLTAS"
FT   gene            416286..417449
FT                   /locus_tag="Bxe_A4085"
FT   CDS             416286..417449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4085"
FT                   /product="Putative acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28914"
FT                   /db_xref="GOA:Q145S5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S5"
FT                   /protein_id="ABE28914.1"
FT                   /translation="MTATELDTLENDQLILDMLDRFLETEVRPYVHKFDHDDIYPAEIV
FT                   EKMKEMGLFGCIIDPEYGGLGLSTRTYAQIIARISRVWMSVSGIINSHLILAMLVQRNG
FT                   TPEQKSKYLPKFATGEWRGGIGLTEPDCGTDLQAIRTTAKRVGDEYVVNGNKTWITNSK
FT                   HGNTLALLVKTDTTAQPRHRGMSLLLVQKGPGFEVSRQLEKLGYKGIDTCELSFNGYHV
FT                   STDALIGGVEGKGLQQILGGLELGRINVAARGVGVAQAALDESVSYSQQRKTFGKPICE
FT                   HQAIQLKLGEMATRVEAGRLLVDAAAQKYDRGERCDMEAGMAKYFATEAALENSIEAMR
FT                   IHGAYGYSKEYNVERLYRDAPLLTIGEGTNEMQRIIIAKQLIERSPV"
FT   gene            417446..418636
FT                   /locus_tag="Bxe_A4084"
FT   CDS             417446..418636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4084"
FT                   /product="Putative L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4084"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28915"
FT                   /db_xref="GOA:Q145S4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S4"
FT                   /protein_id="ABE28915.1"
FT                   /translation="MSLPLSGVRVLAIEQYGAGPFATQHLADLGAEIIKIEHPTNGGDV
FT                   GRAVGPYFFGDGDSHFFEAFNRNKCSLTLDLKKPEARAVLLDLVAKSDAVFNNLRGDLP
FT                   AKLGLTYEQLCEANPKIVCGHLSAYGRTGSRAAWPGYDYLMQAEAGYLSVTGEPDSPPA
FT                   RFGLSIIDLMTGTTAAMALLAGLVDAKTSGKGRDIDVSLFDVALHNLAYVATWYLNGGV
FT                   VTGRENRSSHPSLTPSQLYKTQDGWIFLMCNKEKFWGVLAEVLDKPSWVTDPRFCNFQA
FT                   RLANRELVQTELDAVLSGATTAQWLERFGGRVPAAPVFNVKEALENPFVAERECVVNAV
FT                   HPRFGTVRGVAAPVRIDEPLPTRAAPDLGQDTQRLLDELGYGAERIALLREAGVVQ"
FT   gene            418683..419435
FT                   /locus_tag="Bxe_A4083"
FT   CDS             418683..419435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4083"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4083"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28916"
FT                   /db_xref="GOA:Q145S3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S3"
FT                   /protein_id="ABE28916.1"
FT                   /translation="MATTVLGQQPRYMQLAQTLLNEIQGGQFPIGTLLPTEFELCEQFG
FT                   ASRFTVRQAIKQLEQRGLVDRRPGIGTRVKATQSETAYRQVMERLSDLHRYTSDTELEI
FT                   ASTQTVEIDDPDLIERLGAKPGETWLLAEGIRLSPESVEPICHTEVYIHPAFRSLAGLS
FT                   GRTHVPIYTLIEKQFGEQITEVQQEIRAVALPAALAQRLNAKPRSPALWLCRRYLNRRG
FT                   QVVELTISVHPADRYSYSETFQRDWHAN"
FT   gene            419470..420282
FT                   /locus_tag="Bxe_A4082"
FT   CDS             419470..420282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4082"
FT                   /product="Citrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4082"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28917"
FT                   /db_xref="GOA:Q145S2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S2"
FT                   /protein_id="ABE28917.1"
FT                   /translation="MDARSYLFVPGDRPERFAKALGTGADAVVIDLEDAVVPAAKLAAR
FT                   DGLRRWLPTVDPARLIVRVNAVGTPWHLEDVEMVRASGVSVMMLPKSDSARQLAEVAAR
FT                   LPSTVRIVALIETVAGVVAMREIAGVPSVARLAFGTVDFCGDAGIEGLGAELDYVRSQM
FT                   VIESRYAGLAAPIDGVTPELDHLERLTEHVAGARRFGFGGKLCIHPRQVEPVNRGFAPS
FT                   EDERRWAARVLAACSEHPEGAFAVDGKLVDRPVIERAKKIAEFDTLIH"
FT   gene            complement(420328..421131)
FT                   /locus_tag="Bxe_A4081"
FT   CDS             complement(420328..421131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4081"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28918"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S1"
FT                   /protein_id="ABE28918.1"
FT                   /translation="MSEVGSTLVVFVLLLAATGVGVWVRPLLPEEHKAHETVQLIQLVI
FT                   GMLVTFAALVLGLMTASAKSSFDTASNDLRAYAADLIEFDTTLRDYGADTDPARRLLRQ
FT                   YTAAAIASTWPAETPPTGEYPKDIGPSQGNSEKLENTRLGDMLTAVGKELRQLRAHDPL
FT                   QQRALNDGLAQYRRVVDARWKLIEEAHSSISQPFLKTLTFWLGVIFLSFGLIAPRNALA
FT                   LVTISLGAVSIASAIYVIVDLDTPFTGPLVISSSPMRDALDHLSR"
FT   gene            421431..423080
FT                   /locus_tag="Bxe_A4080"
FT   CDS             421431..423080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4080"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4080"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28919"
FT                   /db_xref="GOA:Q145S0"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S0"
FT                   /protein_id="ABE28919.1"
FT                   /translation="MLKNLSIRTCLTMLIAFFGLALLVGAAAGLLSLRSSNASLQQMYT
FT                   VDTPAVADLEGSASQLLRLRLALATYASLVDLNDQDGANAVLKRFDQYQKASDDRLAHF
FT                   VSRAGTDADEQRLIKEMQDRRDAFLHEAVEPALAALRSNDRAAFQQLQAHKLPSLYSAY
FT                   EKAMLALEQLQLDHGAQRYQAAQDLFYVICVVVAVGMVVSLLGSLIGRAVLVRAIVSPV
FT                   DATIAQFQRMSSGDLTGQIVVSSSNEMGRLAAALQKMQESLVATVNSVRQGTESIDTGV
FT                   SEIAAGNTDLSQRTEEQAASLEETAASIEQLTSTVKQTADNAKQASSLAQGASSLAAQG
FT                   GDLTGQVVGTMHGIVDDSRRIADIVGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ASEVRSLAQRSAAAAKEIKGLIDESTARVQAGSQLVERSGSTMTEIVDAIARVSSIMGE
FT                   IAAAAIEQSTGIDQVNLAVAQMDEVTQQNAALVEQAAAAASSLEEQARRLTAAVSVFQT
FT                   GSGATSSSGSSGRRGGSSAAPQTADADEFATA"
FT   gene            complement(423153..423962)
FT                   /locus_tag="Bxe_A4079"
FT   CDS             complement(423153..423962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4079"
FT                   /product="Putative cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4079"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28920"
FT                   /db_xref="GOA:Q145R9"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R9"
FT                   /protein_id="ABE28920.1"
FT                   /translation="MNQERVFSLRNPWFTLSVGGTIAIAVVSILIGFIWLPSANNAFGD
FT                   RGLWATICSAAGAPSSWYGGTNLTGPAPSEVVVLPPLRRVRADAISIGRGATIATQNCS
FT                   MCHGVLGTVQVTAPALAGQYADVIYKELRDYQTGLRQNAIMQPIIAARSDQDLHDLAAY
FT                   YASLPGAPAAGVPATGTEPDANAVKLAMQGDPQRNIAPCAACHGQLDRKGAAPWLGGQS
FT                   SVYLAAQLRAFASGARRNDINEQMRNVARRMTPAEIDSLARYYAAMQ"
FT   gene            complement(423959..425584)
FT                   /locus_tag="Bxe_A4078"
FT   CDS             complement(423959..425584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4078"
FT                   /product="Putative cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28921"
FT                   /db_xref="GOA:Q145R8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R8"
FT                   /protein_id="ABE28921.1"
FT                   /translation="MFHAKRLVLAHFWLAFIAFLIALFLGAWQMLVRSPLLPWVGDPEL
FT                   YYRSVTAHGTVMAYVLPTLISMGFGYAIVELALAQRLVGLKWAWAAFIMLAVGAVMAMV
FT                   PVALGQASVLYTFYPPMIGSPFYYLGVVLVVVGSWIWVALMHVNLRIWKRANPGKPVPL
FT                   AMFANVAGAYLWAWTAIGAALEILFQILPVAFGLTNTIDAGLSRILFSWTLHAIVYFWL
FT                   IPAYIAYYTLVPRAIGGRLYSDSMARVSFILFLVFAMPIGIHHLFADPQVGSGFKFLHA
FT                   VFTGMVSVPTLLTVFTICASVEIAGRLRGGKGAFGWLTALPWQNPMMLVLAFSFVMLGL
FT                   GGAGGLINMSYQLNSTVHNTQWVTGHFHLIFGGAIVIMYFAIAYELWPQLTGRALASVK
FT                   LVRTQLWLWFIGMMVVTLPWHYVGLLGAPRRMAYYDYNTPGMQSQAFWVGMSAVGGLIL
FT                   VVSGVLFVYILARSQFGPVVQQQGFRFASATQPVERVPAALNSFGLWVALMIGLTVVNY
FT                   SVPIVQLLRLPQTSVPAVVVGAQR"
FT   gene            complement(425571..426143)
FT                   /locus_tag="Bxe_A4077"
FT   CDS             complement(425571..426143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4077"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4077"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28922"
FT                   /db_xref="GOA:Q145R7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R7"
FT                   /protein_id="ABE28922.1"
FT                   /translation="MSTDSNHQSGGGHAVALRAERRWAIFAVALIVLMLAVIVYSGLHW
FT                   AMMPPSRVETIDPSRLQLSGEFVEDNLGSAVEPDGSVVVRFIAQQYSFTPQCLLVPADT
FT                   PITIRTTSADVVHGLLVTDTNINTMVVPGYVATLNTRFDTPADHTMPCHEFCGFGHQTM
FT                   WAHVKVIDKATFFEQARQSRRLSCVSR"
FT   gene            complement(426146..426322)
FT                   /locus_tag="Bxe_A4076"
FT   CDS             complement(426146..426322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4076"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4076"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28923"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R6"
FT                   /protein_id="ABE28923.1"
FT                   /translation="MEANDTGSAAPPTDEEVERVVAAGPHGAIAVAGVATLIVMAIWFG
FT                   FYFLVFLPRGVVH"
FT   gene            complement(426347..427753)
FT                   /locus_tag="Bxe_A4075"
FT   CDS             complement(426347..427753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4075"
FT                   /product="Putative cytochrome c precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4075"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28924"
FT                   /db_xref="GOA:Q145R5"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R5"
FT                   /protein_id="ABE28924.1"
FT                   /translation="MKPTLRTPGSLRALRTTLLDTWFTATKRRRSRRTRAPLVSGLLIA
FT                   GLIVAGSAALLRASHTPLIAEARAADTTASAPGASADTRPDLVKRGEYLARAGDCVACH
FT                   TAPRGKLFAGGLAMETPFGTLYSPNITPDAQYGIGTWSQDAFFKMMRTGRTPDGTLIYP
FT                   AMPIAQYTKVTRQDSDAIFAYLQTVAPVREPNHKHTLRFPFNQRNLLYGWRTLYFREGE
FT                   FQPDPTKSVEWNRGAYLVEGLGHCTMCHTKINMLGGSSQSEQFAGGLIPVQNWYAPSLT
FT                   SDKDGGLGDWSIKDIVDLLQAGISDRGAVYGPMAEVTYHSLQYMTEEDVKSMAVYLKTL
FT                   PDKSGRKSGPSAPTNTSVFALGEKIYADKCALCHGAKGEGKLQHYPPLAGNQSIEMDSS
FT                   VNPIRIVLNGGFPPGTMRNPEPYGMPPFGQELNDADAAAVVTYIRTAWGNHGQPVTSRE
FT                   VNELRNAPLH"
FT   gene            complement(427750..428523)
FT                   /locus_tag="Bxe_A4074"
FT   CDS             complement(427750..428523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4074"
FT                   /product="Putative periplasmic cytochrome c protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4074"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28925"
FT                   /db_xref="GOA:Q145R4"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R4"
FT                   /protein_id="ABE28925.1"
FT                   /translation="MSERARNNREEERSQQRSGVHRRTVRSYVLLVFYVLWSGVALAAT
FT                   DASSTMPSAMDERVRACTSCHGVQGQGLNNDYFPRIAGKPAEYLFNQLTAFRDGGRTYP
FT                   PMGYLLAFLPDDYLRKISQYFADLQPPYPNADQSNVAPAVLAAGQRLVTQGDPSRKIPA
FT                   CIACHGARMTGTQPGIPGLLGLHASYIAGQMGTWRSGTRHALAPDCMHSIAVKLSDKDI
FT                   TAVSSWLARQPRPADPRPAPASGERLPLACGSQPQ"
FT   gene            complement(428973..429941)
FT                   /locus_tag="Bxe_A4073"
FT   CDS             complement(428973..429941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4073"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4073"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28926"
FT                   /db_xref="GOA:Q145R3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R3"
FT                   /protein_id="ABE28926.1"
FT                   /translation="MIWRYPTARLTIGKAGNSDHFHRIYRIMSQRGFDLTQLRTFVAVA
FT                   ESGSVSAGAERVFLSQSSVSEQLKKLEERAGQPLFVRSKQGVSATHAGSRLLDHARRII
FT                   AMSEAAFEDLQGRSLDGELRIAITDYYRPHDIARILKTFSEQHPRLKLHVTVLPSAVID
FT                   SSAGDDASFDIGLSLRLVTGSARGAGRRSGAPGIVVRREKLLWVSAADSSPRPATPYPL
FT                   VLLPSSCQLQRFVVKLLDEHKVPYVVSHSASGVAGLQLALKAGLGISCLNESSIGGGVV
FT                   ACPASVGLPALPAVEFHLLPGRIGESERVSNARTALMRLFS"
FT   gene            429971..431272
FT                   /locus_tag="Bxe_A4072"
FT   CDS             429971..431272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4072"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4072"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28927"
FT                   /db_xref="GOA:Q145R2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R2"
FT                   /protein_id="ABE28927.1"
FT                   /translation="MAAVRLSGGRPASHRWKVLGVGFAANASFSAAFSGIPTTAVFLRS
FT                   GYHLGNDGLGLVLGMLGLGIAVSELPWGLLTDRWGDRRVLLLGLLSTAAALAALALFVV
FT                   PSATHVPGVTTLALGLLLVGLLGGSVNGSSGRAVMAWFREGERGLAMSIRQTAVPAGGG
FT                   LGALLLPALASRFGFASAYTVLALACAVTAAFAWRWLHEPSHIDADGAREVRATAASGV
FT                   RTRVSPLRDIGIWRVALGAGTLCVPQLAVVTFGTVFLHDFSRAGVLAVSVTMAAVQTGA
FT                   AIARVWSGGWTDRRGNRRAYMRACSLLTAVLFASLALLTGLAGMHHAALTAVFAPMVVL
FT                   GGVSASAWHGVAFTELATLAGTSRAGTALAIGNTCVFLTLFVTPLAIPPLLSIGSWPMV
FT                   WAVASVCALIALPVFPRAARERELSAARIGDASR"
FT   gene            431630..432295
FT                   /locus_tag="Bxe_A4071"
FT   CDS             431630..432295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4071"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4071"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28928"
FT                   /db_xref="GOA:Q145R1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R1"
FT                   /protein_id="ABE28928.1"
FT                   /translation="MKLRIILADDHPFVLLGIRTTLKMHAGVTIVDEATSPDSLLERLQ
FT                   NTPCDVLVTDLAMPELAGANDDGLDLVRRIRCDWPRLRIVVMTTLTNAAILRAIVSDGT
FT                   VSMLGKAESMDELWQAIAATRHGEAYLGRSIIEALARPQNLESERPPAPRLSCVQAEVV
FT                   RLLVDGRSIAEIAAALGCHRRTVSRKKREAMTRLGVTNDPGLFSYVRANGILGFESYI"
FT   gene            432435..433124
FT                   /locus_tag="Bxe_A4070"
FT   CDS             432435..433124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4070"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4070"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28929"
FT                   /db_xref="GOA:Q145R0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R0"
FT                   /protein_id="ABE28929.1"
FT                   /translation="MRDTAEVSTPIRAIIADDHPLVLLAIENLIGGYPNMQIVGRAADA
FT                   TELFTEVDRSSCDLVLMDLYMPGGADGSGLEVVRQFKTRYPGIALVVLTMETAAAELQK
FT                   VISLGADALVSKRDRIDLIHVAVVTALARECYVGPAVRALIADATVTQRLDFVRQMLSR
FT                   RELEVFTQYASGYGVTEIAARLGRSVKTISAQKCTAMRKLALHSDAELFRFAVEYGVIP
FT                   EERVQNL"
FT   gene            433198..433875
FT                   /locus_tag="Bxe_A4069"
FT   CDS             433198..433875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4069"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4069"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28930"
FT                   /db_xref="GOA:Q145Q9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q9"
FT                   /protein_id="ABE28930.1"
FT                   /translation="MQGMPIDKTTKMRQKIRVIVADDHDCVRVGVKQMLQSVPHIEFVG
FT                   EAADTHGLAELLDACACDVVVSDITMPGIHGGSNAVPFLRRLLRGRPHPCVVVLTMICH
FT                   AHMLTGLLHIGVGGIVDKRETVTALIDAIEAAFSGHVYLSAHARAAIEMADAPPQLRAG
FT                   MLSAREWEIFQLYVQGLAVHQIAARLQRSGKTISTQKRSAMRKLGLETEADLIDYARQI
FT                   GLA"
FT   gene            434127..434873
FT                   /locus_tag="Bxe_A4068"
FT   CDS             434127..434873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4068"
FT                   /product="Aquaporin Z"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4068"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28931"
FT                   /db_xref="GOA:Q145Q8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q8"
FT                   /protein_id="ABE28931.1"
FT                   /translation="MVALGKRLLVESAGTAWLVFIGCGSIVLNVGAIQQAGGVLEAALA
FT                   FGLALATASYCVGSLSGGHFNPAVTVGFTVAQRFPVRDLLPYIASQIFGAIVAAALLLY
FT                   VAGGRPGFDLHATEFAANGFGDHSPADYQMHSALAIEFVLSFCFVMATLVISRRHDMEP
FT                   IAPLVAGACLVLVYLVSIPVTNGSVNPARSTAQALFVGDWALDQLWLFWAAPLSGGVIA
FT                   GALFSFLHGKPDNHTAALAEGRGEVV"
FT   gene            434895..439367
FT                   /locus_tag="Bxe_A4067"
FT   CDS             434895..439367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4067"
FT                   /product="amino acid-binding domain sensor hybrid histidine
FT                   kinase / PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28932"
FT                   /db_xref="GOA:Q145Q7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q7"
FT                   /protein_id="ABE28932.1"
FT                   /translation="MSSVNFPPDVAMRRALERVRLCLLAWCLIAAAQTATAAQLFDNRS
FT                   NSQVVAAFPAKLTVGVLAGGWLPLDALQDGRLTGMSVDYLRALVGPNVVIEAKAFPDVS
FT                   QLLAAACAGNVDLLTSVARTPERERCLSFTAPYFRSSSSAVVRRDGDSYASPALIAGAR
FT                   IAVEKGFALERVARERFPHAQISAFATTHAALSAVVRGDADVYLGFTPAVQYALATEEF
FT                   RGLHVAFEESSRTANLRFAVPRSHAALRDQLDEALASMNPADEAAIRVRWLSGNFDAKP
FT                   VPTAPRLVLTPQEQAWLRSLPPLQIGFDNGWSPFSYVDSSGRPAGIAADYLAYLSRTLG
FT                   VVFNRARTADWPTAIESFQRGELAILATASIHDPRLKGARHTVAYESYPLVIVGREDEP
FT                   AARSLSDFASRRVVVSSHVAGSIPLAFERIPADHVVIAPSLDDALDMVAAGEADVLVGN
FT                   VAAIDILLKQRYDSVLKILGTVGESDALDFAVRTDLSPLAGLIDRALLAMPPAEKQRIR
FT                   QKWVTGNSPESGLWSVTAVRLLPLLIGIGVALLITLRAYLLLQREVRLRKKTELELELQ
FT                   LNFQETMMKMVPYPLVAIDLDGRYIAVNEAYEQACGMSREAVIGRNTVDVQTWGEANSR
FT                   ILTDMTREMLNGRETAQLELQFERGAGNVRHGLFWASVCRDGDGQPACVLGTVVDITDI
FT                   RRAEMRARETERRLFDVTRSLPAVVFQLRRTSDGAYSFPYIGGDTRHLLGGKDGSLNRS
FT                   DHVDFQRVCEEDRAFVLAELERSALCETPVNMEFRFEGDEEIKWARAELVPRREADDSV
FT                   VWSGYWVDASVEHARSDELARARDLAEAAARAKDDFFAMMSHEIRTPMNGVLGLVEVLE
FT                   RTPLNTDQGEMLGMIHESAGALLQILDDLLDYSKIEAGRLTIEAESIDIRELVDNAVGL
FT                   LAGRAHEKGLKVRVDIAPDVAATLRGDSVRLRQILFNLLGNAIKFTPQGEVDVRVSVFA
FT                   QADGVQTLEMTVEDTGIGIAPEVQNRLFEPFVQAESSTTRRFGGTGLGLTICRKLIDLM
FT                   GGSLALHSEPGSGTRMTVRLDMAVETQRYSVNGLRGKRGLVATGDARVAQALMHFGEAL
FT                   GLTLRRVPPDAPELRDRVALANLDLLFVNEDVTLPADVRPRTRVICLTEKPKPTGYRIL
FT                   DDNVRLSINPISWRGLGAACAAAMTGLPSVPRSAGTPRAPEGGPPPPDRERAIASGRLI
FT                   LVAEDHPVNQELIRHQLALLGFACDVTNDGAEALAALQRTSYGCLITDCHMPNVSGYEL
FT                   TRRIREGEEGGAHRLPILGITANTAPEDLNLCRDAGMDDSLVKPTRLATLRDYLSRWFG
FT                   SDSAAHAAPSESVGAPAIAATDVQGGADPFVPVDLGHMTQLWGSESTVKALLDSFVSSV
FT                   REDVQSLSPLLERVGSERTELERVREWLHRVAGAASVLQYPPLLMALEDYRREINVKPP
FT                   ERVRNDGMVLIDKCNAMLDGIEQQAALLV"
FT   gene            439594..439869
FT                   /locus_tag="Bxe_A4066"
FT   CDS             439594..439869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28933"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q6"
FT                   /protein_id="ABE28933.1"
FT                   /translation="MRKSLKTPFVHHVSVMFAWAALGNDGARRRFPSDIANVFCSSAAL
FT                   RITTDNYEVGVFHRSKVWRRERFPAAKRVAPSLFVRTLRDKRAQRI"
FT   gene            439937..440371
FT                   /locus_tag="Bxe_A4065"
FT   CDS             439937..440371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4065"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4065"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28934"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q5"
FT                   /protein_id="ABE28934.1"
FT                   /translation="MIALRKMNLAVVLWALASGVAFGDTVALKADLEPSSEVPPRVSHG
FT                   HGMLNATFDTSTKSLQWTVTYEGLSGPATAAHFHGPAPVGQNAKVQVPIDKNALASPIK
FT                   GSAALTEQQVTDLMAGQWYFNVHTAQNPMGEIRGQVLPAN"
FT   gene            440488..441444
FT                   /locus_tag="Bxe_A4064"
FT   CDS             440488..441444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4064"
FT                   /product="Putative lipase/esterase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4064"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28935"
FT                   /db_xref="GOA:Q145Q4"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q4"
FT                   /protein_id="ABE28935.1"
FT                   /translation="MSWQSALACWYLRRQFRPETLKPGINVERARALTAKRVWSPRVPR
FT                   GWHLRELYGQDDAPLRGEWIERADGSPVAGAGPIVLYCHGGGYYFCSPRTHRSLVFGLA
FT                   TRANAAIFSLDYRLAPEHRFPAALNDTTAAYRRLIGGGIAPESIVIAGDSAGGGLALAT
FT                   LVALRDAGDPMPAGGLLFSPWTDLAATGASIHGNDGLDPMFSGPAIAPAGKIYLGDTPA
FT                   THPYASPVYADLHGLPPLFIMAGSTEVLLDDSQRVADNARAAGVDCELEVWQKMPHVWP
FT                   IFAPFIPEGNRALDRAAGFVRRATSRAAQPSSAMSMV"
FT   gene            complement(441414..442256)
FT                   /locus_tag="Bxe_A4063"
FT   CDS             complement(441414..442256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4063"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28936"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q3"
FT                   /protein_id="ABE28936.1"
FT                   /translation="MEPSSLAAQSLSDDDLKALRRAKHELESPALAMKLASMVGAPLEK
FT                   LLSRMPAFANEKVADATELALRKCLAIALRTLGRRDGALALVAPEKPSNLLHKFAVATT
FT                   GAAGGAFGLFALPVELPVTTTLMFRSICDIARSEGEDLTSIDTQLQCLTVLGMGSTSSA
FT                   DDDADFGYFIMRGALAQAVSKASSEIATKGFTTHGSAALLRLVNTIAARFSVQVSEQIA
FT                   AKSIPAIGAVLGAMVNTVFIDHFQQVAHAHFTVRRLERQYGQQTVEAAYQTIDIALDG"
FT   gene            442395..443990
FT                   /locus_tag="Bxe_A4062"
FT   CDS             442395..443990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4062"
FT                   /product="major facilitator superfamily (MFS) multidrug
FT                   efflux pump, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4062"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28937"
FT                   /db_xref="GOA:Q145Q2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q2"
FT                   /protein_id="ABE28937.1"
FT                   /translation="MAVHTAAHHSSGQVLPFRESLLAMLGISFVTMLVALDQTVVGTAL
FT                   PTIVAELKGFELYAWVATSYLLTSVITVPIFGRLGDYYGRKPFVIASIVVFTGASVLCG
FT                   AANNMLFLVLARGLQGIGGGMLVGTAFACIPDLFPDSVVRLRWQVVMSSAFGIANAVGP
FT                   SLGGFLTQYYGWRSVFYVNLPVGLLSLFFVWRFLPHLRHVEHEGKMRLDWPGAVLIAVA
FT                   LGSLQLFVELLPKHGVTLSVAALLALSAASAYALWQWEKRCPTAILPVDMFRNRSLAAL
FT                   FTLAVLGGFTMFSLLFYAPLLFQGGFGMSPKEAGLVITPLVVFITIGSIANGRIVSRVR
FT                   NPNLMLYVGFTLLALACLGVVVATRAMPQWLLMAFMVVGGLGLGFVMPNLTIFAQQTAG
FT                   REHLGIATALLQSLRMIGGMLGTALTGTLVSHMYASGVRSALENDHASHWFADLGDPQI
FT                   LINRDAQTTLLGQLAHAGHNGAMLLESAREALVSAIHLGLAMAAIIAVVSVWQSRRVPP
FT                   IKLQRKLEPVIHAD"
FT   gene            444021..444533
FT                   /locus_tag="Bxe_A4061"
FT   CDS             444021..444533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4061"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4061"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28938"
FT                   /db_xref="GOA:Q145Q1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q1"
FT                   /protein_id="ABE28938.1"
FT                   /translation="MEEQDRVAVMQQFGRTYRTFMSAFEAHVGHPLPRWRILLALHEQG
FT                   GESSQKRLVERLRVDPGALTRQLKTLEGMGWIARSMDTRDNRVTNVRLTEAGQSATEAS
FT                   LPRRNAFLHDTMAGLPDDALGALSAALKLLEARIGEVAAMAGAAGAGSIDITQPPAAVA
FT                   GEAPRQP"
FT   gene            complement(444667..445944)
FT                   /locus_tag="Bxe_A4060"
FT   CDS             complement(444667..445944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4060"
FT                   /product="Putative D-serine deaminase (d-serine
FT                   dehydratase) protein"
FT                   /EC_number="4.3.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28939"
FT                   /db_xref="GOA:Q145Q0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="PDB:3GWQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q0"
FT                   /protein_id="ABE28939.1"
FT                   /translation="MKVTNYQGATIDPYSKGLGMVPGTSIQLTDAARLEWNLLNEDVSL
FT                   PAAVLYADRVEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATAHQ
FT                   VRAAYHGGVSRVLMANQLVGRRNMMMVAELLSDPEFEFFCLVDSVEGVEQLGEFFKSVN
FT                   KQLQVLLELGVPGGRTGVRDAAQRNAVLEAITRYPDTLKLAGVELYEGVLKEEHEVREF
FT                   LQSAVAVTRELVEQERFARAPAVLSGAGSAWYDVVAEEFVKASETGKVEVVLRPGCYLT
FT                   HDVGIYRKAQTDIFARNPVAKKMGEGLLPALQLWAYVQSIPEPDRAIIGLGKRDSAFDA
FT                   GMPEPARHYRPGNEAPRDIAASEGWEIFGLMDQHAYLRIPAGADLKVGDMIAFDISHPC
FT                   LTFDKWRQVLVVDPAYRVTEVIETFF"
FT   gene            446101..446988
FT                   /locus_tag="Bxe_A4059"
FT   CDS             446101..446988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4059"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4059"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28940"
FT                   /db_xref="GOA:Q145P9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P9"
FT                   /protein_id="ABE28940.1"
FT                   /translation="MNSTAEPLAFDIVARIAECAPELRSAERKVAALILDDLTGASRAS
FT                   IGALAQQAEVSVATVTRFAKAVGCRDVRELKLRLAQAAAVGQRFLQPGPSGAPEPIATR
FT                   VFDELQTTLAHNHQLLRQAPLGEAAAALRAARMIYVFGMGGGSTALADEMRFRLVRLGR
FT                   PVATYQDGLLQRMVASTVSRDCVVIALSTTGRVPEMVENCKIARSYGATVVALTAPASP
FT                   LARLADWVIPIVAFETDFIYKPSSSRYAMMMALDVLVTELAVSQGDESRELLRRMKHAL
FT                   DTHRGGGDRQPLGD"
FT   gene            446992..448473
FT                   /locus_tag="Bxe_A4058"
FT   CDS             446992..448473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4058"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.82"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28941"
FT                   /db_xref="GOA:Q145P8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012855"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P8"
FT                   /protein_id="ABE28941.1"
FT                   /translation="MHSHPEAADTLIFGAQLYDGTGAPPVERDVAVRDGRIVAIGNLSN
FT                   WLAEEVIEAEGRALAPGFIDVHTHDDTHVIRSPQMLPKITQGVTTVIVGNCGISASPVA
FT                   LRGEPPDPMNLLGERDAFQYPTFAAYVAAVNAARPAVNVGALIGHTALRSNQMDRLDRA
FT                   ATGQEIEAMRAQLEEALANGALGLSSGLAYGSAFAAPAEEVMALAEPLAAAGALYTTHM
FT                   RTEFDAILDAMEEAYRVGRHAHVPVVISHLKCAGPSNWGRSEEVLKSLEGARRLQPVGC
FT                   DCYPYNRSSSTLDLKQVTGDIDITITWSEPHPEMAGKLVKEIAAEWGVTQQEAGKRLQP
FT                   AGAVYHNMSEDDVRRILSHPATMVGSDGLPNDPLPHPRLWGAFPRVLGHYARDAGLLPL
FT                   EEAVRKMTSLSARRFGLAQRGEVHIGYHADLVLFDPARVRDAATFEKPQQAADGIDAVW
FT                   VNGVLSYRDGEVMGERAGHFVARGAASKGDAHGAF"
FT   gene            448548..448934
FT                   /locus_tag="Bxe_A4057"
FT   CDS             448548..448934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4057"
FT                   /product="Putative translation inhibitor, yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4057"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28942"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P7"
FT                   /protein_id="ABE28942.1"
FT                   /translation="MKRYGVEGGKGTGGQHMPFARAVEADGWLFVSGQTPMENGEVING
FT                   GIVEQSHKAIQNVFAILKEAGYGAEHVVRCGVWLDDPRDFASFNKVFREYFGENPPARA
FT                   CVVSSMVIDCRVEVDCVAYKKPTA"
FT   gene            complement(449005..449829)
FT                   /locus_tag="Bxe_A4056"
FT   CDS             complement(449005..449829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4056"
FT                   /product="Putative GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4056"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28943"
FT                   /db_xref="GOA:Q145P6"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145P6"
FT                   /protein_id="ABE28943.1"
FT                   /translation="MTPEQSPLGKASTYTEQYDASLLFPIARKNAREAIGIGAQLPFFG
FT                   TDIWNAYELSWLNARGKPQIAVATFFVPADSPNIVESKSFKLYLGSFAQTAFESMDAVR
FT                   DTIRRDVSASCGATVSVHLTAPYKFGKLQMEEFEGLSLDRLDLDTDVYQPDASLLKAAL
FT                   HEAPVEETVFSNLLKSNCPVTGQPDWGSVQIHYVGPQIDHAGLLRYIISYRNHTGFHEQ
FT                   CVERIFVDVLKACKPVKLAVYARYTRRGGLDINPFRTNYNLPMPDNMRLARQ"
FT   gene            complement(449826..450728)
FT                   /locus_tag="Bxe_A4055"
FT   CDS             complement(449826..450728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4055"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28944"
FT                   /db_xref="GOA:Q145P5"
FT                   /db_xref="InterPro:IPR010394"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P5"
FT                   /protein_id="ABE28944.1"
FT                   /translation="MALSLVDKLVVAISSRALFDFEEENRVYEEGNLQAYEALQRDRLA
FT                   VPAKPGVAFPLIRKLLALNAGGHRVEVVILSRSDPISGLRAFHSCREHGLAIERGVFTR
FT                   GRAPFGYLKPLNASLFLSANQQDVRDALAAGFPAARVLPESAKMASKYPDEIRIAFDGD
FT                   AVLFSDEAERVFQKDGLRAFVGHEIHNKDLPLADGPLKPLLEALHRLQKLADEAAPMHI
FT                   RTALVTARSAPAHERAIRTLMAWNIEIDEAMFLGGLDKSAFLREFEPDFFFDDQIGHCE
FT                   SARVVTATGHVMSGIVNAS"
FT   gene            complement(450764..452371)
FT                   /locus_tag="Bxe_A4054"
FT   CDS             complement(450764..452371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4054"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4054"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28945"
FT                   /db_xref="GOA:Q145P4"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P4"
FT                   /protein_id="ABE28945.1"
FT                   /translation="MHKPKALAHTVGAIIDPFRSHTALRATRMASHDYLKKTLTARVYD
FT                   VARETELERAPNLSARLRNPVYLKREDNQPVFSFKVRGAYNKMAHIPAEALERGVITAS
FT                   AGNHAQGVALSAARMGVKAIIVVPVTTPQVKVDAVRAHGGPTVEVVQFGESYSDAYGHA
FT                   VKLQEERDLTFVHPFDDPYVIAGQGTVAMEILSQHQGPIHAIFVPIGGGGLAAGVAAYV
FT                   KSVRPEIKVIGVQTDDSCAMAASLKAGERVTLNEVGLFSDGTAVKLVGEETFRLCREYL
FT                   DDVLLVDTDALCAAIKDVFQDTRSVLEPAGSLAVAGAKQYAEREGIENQTLIAITSGAN
FT                   MNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRRFCELVGTRSVTEFNYRIADANSA
FT                   HIFVGVQIRNRSESAQIAGAFEAHGFATVDLTFDELSKQHIRYMVGGRSPLAHDERLFR
FT                   FEFPERPGALMKFLSSMAPNWNISLFHYRNQGADYSSILVGIQVPESEDAAFDQFLATL
FT                   GYPNWEETRNPVYRLFLA"
FT   gene            452835..456884
FT                   /locus_tag="Bxe_A4053"
FT   CDS             452835..456884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4053"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4053"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28946"
FT                   /db_xref="GOA:Q145P3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P3"
FT                   /protein_id="ABE28946.1"
FT                   /translation="MAADPEARLREIPYNYTSFSDREIVIRLLGDAAWAALAELRAERR
FT                   TGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRAMLIEALHHRLSEIEKRRRADLTE
FT                   HGDEAGVDRAARVETLVQAARRAVDEFASEFQKTYDLRKRATKVLGKVTEKDNIKFDGL
FT                   SRVSHVTDATDWRVEYPFVVLTPDTEAEIAGMIKACFELGLTVIPRGGGTGYTGGAVPL
FT                   TPFSAVINTEKLEQLGAVEMTELPGVDRKVATIFSGAGVVTRRVTEAAEQAGFVFAVDP
FT                   TSLDASCVGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWLEVTRLDHNMGKIHDI
FT                   EVARFELKWFDGNYAPGEKLLRTEALNIKGRVFRKEGLGKDVTDKFLAGLPGVQKEGCD
FT                   GLITSARWVLHKMPAHTRTVCLEFFGQARDAIPSIVEIKDYLFETSKQGGAILAGLEHL
FT                   DERYLRAVGYATKSKRNAFPKMVLIGDIVGNDADAVAQATSEVVRMANGKSGEGFVAVN
FT                   AEARKRFWLDRSRTAAIAKHTNAFKINEDVVIPLDRMGEYTDGIERINIELSIKNKLQL
FT                   VDALEAFFQAGKLPLGKSDDANEIPSAELLEDRVQQALDLLKRVRTRWEFLRDRLDLSL
FT                   REAQHYLVGLGYEALAEKFADRADAQPDATVFHITQDRTIRVSWKQEIRAELRQIFNGG
FT                   EFKPILEEAQAIHKRVLRGRVFVALHMHAGDGNVHTNLPVNSDNYEMLQDAHTAVARIM
FT                   KLARSLDGVISGEHGIGITKLEFLTEEEIGEFRAYKQRVDPHGRFNAGKLLEGADLRNA
FT                   YTPSFGLMGYESLIMQQSDIGAISESIKDCLRCGKCKPVCATHVPRANLLYSPRNKILA
FT                   TSLLVEAFLYEEQTRRGVSIKHWDEFNDVADHCTVCHKCVTPCPVKIDFGDVTMNMRNL
FT                   LRKMGKKKFNPGNAAGMFFLNATNPQTINLARTAMMGIGYKAQRLGNEVLKKFAKKQTA
FT                   HPPATVGKPPVTQQVIHFMNKKMPGNLPKKTARALLDIEDNKIVPIIRNPKTTTADTEA
FT                   VFYFPGCGSERLFSQVGLATQAMLWEAGVQTVLPPGYLCCGYPQRGSGQFDKAEQIVTD
FT                   NRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFEKIFPGCRIIDIHEFLLEKGMKL
FT                   EGVNGVRYMYHDPCHTPIKTMDPVKLVNQLMGSEKDGYQIEKNDRCCGESGTLAVTRPD
FT                   ISTQVRFRKEEEIRKGAAKLRGIPLVAEAGANGINPANASAGSAGAPDGSVLKAGDGPQ
FT                   PKGATDVKILTSCPSCLQGLSRYNEDAGIEADYIVVEMARHVLGEDWMVDYVQRANNGG
FT                   IERVLV"
FT   gene            456919..457347
FT                   /locus_tag="Bxe_A4052"
FT   CDS             456919..457347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4052"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28947"
FT                   /db_xref="GOA:Q145P2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P2"
FT                   /protein_id="ABE28947.1"
FT                   /translation="MDCVFCREDGGDVLWHDDTLRVVLADEHDYPGFCRVIWNGHVAEF
FT                   SDLDGNDRDRVMKAVYAVERAIRRILQPAKVNLASLGNQVPHVHWHVIPRFSNDAHFPL
FT                   PIWAPRQRTVSEAMLSSRRAQATLLREAVRQEIEQALG"
FT   gene            457427..457840
FT                   /locus_tag="Bxe_A4051"
FT   CDS             457427..457840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4051"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28948"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P1"
FT                   /protein_id="ABE28948.1"
FT                   /translation="MSGLTPDTPVPTGVVVHSKSRVLELQYANGDSYRLPFELLRVYSP
FT                   SAEVMGHGPGQETLQTGKREVTITMIEGVGNYALQPTFSDGHATGIYSWDLLYDMAVRQ
FT                   DELWAAYLAKLQAAGVDRDTPMVQAGAAHGHCH"
FT   gene            457907..458638
FT                   /locus_tag="Bxe_A4050"
FT   CDS             457907..458638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4050"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone
FT                   methylase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4050"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28949"
FT                   /db_xref="GOA:Q145P0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145P0"
FT                   /protein_id="ABE28949.1"
FT                   /translation="MSKTHFGFQSVDEQDKAQKVAGVFHSVAANYDLMNDLMSGGLHRA
FT                   WKMFTIAQANVRPGYKVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLL
FT                   DKGVITPALLCDAEKIPFPDNYFDVVTVAFGLRNMTHKDIALAEMRRVLKPAGRLLVLE
FT                   FSKVWDPLKKVYDVYSFKVLPWLGEHFAKDAGSYQYLAESIRMHPDQETLKTMMEQAGL
FT                   DGVKYYNLSAGVVALHVGTKY"
FT   gene            458677..459669
FT                   /locus_tag="Bxe_A4049"
FT   CDS             458677..459669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4049"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4049"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28950"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N9"
FT                   /protein_id="ABE28950.1"
FT                   /translation="MSDSGVLSPRKVKRSLVRRIGLIAMVGLIMAGSLASLDAEARRMG
FT                   GGRSIGRQSNSVTQQSAPSQPSQGNQAMQQRAQPAPAPAPAPAAQPNRSRWLGPIAGLA
FT                   AGLGIAALLSHFGLGGAFAGAMANIIVIAIIAMIGIWLIRRFMGRKRDTSQPAYAGGSP
FT                   SLNSSGMGYSQEPRYTAPPTGSYLEPQGNPLSTPAINTAPAVPAGFDSEAFLRNAKVYF
FT                   VRLQAAWDVGNTEDIREFTTPEMFAEVKVDLSSRGAETNQTDVVQLNAELLGVEERANE
FT                   YFASVRFSGLIREAPGAAAEPFVEVWNLSKANRAGEGWLLAGIQQVAQH"
FT   gene            459823..460467
FT                   /locus_tag="Bxe_A4048"
FT   CDS             459823..460467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4048"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28951"
FT                   /db_xref="GOA:Q145N8"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N8"
FT                   /protein_id="ABE28951.1"
FT                   /translation="MTLAAKPFAAAVNHLLARETWARERLAPYAGKTAKLSCLPVVLML
FT                   LVQPDGYLSAVAAAEAQHFDVTIAVPSDALPAFVQGGQAAVMKHVKIEGDAEFATVIAK
FT                   LAEHLRWEPEEDLARLIGDGPAWRVASVMRTVGEQVQRAGRNLLDTAAEYLLDENPQLV
FT                   RRAALEDFNVELARARDALARVEKRIERLEQKVEARGAQAPGGAAMSRGTR"
FT   gene            460483..462060
FT                   /locus_tag="Bxe_A4047"
FT   CDS             460483..462060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4047"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4047"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28952"
FT                   /db_xref="GOA:Q145N7"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145N7"
FT                   /protein_id="ABE28952.1"
FT                   /translation="MRFLRFLKIFFTVIRFGLDEMMLSRVNDRRVRLLLRITTIGRKFD
FT                   APPGVRLRLALESLGPIFVKFGQVLSTRRDLLPVDIANELAKLQDQVPPFDSAVAIGLV
FT                   EKSLGAPVDVLFDDFERVPVASASIAQVHFATVKAGQHAGKAVAVKVLRPNMLPVIDSD
FT                   LALLRDIAVWAERLWADGKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDL
FT                   LLVPEMYWEFCTPTVLVMERMVGVPISQVETLRAAGVDIPKLAREGVEIFFTQVFRDGF
FT                   FHADMHPGNIQVSLDPAHFGRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATL
FT                   HLESGWVPPTTRVEELESAIRAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQL
FT                   VLLQKTMLNVEGLGRSLDPELDLWKTAKPYLERWMNEQIGLRGWYERLKIEAPQWSKTL
FT                   PQLPRLIHHALAERHDHTRGANDEMIRQILLEQKRTNRLLQGLLLFGVAVGVGAALARV
FT                   FLALAYGG"
FT   gene            462084..462707
FT                   /locus_tag="Bxe_A4046"
FT   CDS             462084..462707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4046"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4046"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28953"
FT                   /db_xref="GOA:Q145N6"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N6"
FT                   /protein_id="ABE28953.1"
FT                   /translation="MSDPTQPAVPDFETRDPNSPAFWDERFERRFTPWDQAGVPAAFQS
FT                   FAARHSGAAVLIPGCGSAYEAVWLAGQGNPVRAIDFSPAAVAAAHEQLGAQHAQLVEQA
FT                   DFFTYEPPFTPAWIYERAFLCALPLARRADYAHRMADLLPGGALLAGFFFLGATPKGPP
FT                   FGIERAELDALLTPYFDLIEDEAVHDSIAVFAGRERWLTWRRRA"
FT   gene            462890..463291
FT                   /locus_tag="Bxe_A4045"
FT   CDS             462890..463291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4045"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28954"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N5"
FT                   /protein_id="ABE28954.1"
FT                   /translation="MPIYAYRCESCGFGKDVLQKMSDPQLTQCPECGKDTFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGNGGTSAPAKPDANGASNGASGENAGANNGAAAQSTAAEGGSAA
FT                   AGSSNAAATPSAPAAAPAASASSSGSGSA"
FT   gene            463307..464020
FT                   /locus_tag="Bxe_A4044"
FT   CDS             463307..464020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4044"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28955"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N4"
FT                   /protein_id="ABE28955.1"
FT                   /translation="MGRRTRRALGFGPRGFLAVHMTTKKTTLKSVFLTGLLVLVPLAIT
FT                   LWVLGLIIGTMDQTLLLLPAAWQPERLFGFRLPGLGAVLTLAFIFVVGLLTQNFIGQKL
FT                   VKWWELLVGHIPVVGPIYTSVKQVSDTLLSSSGNAFRKALLIEYPRRGSYTIAFLTGIP
FT                   GGDVLNHLKEDHVSVYVPTTPNPTSGFFLMVPRSEVVELDMTVDAALKYIVSMGVVAPS
FT                   APPAPVRRTTVEPPL"
FT   gene            464088..465887
FT                   /locus_tag="Bxe_A4043"
FT   CDS             464088..465887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4043"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28956"
FT                   /db_xref="GOA:Q145N3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145N3"
FT                   /protein_id="ABE28956.1"
FT                   /translation="MSMRSEYCGLVTEELLGQSVSLCGWVSRRRDHGGVIFIDLRDREG
FT                   LVQVVCDPDRAEMFKAAEGVRNEFCLQIKGVVRARPEGTTNAALKSGKIEVLCHELIVL
FT                   NPSITPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLRLRYRVAIEVRKYLDAQGFIDI
FT                   ETPMLTKSTPEGARDYLVPSRTNPGQFFALPQSPQLFKQLLMVANFDRYYQIVKCFRDE
FT                   DLRADRQPEFTQIDCETSFLSEQEIRDLFEAMIRHVFKETIGVTLDEKFPVMLYSEAMR
FT                   RFGSDKPDLRVKLEFTDLTDAVRDVDFKVFSTPANTKDGRVAAIRVPKGGELSRGDIDS
FT                   YTEFVRIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDEAVKAIIERTGAQDGDIIFFA
FT                   ADRAKVVNDSLGALRLKIGHSEFGKANGLVESGWKPLWVIDFPMFEYDEEDNRYVAAHH
FT                   PFTSPKDEHLEYLETDPARCLAKAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKINAE
FT                   EAQAKFGFLLDALQYGAPPHGGIAFGLDRIVTMMAGADSIRDVIAFPKTQRAQCLLTQA
FT                   PSEVDERQLRELHIRLRQPEPKA"
FT   gene            465983..466561
FT                   /locus_tag="Bxe_A4042"
FT   CDS             465983..466561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4042"
FT                   /product="dihydroneopterin triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4042"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28957"
FT                   /db_xref="GOA:Q145N2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N2"
FT                   /protein_id="ABE28957.1"
FT                   /translation="MQPRSTACRTLADMYRARVAPSFYAMPKPPKIPQSVLVIIHTPAL
FT                   DVLLIERADHAGFWQSVTGSKDRLDEPLVETAAREVAEETGIVVGGARVPQSALFDWQY
FT                   SIEYEIYPEFRHRYAEGVIHNTEHWFSLQVPEQLEVTLAPREHTAFIWLPYEEAASRCF
FT                   SSSNADAILQLPRRLSGRAVVGQSGERNR"
FT   gene            466558..467817
FT                   /locus_tag="Bxe_A4041"
FT   CDS             466558..467817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4041"
FT                   /product="Putative phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4041"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28958"
FT                   /db_xref="GOA:Q145N1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N1"
FT                   /protein_id="ABE28958.1"
FT                   /translation="MSVGGARRFARLRQSLLGRRYWQRYRFTSGNDVKLLRSGDEFFSA
FT                   LIARVDAAQSDAVLETYIFCHDNAGQAVSAALLRAAARGVKVRAITDGIGTARLPMFNE
FT                   WAAAGIDHRIYNPHLFGRFGFSRTHRKLAVIDDQFAFCGGINIVDDYENNGEKLPYRRW
FT                   DFAVELHGPVVSDIRQAFEVQWRRIRLGHRPIESMVPDLGPQTAASLGSLRRRRRRRNE
FT                   ALWAGGQPCVAFVARDNLINRRAIEKAYLAAIGQARNEVLLANPYFMPGRKLRRALVFA
FT                   ARRGVVVKLIIGRKEFKALDYAVPFLYRSLLKAGVQIAEYEKTLLHGKVAVVDSNWGTV
FT                   GSSNLDALSLMLNNEANVVLVNDPAIDALREAILVAFKDSRRIDEARYDARPAGERVLN
FT                   WLAYTTYRAVMKLLTVGGYD"
FT   gene            468148..469770
FT                   /locus_tag="Bxe_A4040"
FT   CDS             468148..469770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4040"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4040"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28959"
FT                   /db_xref="GOA:Q145N0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N0"
FT                   /protein_id="ABE28959.1"
FT                   /translation="MLTHPDTYSPTMPTFPSSPAADHSSLHDEAVQAYQAGRHDAVRTL
FT                   AERILAEDPEHVGAIHLQGLLALASGHAREALRSLERAIQIRPEPILFNTLYAIRLNLG
FT                   DFAGAVQSIRQGLAIQPDFAAFHYNLALTLQHLGHIEDAALGYRRTLELDPDNSAAHNN
FT                   LGRVCADLGAMEEAGRHYRRAIELSPANLVARNNLGMALLATGRYDEAWPYFEDRWVSF
FT                   KHTDGRPAPAPVEVPLPRWPGAGVSVGQGAQAVQSLLVLHEQGLGDSLQFVRYLPLALA
FT                   HFARVGYVCPPALRRLYEQSLCSRWPGLVLLDAIPADLAGWDRYIPLMSLPMAFATRVA
FT                   TIPAALPYLYGDAGQAAAWRARLDALPAPHLPRVGVVWAGGHSGIAVDRLRSLAAVQIA
FT                   PLLALPHVRWISLQKTDDPAKLADAVTRTHLTDWTDEIGDFADTAALIENLDLVISVDT
FT                   SVAHLAAAMGKPVWLLNRFAGCWRWLYGRDDSAWYPGLRLFTQTRRADWHDVLERVVVA
FT                   LTQTFPMHDNAHSLLPSVPVERP"
FT   gene            470161..470760
FT                   /locus_tag="Bxe_A4039"
FT   CDS             470161..470760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4039"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4039"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28960"
FT                   /db_xref="GOA:Q145M9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M9"
FT                   /protein_id="ABE28960.1"
FT                   /translation="MRKGEQTRAAILDAALDLASRDGLEGLTIGLLAERMQMSKSGVFA
FT                   HFGSREDLQVEVVREYHRRFEDEVFFPSLREPRGLPRLRAMISRWIEKRIQEVTTGCIY
FT                   ISGAVEYDDRADNPVREQLVSSVTIWRAALTRAISQAMEEGHLRADTDPQLMLFELYSF
FT                   TLGLHHDARFLHLPDAVRLTWAALEKLIVSYQSEGR"
FT   gene            470861..472648
FT                   /locus_tag="Bxe_A4038"
FT   CDS             470861..472648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4038"
FT                   /product="Putative acyl-CoA dehydrogenase oxidoreductase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28961"
FT                   /db_xref="GOA:Q145M8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M8"
FT                   /protein_id="ABE28961.1"
FT                   /translation="MGQYAAPLRDMQFVLHELLNVEAEIRQMPKHADLDADTINAVLEE
FT                   AGKFCSEVLFPLNHSGDQEGCTYVGDGVVTTPKGFKEAYAQYVEAGWPALGCDPEYGGQ
FT                   GLPAFVNNALYEMLNSANQAWTMYPGLSHGAYECLHAHGTPELQQRYLPKLVAGVWTGT
FT                   MCLTEPHCGTDLGILRTKAEPNSDGSYAISGTKIFISSGEHDLAENIVHLVLARLPDAP
FT                   KGTKGISLFIVPKFVPNEAGEPGERNGVKCGSIEHKMGIHGNATCVINLDNAKGWLVGE
FT                   PNKGLNAMFVMMNAARLGVGMQSLGLTEVAYQNSLVYAKERLQMRSLTGPKAPDKAADP
FT                   IIVHPDVRRMLLTQKAYAEGARAFSYWSALHIDKELSHADESVRKEAADLVALLTPILK
FT                   AFLSDNAFEGTNHAMQIYGGHGFIAEWGMEQYVRDARINMIYEGTNAIQALDLLGRKIL
FT                   GDMGAKMKKFGKLVAEFVEAEGVKPEMQEFINPLADIGEKVQKLMMEIGMKAMQNPDEV
FT                   GAAAVPYLRTVGHLVFSYFWARMARIALDKEASGDPFYKAKLATARFYFAKLLPETAMT
FT                   IRQARAGSKSMMEVDEALF"
FT   gene            472763..475198
FT                   /locus_tag="Bxe_A4037"
FT   CDS             472763..475198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4037"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4037"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28962"
FT                   /db_xref="GOA:Q145M7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M7"
FT                   /protein_id="ABE28962.1"
FT                   /translation="MSNLIIRKVAVLGAGVMGAQIAAHLINAKVPVLLFDLPAKEGPKN
FT                   AIALKAIENLKKLSPAPFGVKDDAQYVQPANYDDDIGKLAECDLVIEAIAERMDWKHDL
FT                   YRKVAPHLAPNAIFATNTSGLSITALSEGFPDELKARFCGVHFFNPPRYMHLVELIPTA
FT                   TTRPEILDQLESFLTSVVGKGVVRAKDTPNFIANRVGIFSILAVVTEAAKYGLRFDEVD
FT                   DLTGARLGRAKSATFRTADVVGLDTMAHVIKTMQDTLKDDPFYPVYETPAVLAELVKKG
FT                   ALGQKTGGGFYRKEGKAIKVLDAKTGEYVDGGAKADELVGRILKRPPAERLKLLRESEH
FT                   PQAQFLWAIFRDVYHYIGVHLESIADNARDVDLAIRWGFGWNEGPFEGWQTAGWKQVAE
FT                   WVQEDIAAGKALSNAPLPSWVLEGPVAEKGGVHTNEGSWSPASKTFVPRSSLSVYDKQV
FT                   FRAPLVGETAADPKTYGKTLFETDAVRAWVDDRAGENDVLIVSFKSKMNTIGPSVIDGL
FT                   TQAIELAEKDYKGLVVWQPTSLKLGTPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKKF
FT                   QQGMLRVKYASVPVISAVSGIALGGGCELALHSAKRVAHIESYLGLVEVGVGLVPAGGG
FT                   LKEAALRAAEAATQVGATNDLLKFVQKSFENAAMAKVSASALDARAMGYLKPSDTIVFN
FT                   VFELLDVAKKEARALSAAGYRPPLRVTQVPVAGRSAIATIKASLVNMRDGRFISEHDFL
FT                   IASRIAEAVCGGDVEAGSLVDEEWLLQLERRAFVDLLGTQKTQERIMGMLQTGKPVRN"
FT   gene            475223..476422
FT                   /locus_tag="Bxe_A4036"
FT   CDS             475223..476422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4036"
FT                   /product="Thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4036"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28963"
FT                   /db_xref="GOA:Q145M6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M6"
FT                   /protein_id="ABE28963.1"
FT                   /translation="MAKQLQDAYIVAASRTPIGKAPRGMFRNTRPDELLVHAIRSAVAQ
FT                   VPGLDTKVIEDAIIGCAIPEAEQGLNVARMGALLAGLPNTVGGVTVNRFCASGLTALAM
FT                   AADRIRVGESDAMIAGGCESMSMVPMMGNKPSMSPHIFDRNEDIGIAYGMGLTAEKVAE
FT                   RWKISREAQDAFSVESHRRAIAAQQAGEFNDEIAAYTITERFPDLATGEVRVKTREVSL
FT                   DEGPRAETSLEGLAKLRAVFANKGSVTAGNSSQTSDGAGALIVVSEKMLKEFNLTPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAAGLKIDDLDWIELNEAFAAQSLAVIQDLGLD
FT                   PAKINPLGGAIALGHPLGATGAIRASTVVHGLRRRNYKYGMVTMCVGTGMGAAGIIERL
FT                   "
FT   gene            476577..477347
FT                   /locus_tag="Bxe_A4035"
FT   CDS             476577..477347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4035"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4035"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28964"
FT                   /db_xref="GOA:Q145M5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M5"
FT                   /protein_id="ABE28964.1"
FT                   /translation="MTMDILVERADGVLTIAFNRPDKKNAITAAMYQTMADALVQAHGD
FT                   AAVRAVLIRGSAGIFSAGNDLEDFMKAPPMGENAPVFQFLRAISSAEKPVVASVAGPAV
FT                   GIGTTLLLHCDLVYVADTASFSLPFAQLGLCPEAASSLLLQRVSGYQAAAEKLLLGEAF
FT                   DAAEAQRMGFVNRVLPAAEVDAFAASQAAKLAALPASSLRVTKSLMKRASYQELQTQMS
FT                   EEAVHFGKMLLAPEAREAFKAFFEKRKPDFRQFD"
FT   gene            complement(477480..478319)
FT                   /locus_tag="Bxe_A4034"
FT   CDS             complement(477480..478319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4034"
FT                   /product="Formate dehydrogenase, subunit FdhD"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28965"
FT                   /db_xref="GOA:Q145M4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M4"
FT                   /protein_id="ABE28965.1"
FT                   /translation="MNELETAGQPGAVERQVRRHRGAEVETVTDHVGQEWPVALVFNGI
FT                   SHAVMMCTPRDLEAFAVGFAISEGIVERGSDIQDIEVELHDNDELPHAEVQLQVVQQAF
FT                   VALKEKRRALAGRTGCGVCGIESIDLLDLEPERVPDTGFLQRLAPDAIARAARELPEHQ
FT                   ALTRLTGGLHAAAWCDAAGAIRYAFEDVGRHNALDKLIGQLVLDRVDTREGFVFLSSRA
FT                   SYELVRKAARVGVPMLATISAPSSLAIAIARKAGVRLVSFCREKSYVDYDTLLPAQR"
FT   gene            478468..478944
FT                   /locus_tag="Bxe_A4033"
FT   CDS             478468..478944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4033"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28966"
FT                   /db_xref="InterPro:IPR013481"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M3"
FT                   /protein_id="ABE28966.1"
FT                   /translation="MGLNEAPLLFNFEVESSENFTFIPMSVRFNLDRFGLRISLQQWQL
FT                   LPLEDRKLLARFPVEEDAEIEPNFDHALFEMLRTHANVEPEWFTPEEAPAWRRTDSVPE
FT                   GIAHQAQLAGIAAPGVARWAELAPFKRYVLAKLSRKPEANHDFVPAMKEFGAAG"
FT   gene            479118..482228
FT                   /locus_tag="Bxe_A4032"
FT   CDS             479118..482228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4032"
FT                   /product="Putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains) with PAS/PAC
FT                   sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28967"
FT                   /db_xref="GOA:Q145M2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M2"
FT                   /protein_id="ABE28967.1"
FT                   /translation="MTPFLSKRLLINLAVVAAAVGANAFVAYAQICGQRDADARMLRST
FT                   SVRQNLDAYQSALDGGLAALGRFETSGESAPAGAATSMAATLTRLESDLRGELAGDPAM
FT                   LDALARLSADSHALQHDIDDALLRSADSGASASRPWAASTYTHLGLGMHRVEAALAALR
FT                   GEENRALRASLAASASETQRAMFLLIVTMLAGSVLLIYTFGARESSAREKLRTVRALGR
FT                   NDERFRGLFDDHPVPMYIVDRETLRFLAVNAAAIQQYGYSESEFLGMTIRAIRPKAEIS
FT                   RLESHLQRSDATHHGRTMAGIWHHRRKDGSTISADISYHALNFMGRAAFFVLADDVTDQ
FT                   INAEAEAQRSNQMLEAVIDNIPQRIFWKDLESRYLGCNMAFARDAGLAYPEQVVGKSDA
FT                   DMPWRDFSSLLNDHDREVASTGVPKMNFEVDLMIDGVHRTTVTSKLPFTDGDGRVIGVL
FT                   GSYTDITERKRADLALRLQSRALDASVNAILITAPSPAGNLIEYVNPAFMRITGYDAAE
FT                   AIGHDCRLLQRDDRDQEGVALIRQALAANREVSAVVRNYRKDGALFWNQLFIAPVPDQD
FT                   GVITHHIGVINDVTDLMRYQEQLEYQANYDSLTRLPNRNLLRDRLQHALIVAQRHHKGV
FT                   AVVFIDLDGFKNVNDSLGHSVGDRLLSVVAERLARCTRTSDTVARHGGDEFVIVMTDTV
FT                   DEKSLIAWMERVRVSISEPVWLDGTELYVGCSMGASLFPQDGEDAETLMKKADLAMYRA
FT                   KDMGRNTFQFYQPEMNASAGTRLNLERRLRRALRDNQFLLHYQPQVDIVSGQIVGTEAL
FT                   VRWRDPEVGLVPPSSFIPVAEESGLIGPLSEWVLREACRQNKAWQDEGLPPARVSVNLS
FT                   ARVFQQRDIAKLVMQVLDETGLEPQYLELELTESTIMRNAEEAVSMLNELHALGIGLAI
FT                   DDFGTGYSSLSYLKRFPVDRLKIDRSFVSDIGISGDDETITSAIIALAHSLKLQVIAEG
FT                   VETSAQLDFLKERACDEMQGFYFAKPLSTDAISELLQGGVGRELATV"
FT   gene            complement(482248..482862)
FT                   /locus_tag="Bxe_A4031"
FT   CDS             complement(482248..482862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4031"
FT                   /product="Putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4031"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28968"
FT                   /db_xref="GOA:Q145M1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M1"
FT                   /protein_id="ABE28968.1"
FT                   /translation="MKLIGMLDSPYVRRVAICLKLLKFEFEHEAISVFSTYEQFAKINP
FT                   VVKAPTLIADNGQTVMDSTVILQYLATLAGPDQRLFPTRPDAALRAARLTGLALAACEK
FT                   SVQIVYERNLRPEAKQHEPWIERVSTQLFAAYAELERDLAAATLPVEANQFDAADVTVA
FT                   VAWQFTQMMLPGMVGKTAHPVLQSFSEKAEALPVFLSTPAQ"
FT   gene            483023..483955
FT                   /locus_tag="Bxe_A4030"
FT   CDS             483023..483955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4030"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4030"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28969"
FT                   /db_xref="GOA:Q145M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145M0"
FT                   /protein_id="ABE28969.1"
FT                   /translation="MKPIPPLTALRCFEAVARLGGVTQAARELHVTHSAVSQQIKVLEE
FT                   SMGVALFMRAARGLRLTEEGRLYALDIRMALRDITHATRRAQARPHESELVITTLPSFA
FT                   QHWLVPRLASFRDAHPYYRIRLLTSLQVEDFRQGVSDIGIRMGQGHWPDVAQQKLFDDE
FT                   MVVVAAPHFALAPDGRFPVTAADVMACPLISSPDTPWHEWCQAAQVSEPAEGAVVLSAN
FT                   DSNLVIAAVLQGQGVALERRSLVAYALARGELLQITDIRVPYPYPYWLVWQQREILDAA
FT                   QAHFAQWIEGEVDAYLRNGSAPAAAIRAG"
FT   gene            484144..484482
FT                   /locus_tag="Bxe_A4029"
FT   CDS             484144..484482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28970"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L9"
FT                   /protein_id="ABE28970.1"
FT                   /translation="MTSSPAKKLSVLLASVVLSVACAAPAFAQSGGGGGGPTGSDSDAA
FT                   VPSAASKAAPSTKAQRKAARKQARAKKNAELKKLEANGYQPSRNDPNYPNDIQNAQKKA
FT                   GIGTAASQ"
FT   gene            complement(484557..484952)
FT                   /locus_tag="Bxe_A4028"
FT   CDS             complement(484557..484952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4028"
FT                   /product="Putative thioesterase domain protein"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28971"
FT                   /db_xref="GOA:Q145L8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L8"
FT                   /protein_id="ABE28971.1"
FT                   /translation="MTNLLQLPQKHCALRVVPQPSDANVHGDVFGGWIMAQVDIAGSIP
FT                   ASRRANGRVATIAVNSFVFKQPVFVGDLLSFYADIVKTGNTSVTVEVEVYAQRMSLTED
FT                   LVKVTEATLTYVATDSDRRPRALPTLD"
FT   gene            485155..487125
FT                   /locus_tag="Bxe_A4027"
FT   CDS             485155..487125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4027"
FT                   /product="ABC transporter, fused ATPase and inner membrane
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28972"
FT                   /db_xref="GOA:Q145L7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L7"
FT                   /protein_id="ABE28972.1"
FT                   /translation="MQCAGPACRGRRAAANSGISTLSPADPMRRTPSSELSPISTQPRN
FT                   DWQTILPLLPYLATYKWRVAFALSCLIGAKVANLGVPIVMKRIVDSLASVQHLTALGRA
FT                   NDSPGIVLLGGVGLMVVAYAVVRLSTSLFTELREILFSKVTESAVRQLALKVFRHLHAL
FT                   SLRFHLERQTGGMSRDIERGTRGITQLISYSLYSILPTLVEVGLVLGFFVVKYEAYYAV
FT                   VTFIALAVYIVFTVKVTEWRTHFRRTMNDLDSKANSRAIDSLLNYETVKYFGNEEWEAS
FT                   RYDENLKRYRTAAIKSQRSLSALNFGQQAIIGTGLVFILWRATQGVMAGRLTLGDLVLI
FT                   NTFMLQLYIPLNFLGVVYRELKQSLTDMDRMFTLLGAAQEVPDLEGAPALRVSGAQVRF
FT                   EHVNFAYEPARQILHDVSFTIAAGTTTAVVGHSGSGKSTLARLMFRFYDLDRATGGAIT
FT                   IDGQDIRDVTQDSLRASIGIVPQDTVLFNDSIYYNIAYGRPSATREEVIAAARAAHIHE
FT                   FIEGLPKGYDTPVGERGLKLSGGEKQRVAIARTILKNPPILLFDEATSALDSRSERAIQ
FT                   HELDQIARERTTLIIAHRLSTVVHAQQIIVMDKGRIVERGTHAELLRANGLFAQMWALQ
FT                   QQRTTEAPESAETVGAGDAGR"
FT   gene            complement(487271..487996)
FT                   /locus_tag="Bxe_A4026"
FT   CDS             complement(487271..487996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4026"
FT                   /product="Putative nucleotidyl transferase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28973"
FT                   /db_xref="GOA:Q145L6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L6"
FT                   /protein_id="ABE28973.1"
FT                   /translation="MTMSVKKAMIFAAGRGERMRPLTDTRPKPLLEVGGKPLIVWQIER
FT                   LAQAGFRTIVINHAWLGEQIEATLGNGSRWQVALRYSPEREALETAGGIVQALPLLEDS
FT                   GASEVFVAVSGDVYADFDYATLNARAEKLAALPEPGMHLVMVPNPAFHPEGDFGLADGA
FT                   LSLEAQPRFTFGNIGLYDTRMFRDLPRDTRRALTPYYRETIARGLASGELYEGLWENVG
FT                   TPAQLGELDQRLRAAGAGS"
FT   gene            complement(488000..489091)
FT                   /locus_tag="Bxe_A4025"
FT   CDS             complement(488000..489091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28974"
FT                   /db_xref="GOA:Q145L5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L5"
FT                   /protein_id="ABE28974.1"
FT                   /translation="MTLPPLQDSTDTRLELLEAWLQGHAARYALELDTLVPASSDASFR
FT                   RYFRLAGKAAEGESGATLIAVDAPPPEKCREFVQVAQLLEAAGVHVPGVLEVDFEAGFM
FT                   LVTDLGTASYLGALTEAQNPDNPQDDPHRARTLMRDALDALIRWQLTSREGVLPPFDEA
FT                   FLRREMELMPEWFLGRHLGREADEKTRGVLDRTFALLIASARAQPQMFMLRDFMPRNLM
FT                   VAAGPAPVNPGVLDFQDAVYGPITYDVASLLRDAFLSWDEEFELDCFVYYWERARKAGL
FT                   PVDPDFGEFYRQLEWMGLQRHIKVLGLFCRINYRDGKPHYMKDLPRFIGYARKVAERYA
FT                   PLRPFARLLDDLEGRANEVGYTF"
FT   gene            489314..491683
FT                   /locus_tag="Bxe_A4024"
FT   CDS             489314..491683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4024"
FT                   /product="Putative organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28975"
FT                   /db_xref="GOA:Q145L4"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145L4"
FT                   /protein_id="ABE28975.1"
FT                   /translation="MPPRQLSQTTPSCAVVPRKRRLVAALIAVPGLMPALAHAQLVGEA
FT                   AQPQPIDAPWGMQLAPQLEERPLQPGQKPATFVLGDTTSGTTDQDMAAKGSAEVRRNTV
FT                   VIKADALHYDQDTDMADAYGSVHVVNNGNSFVGPEAHMRVDSSEGFMTAPKYHFNVTGG
FT                   SGSAERVDLLDNERSVFTKGTYTACACADDPAWYIKGSEFDFDTGADEGVAHNGVLFFQ
FT                   GFPVFASPWLSFPLSGERRSGVLPPTFSLSSSNGFELSVPYYFNIAPNRDLTLTPRLIS
FT                   KRGVQLQSTFRYLSPTYSGSITGEFLPDDHLTKTNRYALYIQHNQNFGNGFGGYIYYNK
FT                   VSDNTYPEDLSSSVNQFMNGTQLLYQQEAGLTYNNGPWSVLAREQHWQTLTPSVAPYGR
FT                   EPQLNVKYAKYNVGGFDYGAEADYSNFRITTADMTQGQRVMFNPYLSYSVVGPGYFVTP
FT                   KVQWHFASYNLNHLSDADVAAGTPKNFTESIPTLTFDTGLVFDRSVRIFGQDYIQTLEP
FT                   RLYYVYTPYRNQQSAPLFDTADSDFGLAEIFTPNTFVGNDRIADANRLTAALTTRFIDA
FT                   ATGDERARFVIAQQYYFQDQRVTLQSTQTSAQATHSDLIAGASLKLGAGFASETAFQYN
FT                   ADNNQLVKTSVGFGFSPATGKVINVAYRYTRANTTLDNTPINQVLISGQWPLAHRVYGV
FT                   GRFNYDLGGHRIVDGLVGLQYDADCWTLGAGIQRYANGLNTSGQNQSSTRFLAQLTFKG
FT                   LSSVDNGLMTAFRSSVAGYTPLPPPPPPESRFTNYE"
FT   gene            491751..493112
FT                   /locus_tag="Bxe_A4023"
FT   CDS             491751..493112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4023"
FT                   /product="Putative peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28976"
FT                   /db_xref="GOA:Q145L3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145L3"
FT                   /protein_id="ABE28976.1"
FT                   /translation="MAIMKKLRLATLAAGLAAAASFLSVAPVQAQALSGSGGQTVDTIA
FT                   AVVNNGVITRRELDERMGLITRRLNQQNAPVPPMDQLRQQVLNQMVLERIQLQKAKEDG
FT                   ITIDDATVQKTLERLAAANNLTLDVYRSRIEAQGVPWTTFTSDARTELTLSRLREKEVD
FT                   SKVTVSDAEVANYIASQRGPNAGLTSDLHLQHIFLKAPLNASETDIEAAQRKAQALLAE
FT                   AKGGANFEKLAKSNSQAPDASKGGDTGFVSPSKLPPEFVKAASALRPGEVNPDLIRTSD
FT                   GFEIVRLVDRRAGQGTSSDAPKLVQTHVRHILLRVGDGMSEPQARQKLLEIKNEIAAGG
FT                   DFAKFAHTYSQDGSSSQGGDLGWISPGETVPEFERAMNSLQDGQISDPVRSEYGYHLIQ
FT                   VLGRRESEGSVAQQMDLARQAIGQRKAEQAYADWLRELRDTAYVEVKPTLSSTQ"
FT   gene            493118..494128
FT                   /locus_tag="Bxe_A4022"
FT   CDS             493118..494128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4022"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28977"
FT                   /db_xref="GOA:Q145L2"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L2"
FT                   /protein_id="ABE28977.1"
FT                   /translation="MTTAAQSVRPPLQIAITTGEPAGVGPELTAQALAGAAAHWPHAQF
FT                   IVLGDADLLAERARAVGVDWRALVADGKRVRLQHRPLAAPAVAGKLNAANGRYVLDLLD
FT                   SAIDAAVAGTFDAIVTAPLQKSTINDAGVPFTGHTEYLAERTHTPRVVMMLAGTGKRPL
FT                   RVALATTHLPLKDVSAALSIEGILETLRIIDHDLRHHFGLPAPRILVTGLNPHAGENGY
FT                   LGREEIEVITPALKLADAQGIDARGPYPADTLFQPRYLEQADCVLAMFHDQGLPVLKYA
FT                   TFGEGINVTLGLPIIRTSVDHGTALDLAGTGRADAGSLIAAIDTAVSMAQHRRAG"
FT   gene            494287..495120
FT                   /locus_tag="Bxe_A4021"
FT   CDS             494287..495120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4021"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28978"
FT                   /db_xref="GOA:Q145L1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145L1"
FT                   /protein_id="ABE28978.1"
FT                   /translation="MSTSRQQQGRHQGHIARKRFGQNFLVDMGVIDSIVDVIRPQRGER
FT                   MVEIGPGLGALTEPLIERLATPEAPLHAVELDRDLIGRLKTKFGDLLELHAGDALAFDF
FT                   GSLAAPGDKASLRIVGNLPYNISSPLLFHLTAFAHCVIDQHFMLQNEVVERMVAEPGTK
FT                   AFSRLSVMLQYRYVIDKQLDVPPEAFNPPPKVDSAIVRMIPYELHELPPVDERVLGELV
FT                   TAAFSQRRKMLRNTLAAYRDSVDFEGLGFDLQRRAEDVPVAEYVRVAQIVAASKA"
FT   gene            complement(495276..496268)
FT                   /locus_tag="Bxe_A4020"
FT   CDS             complement(495276..496268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4020"
FT                   /product="Putative 10 TMS Drug/Metabolite Exporter
FT                   (DME)Family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4020"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28979"
FT                   /db_xref="GOA:Q145L0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L0"
FT                   /protein_id="ABE28979.1"
FT                   /translation="MARWAGLLSYDLFPTRLRPMSTSALPARRAPDSFAILLMIGLCAI
FT                   WGLQQVAIKSTNVALPPVFQAGLRSAIAAVLVWGWARSRGTPLFRDDGTLGAGLLAGVL
FT                   FASEFVCIFLGLTLTSASRMAVFLYTAPCFTALGLHWFVDGERMRRIQWLGIFVAFAGM
FT                   ALAFADGFLHGRAAQSPVLTGVAGDALGVLAGIAWAATTVVVRATRLAHSSASKTLFYQ
FT                   LTVSAAVLLALALALGQARVETVTPLAMVSLAYQAVVVAFVSYLVWFWLLTRYIASRLS
FT                   VFSFLTPLFGVTFGVLLLGESFSLRFLMAAVLVLTGIALVNAPAKRVTV"
FT   gene            496562..497683
FT                   /locus_tag="Bxe_A4019"
FT   CDS             496562..497683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4019"
FT                   /product="outer membrane porin, OmpC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28980"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K9"
FT                   /protein_id="ABE28980.1"
FT                   /translation="MKNVGRWAAAAVPAALASLGCQMAYAQSSVTLYGVVDESVRYLTH
FT                   ANAAGDSSIGLGNGGMTQSRWGLKGVEDLGGGWSTFFKLENRIYINSGQSDPTLPFFNE
FT                   AQVGVRSDSYGQIILGRQYNVVIEGVTVAGYGSNSWIPYDFSFQPEVTMTGGIWTSNQV
FT                   QYQARYNGFTFAAGYAFGGNAGNSYGSQIGAAAAYKPEGGPFSLGGAYEESKDSVNGAA
FT                   AKTWTFGGAYTWNLTRFSAGYIVNQNDAGFSNFANGPFTAPVLAALKYTDFARRRMIMG
FT                   GITQQVSNKWHFAANVWRTLQDGKTAAQDGSAWQYQLVADYNLSRRTDIYLEGDYSIYR
FT                   GDLIGAQLQGVNGVGLAQKGSQIGLMAGVRHQF"
FT   gene            497771..498157
FT                   /locus_tag="Bxe_A4018"
FT   CDS             497771..498157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4018"
FT                   /product="Glyoxalase I"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4018"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28981"
FT                   /db_xref="GOA:Q145K8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K8"
FT                   /protein_id="ABE28981.1"
FT                   /translation="MRLLHTMLRVGDLDRSIAFYTELLGMKLLRRDDYPDGKFTLAFVG
FT                   YEDERDGTVLELTHNWDTPSYDLGTGFGHLAVEVDDAYAACDRIKAQGGTVVREAGPMK
FT                   HGTTVIAFVTDPDGYKIEFIQKKK"
FT   gene            498185..498583
FT                   /locus_tag="Bxe_A4017"
FT   CDS             498185..498583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4017"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28982"
FT                   /db_xref="InterPro:IPR016918"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K7"
FT                   /protein_id="ABE28982.1"
FT                   /translation="MNNSNPYFKELDEIHVELAALFDGSADEGALQRIMARFAPQFTLV
FT                   MTSGIALDYAGLRETFSKLRGTRPGSQISIRDKEIVAEYPSGAVVKYREYQRDNTGNAN
FT                   VRRSTAVMDLNAHGKVTWRHLQETFCSE"
FT   gene            complement(498664..499566)
FT                   /locus_tag="Bxe_A4016"
FT   CDS             complement(498664..499566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4016"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4016"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28983"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K6"
FT                   /protein_id="ABE28983.1"
FT                   /translation="MQKSPTPQPAAALDNRQLDLPLFAEPGSTSSSPSPSAPTPGASQS
FT                   SPGGQQAAVPPAPDGSKLRSLAIGSRTLHYVLKRSARRSIGFAIDSTGLTITAPRWVTL
FT                   ADIETAITEKQRWIFTKLIEWQTRVEQRALPKVDWKDGAEVPYLGQPVRVKLGSPQGTL
FT                   AFSAEDAALQVPLPLQADPQQIKDRVQGWLQGEAKRLFGERLAIYAEKLGVNYRAYALS
FT                   SAATRWGSCSSDGKIRLNWRLIHFPLSIIDYVVAHELAHLREMNHSPRFWQTVESIFPE
FT                   FREARQTLKSHPPELLPTL"
FT   gene            complement(499611..500369)
FT                   /locus_tag="Bxe_A4015"
FT   CDS             complement(499611..500369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4015"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4015"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28984"
FT                   /db_xref="GOA:Q145K5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K5"
FT                   /protein_id="ABE28984.1"
FT                   /translation="MRFIRSLLLLIYFVLFTVPYATACFIAFPFMRADKRYWMAAGWCR
FT                   ATLHTVRWLNGIRYRIEGMENLPDGPAVLLSKHQSAWETLAFPALMPRPLCYVFKRELL
FT                   YVPFFGWALGLLKMVHIDRKEGKYAFESVIKQGKARMAEGAWVIMFPEGTRTRTGTQGK
FT                   YKTGGARFAIATGAPVVPIAHNAGRVWPRNSFLKYAGIVTVSIGKPIETTGLTPDEVNT
FT                   RVERWIEAEMRRIDPTAYRAAESSSAAAPI"
FT   gene            complement(500410..500964)
FT                   /locus_tag="Bxe_A4014"
FT   CDS             complement(500410..500964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4014"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28985"
FT                   /db_xref="GOA:Q145K4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K4"
FT                   /protein_id="ABE28985.1"
FT                   /translation="MPTKKVVILDRDGVINVDSDAFIKSPDEWVALPGALEAIARLNQA
FT                   GYRVAIATNQSGIGRGLFDMNALNAMHLKMHRMAAAVGGRIDAVFFCPHTAEDHCECRK
FT                   PKPGMLKMITERFEVDPENTPVVGDAMRDLQAGAALGHPVHLVLTGKGRKTLAAGGLPE
FT                   GTIVHDDLRAFALDFLADAQE"
FT   gene            complement(500975..503074)
FT                   /locus_tag="Bxe_A4013"
FT   CDS             complement(500975..503074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4013"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4013"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28986"
FT                   /db_xref="GOA:Q145K3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K3"
FT                   /protein_id="ABE28986.1"
FT                   /translation="MTQPHQATLLVELLTEELPPKALARLGDAFAEGIAQRLAARDLVE
FT                   GELSFERYATPRRLAVTIKNVRAVAPEKHVREKVLPVSVALDKDGQPTAPLAKKLAALG
FT                   FPDFSVNDLERAQDGKAEAFFLRYAAPGATLAEGLQSALDETLARLPIPKVMTYQRPDG
FT                   TNVQFVRPAHRLIALHGEQIVPVSALGIDADDTTLGHRFLSEGFVQIQHADSYAETLLH
FT                   KGRVVANFSDRKETIRTHLLAQANGDQVVMPESLLDEVTSLVEWPVVYACRFEDEFLQV
FT                   PQECLILTMQTNQKYFALTDANGKLRSRFLIVSNIETSTPGDIVEGNERVVRPRLADAK
FT                   FFFEQDKKKTLADRVPLLANVVYHNKLGSALQRVERVEALAGAIAGLIGADVALAKRAA
FT                   RLAKADLITDMVGEFPELQGTMGTYYARHDGEPEEVALACSEHYQPRFSGDALPATATG
FT                   TVVALADKLETLVGIWGIGLQPTGEKDPFALRRHALGVLRILVEKQLPVDFVELLRNAY
FT                   AQFAAVPNVVDSTQAIYEFSMDRLRGLLRERGYAPGEIDAVLALNPTRLDDIVARLDAV
FT                   REFASLAEAASLAAANKRISNILKKSEGAATGGVQVTLLVEAAEKALHAQLEQVAPRVQ
FT                   SQLAARDYTGALTALAALREPVDTFFNDVMVNAEDPALRANRLALLGALHQQMNCVADI
FT                   SRLAA"
FT   gene            complement(503090..504097)
FT                   /locus_tag="Bxe_A4012"
FT   CDS             complement(503090..504097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4012"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28987"
FT                   /db_xref="GOA:Q145K2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K2"
FT                   /protein_id="ABE28987.1"
FT                   /translation="MLTFQQIILTMQSYWDKQGCALLQPIDMEVGAGTSHVHTFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGFDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVLGEITYGLE
FT                   RLAMYLQKVENVYDLVWTEWEEQGPNGPELRRLTYGDVYHQNEVEQSAYNFEHANVELL
FT                   FSIFNSYEAEAKRMIEAQIALPAYELVLKAGHTFNLLDARGAISVTERAAYIGRIRALS
FT                   KLVAQAYYDSREKLGFPMLGNPVHGVPGLTTDEQDAAMPAWAPPLKVERKIDQD"
FT   gene            complement(504316..505926)
FT                   /locus_tag="Bxe_A4011"
FT   CDS             complement(504316..505926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4011"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28988"
FT                   /db_xref="GOA:Q145K1"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q145K1"
FT                   /protein_id="ABE28988.1"
FT                   /translation="MFSRRYLAMWCAAALFAVCAAFAATHHISWFWIIVPLALVALGLF
FT                   DLTQQRHAILRNYPLWGHFRFLFEFIRPEIRQYFVEGDTDEKPFSRAQRSIVYQRAKND
FT                   VDSRPYGTELDVKAVAHEWISHSLAPTRLDSHDFRIVVGPDRAQPYSMSIFNVSAMSFG
FT                   SLSANAIMALNLGAKKGNFAHDTGEGSMSKYHREHGGDIIWEIASGYFGCRNEDGTFSA
FT                   EKFAKQAAEPQVKMIEVKLSQGAKPGHGGVLPAAKITPEIAETRGVPMGRDCISPATHS
FT                   EFSTPRGLLEFVDRLRTLSGDKPTGFKLCIGHPWEFFGIAKAMLETGILPDFIVVDGAE
FT                   GGTGAAPLEFTDHVGVPLQEGLLLVHNTLVGIGLRQRIRIGASGKMITAFDITKTLAIG
FT                   ADWVNAARGFMFAVGCIQAQTCHTGRCPTGVATQDPVRQRALVVPDKADRVFNFHHNTL
FT                   HALKEIIQAAGLKHPAELRAHHIVRRVSSHEVQLMSELLKYLDPNDLLNGNYRYSLFEK
FT                   YWPVAQSDSFSPKVELAAT"
FT   gene            complement(506142..507287)
FT                   /locus_tag="Bxe_A4010"
FT   CDS             complement(506142..507287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4010"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28989"
FT                   /db_xref="GOA:Q145K0"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145K0"
FT                   /protein_id="ABE28989.1"
FT                   /translation="MSKQKVVVGMSGGVDSSVTAWLLKEQGYDVVGLFMKNWEDDDDSE
FT                   YCSTRQDWIDVVSVADLIGIDVEAVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMSLGAQTIATGHYARVRENNGRFELLKALDHTKDQSYFLHRLNQAQLSKT
FT                   LFPLGEIPKTRVREIAEQIALPNAKKKDSTGICFIGERPFRDFLNRYLPTKPGPMKTTE
FT                   GKVVGEHIGLAFYTFGQRKGIGLGGSKDGSGEPWFVAGKDIPSNTLYVAQGHDHPWLLS
FT                   HTLSAGNTSWVAGEPPADGFACGAKTRYRQADAPCTFSSAGAGEGLFELNFDVAQWAVT
FT                   PGQSAVLYDGDVCLGGGIIEHAVTGQPATRQPQKAALLTAR"
FT   gene            complement(507357..507836)
FT                   /locus_tag="Bxe_A4009"
FT   CDS             complement(507357..507836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4009"
FT                   /product="Putative NTP pyrophosphohydrolase"
FT                   /note="including oxidative damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4009"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28990"
FT                   /db_xref="GOA:Q145J9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J9"
FT                   /protein_id="ABE28990.1"
FT                   /translation="MKPETWLPHVTVAAIVERDGRFLVVEEHTADGLRLNQPAGHLEAG
FT                   ETLLEAVVRETLEETAHPFAPEALVGMYMTHFERPGNEGVTYLRFTYCGAGGEPDPERA
FT                   LDPDIVRTLWMSAGELRACPERHRTPLVMQCLDDYLAGRRFPLDFVHTHSVGPKQ"
FT   gene            508080..509222
FT                   /locus_tag="Bxe_A4008"
FT   CDS             508080..509222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4008"
FT                   /product="Putative NAD(P) transhydrogenase, alpha subunit"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4008"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28991"
FT                   /db_xref="GOA:Q145J8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J8"
FT                   /protein_id="ABE28991.1"
FT                   /translation="MHIGVPAETRAHETRVAATPETVKKYVTQGHRVTIQSGAGTGASF
FT                   PDDAFTAAGAEIVDAAAAFGADLVLKVQSPTDAELPLLKRGAVLVGMLDPFNTENSSKL
FT                   AAAGVTAFALEAAPRTTRAQSLDVLSSQANIAGYKAVLLAATLYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFLDVPYETDEERE
FT                   AAQGVGGYARPMPPSWLTRQSALVHERARQADVVISTALIPGRAAPTLISVETVQAMKP
FT                   GSVLVDLAAGRGAEYEGRRGGNCPLTEADQVVIRHGVSIVGYTNLASMVPADASSLYAR
FT                   NLLDFLKLIITKEGALNIDLADDIVAATLLARDGEVARKA"
FT   gene            509303..509635
FT                   /locus_tag="Bxe_A4007"
FT   CDS             509303..509635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4007"
FT                   /product="Putative NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4007"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28992"
FT                   /db_xref="GOA:Q145J7"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J7"
FT                   /protein_id="ABE28992.1"
FT                   /translation="MEVINHTVINLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAGLTLGAPGKFFGTLAVALAAVNVFGGFLVTRRMLEMFRKKEPKKLIADK
FT                   TAKENA"
FT   gene            509635..511089
FT                   /locus_tag="Bxe_A4006"
FT   CDS             509635..511089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4006"
FT                   /product="Putative NAD(P) transhydrogenase, beta subunit"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4006"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28993"
FT                   /db_xref="GOA:Q145J6"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J6"
FT                   /protein_id="ABE28993.1"
FT                   /translation="MSLNVVTLLYLVASVCFIQALKGLSNPKTARIGNTFGMAGMAIAI
FT                   LTTIALIVKQANGLGSNLGLGLGLLLVALVIGGAIGAFVAARVEMTKMPELVAAMHSLI
FT                   GLAAVCIAYAVVSEPAAFGLVDPENTAPGFLPYGNRVELFIGTFVGAITFSGSVIAFGK
FT                   LSGKYKFRLFQGAPVVYAGQHLINLLLALAMLGFGVIFFLTQSWLPFIIMTVIAFVLGV
FT                   LIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCRA
FT                   MNRSFFNVILGGFGNEPGAAAAGGAAEQRPVKSGSADDAAFMLGNAETVVIVPGYGLAV
FT                   ARAQHALKELTDKLVGKGIEVKYAIHPVAGRMPGHMNVLLAEAEVPYDMVYEMDDINGE
FT                   FGQVDVVLVLGANDVVNPAAKNDPKSPIAGMPIIEAYKARTVIVNKRSMAAGYAGLDND
FT                   LFYMDKTMMVFGDAKKVIEDMVKAVE"
FT   gene            complement(511141..511881)
FT                   /locus_tag="Bxe_A4005"
FT   CDS             complement(511141..511881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4005"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4005"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28994"
FT                   /db_xref="GOA:Q145J5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J5"
FT                   /protein_id="ABE28994.1"
FT                   /translation="MRRYHRGTVPVLLYTTPTMTRRADRLFQIAELLRGRRLTTAQQLA
FT                   DWLNISLRTVYRDVRDLQLSGVPIEGEAGIGYRLSRTASLPPLTFTADELAALAAGARM
FT                   LESWGGAAFAGGARGALAKIASAMPADKRAALERLAVFAPSFHIKGNFSAQLDALHRAI
FT                   DTRHVVSFAYVDVNGAATERRVWPLALAYWGARWTLGAWCELRSDFRNFGLEKIQNLQV
FT                   LEQYPDQEGKRLADLLRHVNARSK"
FT   gene            complement(511954..512337)
FT                   /locus_tag="Bxe_A4004"
FT   CDS             complement(511954..512337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4004"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4004"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28995"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J4"
FT                   /protein_id="ABE28995.1"
FT                   /translation="MSTSSKVVAWFEIPSVDFDRAVRFYEAALDVKLNVQEIGGQPIAV
FT                   FGYEEPATGGAIVHSPSMTPTGDGVLVYLNAQPNVDATLARVEKAGGKTDGPVIKLPQD
FT                   IGYIAFFTDTEGNRLGLHSRTNG"
FT   gene            complement(512576..513868)
FT                   /locus_tag="Bxe_A4003"
FT   CDS             complement(512576..513868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4003"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28996"
FT                   /db_xref="GOA:Q145J3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J3"
FT                   /protein_id="ABE28996.1"
FT                   /translation="MSFDFFLPCPRGLEASLAAELAEIAAQHLNGAPFTAGAQVPGGVH
FT                   FRGGWAAGMAANLHSRLASRVLLKVAHRPYRSEQDIYALAVEQRWEQWFSANETLRVDV
FT                   TAIKSPLRSLEFTTLRVKDAICDRLREVSGARPSIDTAMPDVRVFAFLTATDCTLYLDT
FT                   SGDPLFKRGWRLDKGAAPLRENLAAGILRLTGWTAGTPLYDPMCGSGTFLAEAAQVALN
FT                   IAPGAERRFGFEKLKQYEAKTWQTLKAAALDAKHAARNSRADLQIFGSDISGDMLDKAR
FT                   ANFQRAGLPSIPLKQLDARNMTPPSSAAGILVANPPYGERIEVRGRNARGELREGRGNR
FT                   DSREDDGFRRAQEETPDSEFFQSLGDALKQRFTGWHAFILTSDRKLPGQLRLRESTKTP
FT                   LFNGALECRLFRFDLIAGSVRQRPQTDTPAA"
FT   gene            complement(514000..516168)
FT                   /locus_tag="Bxe_A4002"
FT   CDS             complement(514000..516168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4002"
FT                   /product="Putative site-specific recombinase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28997"
FT                   /db_xref="GOA:Q145J2"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J2"
FT                   /protein_id="ABE28997.1"
FT                   /translation="MFDSLRRFIRKWRASRDGGHQLDALLAIADRTAPYPERSEWLIEL
FT                   AHWIRRGHAVEAGAAAAGDNAHHSTPTHTRIRYLLHVLDRNPVWKGNVAGILRALLRES
FT                   DGLSLLCDAGMPVHSGFFGALFERLEAALIPPAPNRRDLTAIVTLMFSSERDAEWIGAL
FT                   PTDLLIRIHALFDYAADEDEQRDTTPFSLDLLAALHNLTCQISSTGLSQTVRSRLGRAD
FT                   PDERGSAHAHRDRDGHAAHEASDVRVAMEKQPFYRLTRAMLAVETVHQAFVAGGPQEPL
FT                   LHEVNYLRLLLDECRGATDNVFAHLYRNGVSVDIVFQVERMRMRIVRAEHLLNAWMAQD
FT                   DPHAGARLTAELVNANHASQSVAHLVRSNFSLLARKVVEYSADTGEHYIARDRAEYLKM
FT                   LRMAAGGGLVTVVTVCVKFAITGAHFQAMFEGLLAGINYAASFLLMHFLHFSLATKQPA
FT                   MTAPTLARELDGVGTPAGVDSFVSSVTALMRTQAAAVLGNVLLVFPVCFGVQLLWHALF
FT                   RANIISPEKAHATLHSFSLWGPTPFYAALTGVLLWSSSLLAGWADNWFVLHRVADALTY
FT                   NRRLRMTLGAAGAERIARFCRANVARVVGNITLGLMLGLVPAILTAFAFSFEVRHVTLS
FT                   AGSIGVALGVLGKDALKLPELWWAVAGVGSMAILNVAVSFALAFYMAVKSRDLRRNAVR
FT                   SLRGAIWQRLFRHPLELVWPAKAARAAR"
FT   gene            complement(516170..516922)
FT                   /locus_tag="Bxe_A4001"
FT   CDS             complement(516170..516922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4001"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28998"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J1"
FT                   /protein_id="ABE28998.1"
FT                   /translation="MMFARLPRPPRGLARGAVLAGALAGLVALAACSSPSSRFYTLGSD
FT                   STAAAAAPVSGRTPAAPAWLIEVAPIDVPPQVSKNQLVVQTGPTQVKVLEEERWASLPG
FT                   DEIRRALSTSLTQQLNTIDVYGTARPDATPVYRVGMNVQRFESWPGSHALIDAVWSVRS
FT                   VRSNAVMTCRSVVSAPVSGGYDALVDGHRQALQRISVQIASAVQAMAAAAPQGQGTRGA
FT                   ASASTKGTAVSVAVPPCPSADSTAGAGA"
FT   gene            complement(516919..518577)
FT                   /locus_tag="Bxe_A4000"
FT   CDS             complement(516919..518577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4000"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4000"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28999"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J0"
FT                   /protein_id="ABE28999.1"
FT                   /translation="MTSPQEPTPAPDAPRNDSNGPKLPPQLPDPDIEPRSRWLPSLVWV
FT                   IPLIAALIGIALVIKSVTARGPTITISFVSAEGLEPGKTKVKYKDVDVGAVKTITLSKD
FT                   LSHVLVQVQLTKEGEDFAVKDSRFWVVRPRVGASGVSGLTTLLSGAYIGADAGHSPDTE
FT                   KNFVGLETPPPITGDQKGHQFILHGDSLGSIDIGSPIFYRRVQVGQVVGFSLDKDGTGV
FT                   TMQVFVSAPFDQYVGTNSRWWHASGVDLRLDSSGFKLNTQSLATVIVGGLSFQSPPGQG
FT                   VGAQAPNNMTFRLGSDEADAMREPDGVPLRVVMNFNQSLRGLSIGAPVDFRGIVLGQVT
FT                   NIGIDYDPKTRSFTMPVTMNLYPDRLGRRFRETAPAPGSLAGQTMLQQLVKHGLRGQLR
FT                   TGNLITSQLYVAVDIFPKAPPATVDVASDPLELPTIPNTLDELQLQVADIAKKLDAVPF
FT                   DQIGNNLNSALKNADQLFTRLDKEVVPQARDTLAAAKQTFGSAEATLQQDSPLQSDVHQ
FT                   ALQELTRTLQSLNALSDYLERHPESLLRGKSGDKP"
FT   gene            complement(518570..519220)
FT                   /locus_tag="Bxe_A3999"
FT   CDS             complement(518570..519220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3999"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3999"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29000"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I9"
FT                   /protein_id="ABE29000.1"
FT                   /translation="MKYVTARSAGLVSCHACGRVEPRIRSVTAQHCSRCGAHLHSRNPD
FT                   SLMRTWALLIAAALLYIPANLLPVMHTSSLLGSEDDTIMSGVVYFWTSGDWPLAVIVFV
FT                   ASIMVPMLKLSVLVLLTITAQRRSRWRPDQRITLYRMVERIGRWSMLDVFVVTLTVALV
FT                   RFKSLAVITAGPGAIAFGSVVILTMMASMQFDPRLIWDHVEGSTPKPQDLKHD"
FT   gene            complement(519228..519983)
FT                   /locus_tag="Bxe_A3998"
FT   CDS             complement(519228..519983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3998"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3998"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29001"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I8"
FT                   /protein_id="ABE29001.1"
FT                   /translation="MEHDNLIACHECDTLFRKPRLVGRTVARCPRCGATLYRGISRRLD
FT                   AVSAMTLGALITFLIAQGFPIVELETNGITSQTTLFGALIALWDEDMQIVAVMVFCSTI
FT                   LFPLTELVALLYVLIPLRAGYVPHAFNRVLRAIQFVRPWGMIEVFMLGILITIVKMVSL
FT                   ARVIPEAALFAFGVLTLMLAVVVTFDPRILWDLADELGARDQRPLPRTSADSAAAALNS
FT                   VAGPPAPPEVLGAEPSALPPVVPPAPRRG"
FT   gene            520421..520981
FT                   /locus_tag="Bxe_A3997"
FT   CDS             520421..520981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3997"
FT                   /product="Putative cytochrome b-561 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3997"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29002"
FT                   /db_xref="GOA:Q145I7"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I7"
FT                   /protein_id="ABE29002.1"
FT                   /translation="MALNPSFGSRESYTRTAIALHWLIALLIVCGFALGWVMTDIPGFT
FT                   PTKLRYFSWHKWIGVTVFALAVLRILWRATHSAPVMPRRMPAWQRGAAHVVHLLLYVLM
FT                   IAIPASGYLYSSAANVPVVYLGLIPLPRLIAPDPHLKELLKNVHITLNYTLLVLVALHV
FT                   AAALKHQWLDRDGLLSRMLPFLK"
FT   gene            520990..521553
FT                   /locus_tag="Bxe_A3996"
FT   CDS             520990..521553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3996"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3996"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29003"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I6"
FT                   /protein_id="ABE29003.1"
FT                   /translation="MKVSFYRYMLAAFAAASLTVAGSALAQVDVAKSSVTATSKQMNVP
FT                   VEGKFGKFTAQVRFDPAKPAEGSAQFSIDVASYDLGDESYNDQVRGKDWFDAKTYPSAT
FT                   FVSSAIAPAGGNQFKVTGKLTIKGKSQTVVVPVTVAQQGAMQIFDGSLPIKRSQFDIGT
FT                   GEWKDTSVVADEVVIKFHIVAARK"
FT   gene            521620..522189
FT                   /locus_tag="Bxe_A3995"
FT   CDS             521620..522189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3995"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3995"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29004"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I5"
FT                   /protein_id="ABE29004.1"
FT                   /translation="MLIAFGALASSFSLGAFAAADTYQLDPTHTYPSFEADHFGGLSVW
FT                   RGKFTKSSGTVTLDRAAKTGTVDVTVDPASVDTGNGKLDEHLKSDAFFDVAKYPSVTYK
FT                   GTDIRFDGDKPVEVIGNLTIRGITKPLNLKIESFKCMQHPVLKREVCGVEASAHFNRAD
FT                   YGMDFGVKYGFSMDTKLHIQSEGIRQ"
FT   gene            522470..523747
FT                   /locus_tag="Bxe_A3994"
FT   CDS             522470..523747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3994"
FT                   /product="Major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3994"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29005"
FT                   /db_xref="GOA:Q145I4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I4"
FT                   /protein_id="ABE29005.1"
FT                   /translation="MNATTAASLTGSRQSSWRAVVAASIGNALEWFDLVVYGFFAVVIA
FT                   KLFFPAGNDTVSLLLTLGTFGVSFFMRPLGAIVIGAYADRAGRKAALTLSILLMMAGTL
FT                   IIAILPTYQSIGLAAPVILVLARLMQGFSAGGEFGSATAFLAEHVPGRRGFFASWQVAS
FT                   QGLTTLLAAGFGVLLTGQLSPEQMSSWGWRVPFFFGLLIGPVAWYIRTKLDETPEFLAA
FT                   ETTTTPLRDTFTSQKLRLLIAIGVVVLGTVSTYLVLFMPTFGVKQLGLAPSVAFAAIAL
FT                   TGLIQMVFSPLIGHLSDRHGRTTIMLASALLLLVLIYPAFVYLVAHPTFGTLIVMQIVF
FT                   GFLMTGYFAALPGLLSEMFPVQTRTTGMSLAYNIAVTIFGGFGPFIIAWLISVTGSKAA
FT                   PSYYLIFAAAVSLVALIAARRKLGFR"
FT   gene            complement(523885..524835)
FT                   /locus_tag="Bxe_A3993"
FT   CDS             complement(523885..524835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3993"
FT                   /product="protein translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3993"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29006"
FT                   /db_xref="GOA:Q145I3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I3"
FT                   /protein_id="ABE29006.1"
FT                   /translation="MEFFRFRKDIPFMQRALIFNAISLLTFLAAVFFLLHRGLHLSVEF
FT                   TGGTVIEVQYPGAAPLEPVRGTLGKLGYADAQVQNFGTSRDVLIRLPLKQGYTSAQQSD
FT                   QVMSALKADTPQVQLQRVEFVGPQVGKELATDGLLALACVVIGIVIYLSFRFEWKYAVA
FT                   GVIANLHDVIIILGFFAFFQWEFSLSVLAAVLAVLGYSVNESVVIFDRIRETFRRERKL
FT                   SVIEVINHAITSTMSRTIITHGCTQMMVLSMFLFGGPTLHYFALALTVGILFGIYSSVF
FT                   VAAALAMWFGVKREDLIKDRKERTDADDPNAGAQV"
FT   gene            complement(524856..526943)
FT                   /locus_tag="Bxe_A3992"
FT   CDS             complement(524856..526943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3992"
FT                   /product="SecD export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3992"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29007"
FT                   /db_xref="GOA:Q145I2"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I2"
FT                   /protein_id="ABE29007.1"
FT                   /translation="MNRYPLWKYAVMLVALVIGLVYTLPNLFGEAPAVQVSSGKATVKL
FT                   DSTTLSAVEAALAANQIKPDDVTFDNSATNANIRVRLPDTDTQLRVKDLLQKSLNSDPS
FT                   DPQYIVALNLQSASPRWLTALHALPMYLGLDLRGGVHFLLQVDMAGALNKKLDSDASDA
FT                   RTLLRDSNIRDGGVNRVNQTVVINFADQATADIASKQLGRSISELQWASQTGPDGGVQL
FT                   VGTFTPTVQKAVQDAALKQNITTLHNRVNELGVAEPVIQQQGSDRIVVELPGVQDTAKA
FT                   KDIIGRTATLEARLADPVNTHPNPSDPVPPGDELFTQGNQTPVLLRKQIIFTGDRIIDA
FT                   SAGFDEHQRPSVNIRLDSAGGRAVASVSRDNIGKPMAMVLFEKGKGEVLTVATIQSELG
FT                   DRFQITGQATPQGAADLALLLRAGSLAAPMDIIEERTIGPSLGADNIRKGFHSVVWGFA
FT                   AIAVFMIAYYMLFGVISMIGLSVNLLLLIAVLSMLQATLTLPGIAAIALALGMAIDANV
FT                   LINERVREELRNGAPPQLAIQNGYAHAWATILDSNVTTLIAGIALLAFGSGPVRGFAIV
FT                   HCIGILTSMFSAVFFSRGIVNLWYGGKKKLKSLAIGQVWRPDTAPAGSAAYLGSEDAST
FT                   DTAQAVAAVAAKPSKARAAVAQARAGKPTVRRRNAPGSSTGTPGSSPGSTNTPQKPGSS
FT                   R"
FT   gene            complement(527062..527424)
FT                   /locus_tag="Bxe_A3991"
FT   CDS             complement(527062..527424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3991"
FT                   /product="protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3991"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29008"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I1"
FT                   /protein_id="ABE29008.1"
FT                   /translation="MIVLTYNGETNVSFISNAFAQGTATGGIESNLMSFLPLILMFGVL
FT                   YFIMIRPQMKRQKEHRNMLAAMAKGDEVVTNGGIVGKVTKVGEAYVGVEISEGTEITVQ
FT                   KASVTTILPKGTIKSL"
FT   gene            complement(527601..528791)
FT                   /locus_tag="Bxe_A3990"
FT   CDS             complement(527601..528791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3990"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3990"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29009"
FT                   /db_xref="GOA:Q145I0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I0"
FT                   /protein_id="ABE29009.1"
FT                   /translation="MTDGHLSQDATHERPENGLKFELLGVDGQARRGRVALNHGVVETP
FT                   IFMPVGTYGTVKAVQPRELEEMHAQIILGNTFHLWLRPGLETIEAYGGLHGFMGWKKPI
FT                   LTDSGGFQVFSLGDLRKITEDGVTFASPINGDKLFLSPEVSMQIQKVLNSDIVMQFDEC
FT                   TPYATHNVPTSHQEAADSMRMSMRWAQRSIDEFNRLGNPNALFGIVQGGMFEDLRDESL
FT                   AGLAEKDFHGLAIGGLSVGEPKEDMMRVLNHIGPKLPANKPHYLMGVGTPEDLVAGVAA
FT                   GVDMFDCVMPTRNARNGWLFTRFGDIKIRNAAHRNSLRPLDEQCGCYTCRNFTRGYLHH
FT                   LHRVGEILGAQLNTIHNLHYYLELMQEIRDAIDAKMFEPFRKRFHENRARGTAEAP"
FT   gene            complement(528910..529968)
FT                   /locus_tag="Bxe_A3989"
FT   CDS             complement(528910..529968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3989"
FT                   /product="Queuosine biosynthesis protein"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3989"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29010"
FT                   /db_xref="GOA:Q145H9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145H9"
FT                   /protein_id="ABE29010.1"
FT                   /translation="MLTLSDFDFDLPPELIAQVALPERSASRLLEVDNPAGATGPARLI
FT                   DRRFAELPDCIAAGDLLVFNDTKVLKARFLGQKASGGKIEVLVERLTGERTALAQIRAS
FT                   KSPQPGTTIRLADAFDVTVGERVEPFYTLHFPADCLTLIEQFGRLPLPPYIEHDPDATD
FT                   ETRYQTVFAQNPGAVAAPTAGLHFDEALLARLDAAGVERATLTLHVGAGTFQPVRVENL
FT                   AEHKMHSEWYHLPQSLADKIAATRARGNRVIAVGTTSMRALEAAARDAEAAGRPLAAAS
FT                   TETDIFITPGYRFRVVDRLVTNFHLPKSTLLMLVSAFAGVETIREAYRHAIEARYRFFS
FT                   YGDAMLLTRRDA"
FT   gene            530240..532546
FT                   /locus_tag="Bxe_A3988"
FT   CDS             530240..532546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3988"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3988"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29011"
FT                   /db_xref="GOA:Q145H8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H8"
FT                   /protein_id="ABE29011.1"
FT                   /translation="MDREKAAREGEKSGIHPADKPADKPADEPTDKPTDKPTDKPDNIF
FT                   GDKPAGRSAAKAAAKAAAKSATKPAAKSTDKPAAKPAEKTADKLAKLGLTRDIDLVLHL
FT                   PMRYEDETSLTPIGHLLPGGIAQTEGVVFDNEIAYRPRRQLLVKLRDDAGDELVLRFLN
FT                   FYGSQVKQMAIGARLRVRGDVRGGFFGMEMVHPAVRVVDEDTPLPQALTPVYPSTAGVT
FT                   QAYLRKSIDNALSRTSLPELLPEPVARTWLEPLGVPSLMDAVRTLHHPGVQSDETALID
FT                   GTHPAWVRIKFEELLAQQMSLKRAHEERRTRAAPAMPRRKLGDESALVARLLKALPFSL
FT                   TAAQERVGGEIALDLTQPHPMQRLLQGDVGSGKTIVAALAAAQAIDAGYQAALMAPTEI
FT                   LAEQHARKLRGWLEPLGVSVAWLAGSLKTREKRAAIEAAALGTAQLVIGTHAIIQDAVE
FT                   FARLGLVIVDEQHRFGVAQRLALRAKAQNAADGARDFQPHQLMMSATPIPRTLAMTYYA
FT                   DLDVSTIDELPPGRTPILTKLVSDARREEVIGRVREAALTGRQVYWVCPLIEESETLQL
FT                   QTAVETYETLVAALPELKVGLVHGRLAPAEKAAVMDAFTRNEVQLLVATTVIEVGVDVP
FT                   NASLMVIEHAERFGLAQLHQLRGRVGRGSAASVCVLLYTGPLSMTARARLQTMRETTDG
FT                   FEIARRDLEIRGPGEFLGARQSGAAMLRFADLENDQWLIEPAREAAAALLEKYPEVVMQ
FT                   HLARWLGAREQYLKA"
FT   gene            532717..533676
FT                   /locus_tag="Bxe_A3987"
FT   CDS             532717..533676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3987"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3987"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29012"
FT                   /db_xref="GOA:Q145H7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H7"
FT                   /protein_id="ABE29012.1"
FT                   /translation="MTLTELKYIVAVARERHFGRAAEACFVSQPTLSVAIKKLEDELNV
FT                   QIFERGTSEVSVTPIGEQIVTQAQRVLEQTLAIKEIAKQGKDPLVGPLRLGVIYTIGPY
FT                   LLPTLVKQMIKRVPQMPLMLQENYTLKLIELLKQGEIDVAIMALPFPETGLMLRPLYDE
FT                   PFVVALPSGHAWENRQKIDADDLKQETMLLLGSGHCFRDHVLGVCPELMRFSQNADGIQ
FT                   KTFEGSSLETIRHMVASGVGITVLPRMSVHEVKPHAGGIDAGLLSYVAFDEPVPDRRVV
FT                   LAWRKSFTRMPAIDAICDAINACDLPGVRKLDLPVAVN"
FT   gene            534087..535541
FT                   /locus_tag="Bxe_A3986"
FT   CDS             534087..535541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3986"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3986"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29013"
FT                   /db_xref="GOA:Q145H6"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H6"
FT                   /protein_id="ABE29013.1"
FT                   /translation="MSEHKLTNAAGAPVADNQNSMTAGARGPVVLQDVWLLEKLAHFDR
FT                   EVIPERRVHAKGSGAFGTLKVTHDISRYTKAKVFAQAGKETPLFMRFSTVAGERGAADA
FT                   ERDVRGFSIKFYTEEGNWDVVGNNTPVFFIRDPLKFPDFIHTQKRDPYTNMRSNVAAWD
FT                   FWSRHPESLHQVTILMSDRGIPQNFRQMHGFGSHTYSFINANNERFWVKFHFKSMQGVE
FT                   NFTDAEAAQVVAQDRESAQRDLLTNIDQGNFPKWRFAIQVMPEAEAATYRFNPFDITKV
FT                   WSQKDYPLIDVGTIELNRNAANYFADVEQAAFTPANVVPGIGFSPDRLLQGRLFSYGDT
FT                   QRYRLGVNHHQIPVNASRVASPHSFHRDGAMRTDGNLGGNVNYEPNRFGDFAQDANASE
FT                   PPLAAGAVDRYDHRLDDDYYTQPGMLFALFDAAQRERLFGNIARHINGVPQEIVARQIE
FT                   HFRRADPAYAEGVIAAIARLAEGETK"
FT   gene            535563..535787
FT                   /locus_tag="Bxe_A3985"
FT   CDS             535563..535787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3985"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29014"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H5"
FT                   /protein_id="ABE29014.1"
FT                   /translation="MQQRGTHLRPAGIDTNRRSTIMMQMMMATLGGTSAARGAQQQYAL
FT                   MARKAVGFAIVTSGLAVIAAQALQHALGG"
FT   gene            535940..536437
FT                   /locus_tag="Bxe_A3984"
FT   CDS             535940..536437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3984"
FT                   /product="Putative ferritin DPS-family DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3984"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29015"
FT                   /db_xref="GOA:Q145H4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H4"
FT                   /protein_id="ABE29015.1"
FT                   /translation="MAKKEASAAVQHVNIGISDKDRKKIAEGLSRLLADTYTLYLKTHN
FT                   FHWNVTGPMFNTLHLMFETQYNELALAVDSIAERIRALGVHAPGSYKEFARLSSIPEAD
FT                   GVPAAEEMIRQLVEGQEAVVRTARAIFPSTEAANDEPTADLLTQRMQTHEKTAWMLRSM
FT                   LA"
FT   gene            536656..537519
FT                   /locus_tag="Bxe_A3983"
FT   CDS             536656..537519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3983"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3983"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29016"
FT                   /db_xref="GOA:Q145H3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145H3"
FT                   /protein_id="ABE29016.1"
FT                   /translation="MFARLPLYLRLVRMDKPIGSLLLLWPTLNALWIASDGRPSLPLLV
FT                   IFTVGTVLMRSAGCAINDYADRDFDRYVRRTENRPITSGKIRAWEAVALAAALSLLAFL
FT                   LILPLNALTKELSVAALFVAGSYPFTKRFFAIPQAYLGIAFGFGIPMAFAAIQNHVPML
FT                   AWVMLLANVFWSVAYDTEYAMVDRDDDIKIGIRTSALTFGRFDVAAIMLCYAVTLGIYV
FT                   GIGVLLGFGALYWLGWAAAAGCAIYHYTLIRNRERMACFAAFRHNNWLGGALFAGIAAH
FT                   YAATWF"
FT   gene            complement(537637..538452)
FT                   /locus_tag="Bxe_A3982"
FT   CDS             complement(537637..538452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3982"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3982"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29017"
FT                   /db_xref="GOA:Q145H2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H2"
FT                   /protein_id="ABE29017.1"
FT                   /translation="MKIAFIGGGNMAAALIGGLIKRGVAAADLYAIDPNEEARKRNEQQ
FT                   FGIRTGAAADAALAAYDAVVLAVKPQILKSVAEAVAPHLNASQLVVSIVAGIRMGDMSR
FT                   WLNGHSRIVRVMPNTPALIGMGVTGLVATGSVDEAGRALASQLLGAVGETVWFDDEAKI
FT                   DAVTAISGSGPAYVFYFIEALQEAARQLGMDEAQGRALAVATFTGAAQLAANSDEPPGV
FT                   LRERVTSKGGTTAAALASFDASGIKDAIVRGALAANARAREMGDEFGKQ"
FT   gene            complement(538510..539208)
FT                   /locus_tag="Bxe_A3981"
FT   CDS             complement(538510..539208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3981"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3981"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29018"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H1"
FT                   /protein_id="ABE29018.1"
FT                   /translation="MPDLIHNLEAVRQRIATAAHVAGRDTRSIHLLAVSKTFPAEDVRA
FT                   AYAAGQRAFGENYVQEAITKIEALADLRATIEWHFIGPLQSNKTRPVAEHFDWVHSVDR
FT                   LKIAQRLSEQRPDNLPPLNVCLQVNISGEASKSGVGIAEAAQVAQAIAALPKLKLRGLM
FT                   AIPEPAGSIDEQRVPHRQLRELFERLRDGGLALDTLSMGMSSDLEAAVLEGATIVRVGT
FT                   AIFGARDYSN"
FT   gene            complement(539246..540472)
FT                   /locus_tag="Bxe_A3980"
FT   CDS             complement(539246..540472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3980"
FT                   /product="Putative glycolate oxidase iron-sulfur subunit"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3980"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29019"
FT                   /db_xref="GOA:Q145H0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H0"
FT                   /protein_id="ABE29019.1"
FT                   /translation="MQTNLADFMRNTPDGDEADGILRNCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQMVEGAPVTRSTQVHLDRCLTCRNCETTCPSGVQYGRLVEIGRKITEE
FT                   KVTRPLGQRLMRRMLASFVPSSALFTPTMRIGQHFRPLLPRKLRDKVPARQRPLEWPTA
FT                   KHPRKMLLLAGCVQPSMMPNVNVATARVLDALGIETLIAPDAGCCGAIRLHLGYNDDAL
FT                   DDLRANIDAWWPYVEQGVEAIVMNASGCGATVKEYAHLLRDDPAYAEKARRVVELTRDI
FT                   AEILPEFEESLVSVTRRRSVHTVAFHPPCTLQHGQQIRGKVEHLLGALGVEVRLPTDNH
FT                   LCCGSAGTYSLTQPKLSYALRDQKLERLQAQEPQVIVSANVGCIAHLQSGTSTPVAHWI
FT                   ELVEHMLSV"
FT   gene            complement(540481..541569)
FT                   /locus_tag="Bxe_A3979"
FT   CDS             complement(540481..541569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3979"
FT                   /product="Putative glycolate oxidase, subunit GlcE"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3979"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29020"
FT                   /db_xref="GOA:Q145G9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G9"
FT                   /protein_id="ABE29020.1"
FT                   /translation="MEEDDIVAGWSERVRSASAEGRALRIRGGGTKDWYGQTLEGDILD
FT                   TRAYRGIIAYDPAELVITARAGTPLLEIEAALADHHQMLAFEPPHFGPQATFGGCIAAG
FT                   IAGPRRPSAGAARDFVLGAVIMNGQGQTLHFGGQVVKNVAGYDVSRLMAGSLGTLGLIL
FT                   ELSIKVLPLPQAEATLKFDMNGTDAVRKLNEWGGRPLPITASAWRHGTLAVRLAGAEAA
FT                   VKSARTSLGGEVVDAVEAERFWAGLREQTDSFFSAIPPKAALWRLALPSITEPLQLPGA
FT                   QLMEWGGGQRWWITDTDAQTVRISAKQAGGHATIFRTGHGYDRGAGVFTPLPAPLMKIH
FT                   RGLKAAFDPARIFNRGRLYPDF"
FT   gene            complement(541719..543212)
FT                   /locus_tag="Bxe_A3978"
FT   CDS             complement(541719..543212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3978"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3978"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29021"
FT                   /db_xref="GOA:Q145G8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G8"
FT                   /protein_id="ABE29021.1"
FT                   /translation="MNAPAELTAEVLAQRQREVVQALMAVLPTHCLLYREEDTVAYECD
FT                   GLAAYRRLPLAVALPETESQVQRIVQICHRLDVPIVPRGAGTGLSGGAMPIRHGVVVSL
FT                   ARLRKIVEVDSYARTATVQPGVRNLSISEAAAPYGLYYAPDPSSQIACTIGGNVSENSG
FT                   GVHCLKYGLTVHNVLRVRAVTMEGEIVEFGSLAPDAPGLDLLAVLIGSEGMFAIVTEVT
FT                   VKLIPKPQTAQVIMASFDDVVKGGDAVAGIIAAGIIPAGLEMMDKPATRAVEEFVNAGY
FT                   DLDAAAILLCESDGTPDEVADEIVRMTAVLREHGATRIQISRSENERLRFWSGRKNAFP
FT                   AAGRISPDYYCMDGTVPRRSIGPLLTRIEAMEKIYNLRCINVFHAGDGNMHPLILFNGN
FT                   DRDEWHRAEAFGCDILEACVELGGTVTGEHGVGIEKINSMCVQFSPEERDAFHAVKRAF
FT                   DAPGLLNPDKGIPTRARCAEYGKMHVRGGLLPHPDLPRF"
FT   gene            complement(543284..544699)
FT                   /locus_tag="Bxe_A3977"
FT   CDS             complement(543284..544699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3977"
FT                   /product="Putative FAD-binding oxidase"
FT                   /EC_number="1.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3977"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29022"
FT                   /db_xref="GOA:Q145G7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G7"
FT                   /protein_id="ABE29022.1"
FT                   /translation="MNHPVPPAPLRRPFPAELLSALKAAFAERVSVSEAVRVHHGRDES
FT                   PFDPQLPDAVVFARTTEDVQNVVKLCGQYNVPVIPYGNGSSLEGHLLAVQGGVSIDLSE
FT                   MNRVLSINAEDLTVTVEPGISRKQLNEALRDTGLFFPIDPGADASIGGMSATRASGTNA
FT                   VRYGTMRENVLGLTVVLADGRVIKTGTRARKSSAGYDLTRLFVGSEGTLGVITEITVRL
FT                   YPQPEAVSAAVCTFPSMGDAVRAVIETIQIGVPIARVEFVDSLAIRSINRHSNLTLREA
FT                   PTLFFEFHGTEAGVKEQAELVQEVAAQNAGEGFEWATRPEDRSRLWNARHNAYFAMLQL
FT                   KPGCRAVTTDVCVPISRLAECVEETEQDLKASPLPCPIVGHVGDGNFHVAILIDPNKPE
FT                   ELVEAERLNHRIVERALRMDGTCTGEHGVGLHKMGFLLEEHGEVAVDTMRSIKHALDPH
FT                   NLMNPGKIFSWAA"
FT   gene            544957..545523
FT                   /locus_tag="Bxe_A3976"
FT   CDS             544957..545523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3976"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3976"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29023"
FT                   /db_xref="GOA:Q145G6"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G6"
FT                   /protein_id="ABE29023.1"
FT                   /translation="MGDMMGNRLSKIATRTGDDGTTGLGDGSRVRKDSARIAAIGDVDE
FT                   LNSNVGVLLCETLPDKVRAALVTIQHDLFDLGGELCIPGHTMITDRQLAQLDDWLADYN
FT                   AALPPLKEFILPAGSRAASLAHVCRTVCRRAERAIVALGEHDTINAAPRQYVNRLSDLL
FT                   FVLARVLNRADGGTDVLWQHERRAG"
FT   gene            complement(545599..545931)
FT                   /locus_tag="Bxe_A3975"
FT   CDS             complement(545599..545931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3975"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3975"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29024"
FT                   /db_xref="GOA:Q145G5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G5"
FT                   /protein_id="ABE29024.1"
FT                   /translation="MTIDTKIRHVTRPGANLFLELGFSAKEAKQLHAASQKQINDTRLL
FT                   KEQLMTELSTWIEQHHLKQAEAAEILMVSRPRVSDVVNKKTTKFTIDTLVEMMSRIGKP
FT                   VTLAVG"
FT   gene            complement(545928..546272)
FT                   /locus_tag="Bxe_A3974"
FT   CDS             complement(545928..546272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3974"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3974"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29025"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G4"
FT                   /protein_id="ABE29025.1"
FT                   /translation="MEQEKEIRWLGSSYHDLLAFPEEMRRRAGFQLGKIQAGLDPDDWK
FT                   PFDSIGPGTREIRIREADGVFRVMYVTKFVEALYVLHCFQKKTQRLGPHDRKIAETRYR
FT                   AIINNRKTEK"
FT   gene            complement(546456..547529)
FT                   /locus_tag="Bxe_A3973"
FT   CDS             complement(546456..547529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3973"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3973"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29026"
FT                   /db_xref="GOA:Q145G3"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G3"
FT                   /protein_id="ABE29026.1"
FT                   /translation="MPPHNTDDVRIRELKELTPPAHLIREFACDETVSDVIYNSRTSMH
FT                   RILHGMEDRLIVIIGPCSIHDTKAAMEYAGRLVEQRKRFAGELEIVMRVYFEKPRTTVG
FT                   WKGLINDPYMDNSFKINEGLRTARELLLRINELGLPAGTEYLDMISPQYIADLISWGAI
FT                   GARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIV
FT                   STAGNEDCHIILRGGKTPNYDADSVNAACADIGKAGLAARLMIDASHANSSKKHENQIP
FT                   VCADIGRQIASGDERIVGVMVESNLVAGRQDLQEGCALTYGQSITDACIGWDESVAVLE
FT                   GLADAVKQRRVARGSGN"
FT   gene            complement(547907..549373)
FT                   /locus_tag="Bxe_A3972"
FT   CDS             complement(547907..549373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3972"
FT                   /product="microcin-processing peptidase 2, Unknown type
FT                   peptidase, MEROPS family U62"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3972"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29027"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G2"
FT                   /protein_id="ABE29027.1"
FT                   /translation="MNIIEPGIRNLATAKDILLTPYGLDEALLTRTLAEIFTHKIDYAD
FT                   LYFQYTRSEAWSLEEGIVKSGSFSIDQGVGVRAVSGDRTAFAYSDDLSPEAIRQAALAT
FT                   RSIARAGGGKQKIKVASSLTGIAGRDLYLPADPLHSLDATAKVKLLERIEKMARGRDPR
FT                   IQQVMAGLAGEYDVVLVARSDGGFAADIRPLVRVSVTVIAEQNGRREIGSGGGGGRFDY
FT                   AYFTDEVLSGYVDDAVHAALVNLEARPAPAGAMTVVLGPGWPGVLLHEAIGHGLEGDFN
FT                   RKGSSAFAGRIGEQVAARGVTVVDDGTLPNRRGSLNIDDEGNPTQCTTLIEDGILKGYI
FT                   QDTLNARLMKMPVTGNARRESYAALPMPRMTNTYMLNGDKDPQEIIASVKNGLYAVNFG
FT                   GGQVDITNGKFVFSASEAYMIEDGKVTYPVKGATLIGSGPESLKYVSMIGNDMKLDSGV
FT                   GVCGKEGQSVPVGVGQPTLRIDRMTVGGTA"
FT   gene            complement(549493..550317)
FT                   /locus_tag="Bxe_A3971"
FT   CDS             complement(549493..550317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3971"
FT                   /product="Putative carbon-nitrogen hydrolase protein"
FT                   /EC_number="3.5.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3971"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29028"
FT                   /db_xref="GOA:Q145G1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G1"
FT                   /protein_id="ABE29028.1"
FT                   /translation="MSSGSLESAFRVAALQMVSTPDRERNLAEAGRLIAEAAAEGAQLV
FT                   LLPEYFCFMGFKDTDKLAVREPYQDGPIQRFLADAARRHQIWVIGGTLPLMSPEASRVL
FT                   NTTLVFDPQGNEAARYDKIHLFNFEKGAESFDEARTICPGGEVRSFEAPFGRVGLSVCY
FT                   DLRFPELYRRMGDCALIVVPSAFTYTTGRAHWEMLLRARAVENQCYVLAAAQGGKHENG
FT                   RRTWGHSMLIDPWGEIVALRDEGAGVVAGNLERARIDEVRQSLPAWRHRVLS"
FT   gene            complement(550473..554765)
FT                   /locus_tag="Bxe_A3970"
FT   CDS             complement(550473..554765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3970"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3970"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29029"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G0"
FT                   /protein_id="ABE29029.1"
FT                   /translation="MQTGFAGSPSTLSRVLHFVVNLQNYHTPTRRSMSERNESADPHET
FT                   GQVRPVSGSDHIVLRRTFHVVLAIALVLYFVATGLFLALRYVVLPRADSFRPRIEAIVS
FT                   EKLHAQFSIGKLAPYWSGFQPGLDVTNLVIRDRDGKTALTIPHATATLSWKSLWQFHPA
FT                   LSSLIVDQPDVLVARSSDGVLSVAGVPVPTRHSGNDVLTTWLLRQQAIVVRGGVLRWRD
FT                   AEHAAPELALRDIRIAILNDGYDHRLALQAPAEGHVLNGPLDFRTHFRHAPLSAIGKPI
FT                   NWTGQVYVSTGPVDLPTLARYVNFPIETFAGRIDNAIWIDFADGRMKSASGQLTGADVA
FT                   MRVRPTQPKLLVPVASFMWRLEAEAGDYKLQLSQFHAELGQPPLDDGTPLTRTLALTTL
FT                   NGRYRTASQQHGQLVSVSGDRVDLGILAEFSRALPLSRRLLNNLVRYNPRGLVANYLIE
FT                   VERAKPESGEAGSDHQPSGAEPIERYRFKGDLQGISVAAQEPPPGLTPLNHPRAGIPGI
FT                   ENLWGSVDADETHGTALLDTSNVAITLPGVFDDPRLKLDRLHGRADWTITPKAPGENHP
FT                   AFTVKLADFGVSNADVAATATADYSNPGHGRGSLDLKADFQRAQVTRIARYLPTSIGEK
FT                   LRIYLGHGLQAGMSHGATIEVHGDLTKFPYSRDPSAGLFHIVAPFKGGKFDPTPYPPRK
FT                   MRNGTPNVWPALDGIDGVFELRQNVMRFDIDRAHYKQVALTGVNGRIDDLGTRASSLVI
FT                   KGDGHGPLADMLDYVNASSLGIMAKHETDKVRAEGPASLALKLTVPRTPKPHIGVEGAV
FT                   GFQNNRLSVENVPPLSQLKGKVRFTEHTAQVDRLSGQFLGGDVHANGGLKQDGTYALDL
FT                   GGHIAVDAARGLDLHGPGAQVLTRMSGSAPYALNVRGAKGRLPEVTANSDLTGLALDFP
FT                   APFNKPVGAPMPLRFAVSPSAAPGEAGLERADLTFGPLAAAYLLRYQPKTPPTVVRGAV
FT                   GVNRPADLPSEGVIAAVDLDTFDADAWRALVTQIRTKDAPAPASVTPAPATPNPTVAQF
FT                   LPSRFALHVGTLTLLKRHWDSVIVGASHADRTWQANIASNQVSGHVSWLPGPTRESPGT
FT                   LQARFARVVIPSATDKDLLGEVMSAPAQNMPSIDLVVNELIVRDHNVGRLEVDAHNFDE
FT                   DGVPVWQLDKLDITNPAATLSATANWRTSTDLGSSADEATARRTVFDFKLDIKDAGALL
FT                   ERFGQPRTLKAGAGSLSGKMVWQGGPTRIDYPTLNGNLAVDLRHGQILKVDPGVAKLLG
FT                   VLSLQSLARFATLNFRDVIGEGLPFEHVTGTAQIHNGIGRTENFEMVTAPARAEMKGSV
FT                   DLAQETQDLHVQIVPTVSAGAAVIAATVINPLLGLGALVADLAFSQSVSHAFAREYAIT
FT                   GSWSKPHVERVKGDRGKMDAPASTVEAH"
FT   gene            554802..557648
FT                   /locus_tag="Bxe_A3969"
FT   CDS             554802..557648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3969"
FT                   /product="Glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3969"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29030"
FT                   /db_xref="GOA:Q145F9"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F9"
FT                   /protein_id="ABE29030.1"
FT                   /translation="MLLRIEQRLSSNERARPLKTDATLLSSSYSHYAARAAAARPQLVA
FT                   QVAALASAPLTRERIDARFDALCAEAAGASGAPLSEDALKRALRQLRTEVFCAVMERDL
FT                   AGEADVAEVTGAMTDLAETTIQRALAVLSAELEVLYGEPRGPHGERLSLGVVGMGKLGG
FT                   RELNVSSDIDLIFIYEEDGETAGGHRSPIATQEFFTRLGKRLIGALAEVTADGYVFRVD
FT                   MRLRPNGDSGPLVCSLGMLEEYFYVQGREWERYAWIKGRLVSEGTSDAAQRLQKQLDAI
FT                   VTPFVYRRYLDFGVISAIRALHLQIRQEAQRRASMRPDKADDIKLGRGGIREIEFSAQV
FT                   FQLIRGGQDAGFRVRPTLAVLRHAATHGLIDTSVCVKLSQAYRFLRELEHRLQYRNDAQ
FT                   THAMPVDPEERVALAHAMGCDDYAALMAKLDAHREFVEQQFDQIFADKVSGRDGCGAPE
FT                   DGAAAWVWSSALADDSADDVLQARLVELGVAEPGELLARLRAVWQSSRYAGLAERSRQR
FT                   FDIVAQRALEAARTLEPAERRGDTVARFFDLLEAVSRRGAYLALLTEYPQALHHVLSVL
FT                   GGSRWAAGYLIRHPQLLDELLDDEAMDSPFDWPEFKRTLRLRLAAADGVEQQMDLLRHA
FT                   HQAEVFRILLIDLAGKLSVEHVSDRLSELADAVLDVTLEAVWRQLPKRHRDVPRFAVIA
FT                   YGKLGGKELGYASDLDVIFLYDDTDEAAAEVYSTYTRRLITWLTTATGAGTLFDVDLRL
FT                   RPNGESGLLVTDLDAFRRYQLREGDAANTAWVWEHQALSRARYCAGDAGIGAKFEAIRE
FT                   QVLTTPREAAPLAKEIVEMRERVEAGHPNHTALFDLKHDRGGMVDIEFTVQYWVLLHAA
FT                   SDPELIRNTGNIALLREVSRFGLMSEAEAETVGAAYRTYRKLQHKLRLDGMEKARVEPA
FT                   LVATEREAVLGLWKRVFG"
FT   gene            complement(557704..559374)
FT                   /locus_tag="Bxe_A3968"
FT   CDS             complement(557704..559374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3968"
FT                   /product="DNA replication and repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3968"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29031"
FT                   /db_xref="GOA:Q145F8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F8"
FT                   /protein_id="ABE29031.1"
FT                   /translation="MLRHLSIRDFVIVAALDLEFDSGFTVFSGETGAGKSILIDALALA
FT                   LGARADANVVRTGESRADITAEFETHAQVEQWLDEQALGTTGSDGHHGSTVMLRRVVDG
FT                   NGRSRAFINGTAATLAQLREVGEMLVDIHGQHAHQLLMRPDAQRELFDTHAGLSDTAAA
FT                   VTRAWRAWREKVQAVEHAQTRDRELQLERERLAWQLAELDKLAPQPGEWEEVNSEHRRL
FT                   SHSANLIDGVQGALGALSESDEAMITHLSSIVSKVRDLAEVDPALNDVLAALEPAEIQL
FT                   QEAAYSLSHYAQKLELDPDRLAQVEKRLDALHSAARKFRLQPQTLPEEHEARRAQLAAL
FT                   DAAADLDSLHAAEAKAKEHFLTEAKKLSKARAKAGKALGAAVTTGMQELSMKGGSFEVA
FT                   LVPQPEGGAHGLEQVEFRVAGHAGVPLRPLAKVASGGELARISLALAVIASAASPTPTL
FT                   IFDEVDTGIGGGVAEVVGRLLHQLGQQRQVLCVTHLPQVAARGDHHFQVAKAGNGKGGT
FT                   ISSVTSLDKASRIEEVARMLGGLEITPTTRKHAKEMLAA"
FT   gene            complement(559446..560348)
FT                   /locus_tag="Bxe_A3967"
FT   CDS             complement(559446..560348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3967"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3967"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29032"
FT                   /db_xref="GOA:Q145F7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F7"
FT                   /protein_id="ABE29032.1"
FT                   /translation="MQVTSQFKTVALVGRNNTPGIAEPLTALALCIAKRGFEVVFEADT
FT                   AAEIGVTDYPALRPAEIGARADVAVVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFIT
FT                   DIPISDMREIVPQMLAGNFEREERVLLEARIMRDGNPIYHALAFNDVVVNRSGFSGMAE
FT                   LHVSVDGRFMYNQRSDGLIVATPTGSTAYALSSQGPILHPQLQGIVLVPIAPHALSNRP
FT                   IVLPDDSKVSIQIVSGREVNVNFDMQSFTSLELSDTIEVRRSRHTVPMLHPVGYSYFAT
FT                   LRKKLHWNEYPSHEEDPKP"
FT   gene            560667..561686
FT                   /locus_tag="Bxe_A3966"
FT   CDS             560667..561686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3966"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3966"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29033"
FT                   /db_xref="GOA:Q145F6"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F6"
FT                   /protein_id="ABE29033.1"
FT                   /translation="MLDPRAQTLLKTLIERYIAEGQPVGSRTLSRYSGLELSPATIRNV
FT                   MSDLEDLGLVISPHTSAGRIPTPRGYRLFVDTMLTVESAADEEAVMRTVKTTLQAGEPQ
FT                   KIVAAAASVLSNLSQFAGVVLTPRRSHVFKQIEFMRLSDKRILLIIVTPEGDVQNRIMA
FT                   TQRDFSPSQLVEASNYINAHFAGLSFDDVRRRLREEIDELRGDMTTLMHAAVTASTDEA
FT                   DTGETVLISGERNLLEVADLSSDMARLRKLFDVFDQKTSLLQLLDVSSHAAGVQIFIGG
FT                   ESNLVPIEEMSVVTAPYEVNGKIVGTLGVIGPTRMAYNRVIPIVDITARLLSLTLSQQ"
FT   gene            561861..562931
FT                   /locus_tag="Bxe_A3965"
FT   CDS             561861..562931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3965"
FT                   /product="Ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3965"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29034"
FT                   /db_xref="GOA:Q145F5"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F5"
FT                   /protein_id="ABE29034.1"
FT                   /translation="MRFDLERPSQNATSHRVAVLLINLGTPDAPTPRAVRRYLAQFLSD
FT                   PRVVEIPALLWQIILRLLILPFRGSASAKKYAAVWMPEGSPLRVYTEKQVEGLRHLLQL
FT                   NDYTVLVDYAMRYGTPGIPAMLNQLKLAGAERVLLMPMYPQYSSSTTATAFDDAFSALK
FT                   RMRNQPEIRTVRQYADHPAYIAALAAQVHQYWHQHGRPDFAAGDKLVLSFHGVPKRTLD
FT                   LGDPYHEQCQQTGALLMQALELTPVECRITFQSRFGKAEWLQPYTAPTLKELGAAGVRR
FT                   ADVFCPGFTADCLETIEEIGMEVRDEFLHAGGKDFHRIPCLNASQAWIAALGEIVAQNL
FT                   QGWPVQALPVPHTTGA"
FT   gene            562940..563347
FT                   /locus_tag="Bxe_A3964"
FT   CDS             562940..563347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3964"
FT                   /product="heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3964"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29035"
FT                   /db_xref="GOA:Q145F4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F4"
FT                   /protein_id="ABE29035.1"
FT                   /translation="MNYGISTEAGAKLRIDKWLWAARFFKTRSLAAAAVEKGHVRIEGA
FT                   SVKPAKDVRVGDLVEIEIERIVWQVAVLGVCDVRGPASVAQTLYAETEESRVKRQVEQE
FT                   RRKTYREPAAALHGRPTKRDRRTIDKLSGGG"
FT   gene            563867..564451
FT                   /locus_tag="Bxe_A3963"
FT   CDS             563867..564451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3963"
FT                   /product="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3963"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29036"
FT                   /db_xref="GOA:Q145F3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F3"
FT                   /protein_id="ABE29036.1"
FT                   /translation="MENTQENPTSQNPKPAEETARQAAEAAAPQQEAAANAATDSPASA
FT                   EQAALAEAQAKIAELQESFLRAKAETENVRRRAQEDVAKAHKFAIESFAEHLLPVIDSL
FT                   EAAVAHSSDDPAKVREGVELTLRQLTGALEKGRVVALNPVGEKFDPHRHQAISMVPADQ
FT                   EPNTVVAVLQKGFVIADRVLRPALVTVAAPK"
FT   gene            564497..564943
FT                   /locus_tag="Bxe_A3962"
FT   CDS             564497..564943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3962"
FT                   /product="Putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3962"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29037"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q145F2"
FT                   /protein_id="ABE29037.1"
FT                   /translation="MANIPVDSTAFAVFGMQELSAASFDAALAEAGDELAVVFFWGLDC
FT                   FNCEIAKKAMLAQPDAIRALGLKWFHSNVYEHRELGRRFMLHGVPTWFFFYRGKRLGRA
FT                   TGWHGLGQFQAAVAAAREKIRAGNAANAAGGHIEAADSGGSSPD"
FT   gene            565098..567059
FT                   /locus_tag="Bxe_A3961"
FT   CDS             565098..567059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3961"
FT                   /product="Putative DnaK chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3961"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29038"
FT                   /db_xref="GOA:Q145F1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F1"
FT                   /protein_id="ABE29038.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEGNSVKVIENSEGARTTPSIIAYMED
FT                   GEILVGAPAKRQSVTNPKNTLYAVKRLIGRRFEEKEVQKDIGLMPYKIIKADNGDAWVE
FT                   VRDQKLAPPQISAEVLRKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAFGLDKNEKGDRKIAVYDLGGGTFDVSIIEIADVDGEKQFEVLST
FT                   NGDTFLGGEDFDQRIIDYIIGEFKKEQGVDLSKDVLALQRLKESAEKAKIELSSSQQTE
FT                   INLPYITADASGPKHLNLKITRAKLEALVEELIERTIEPCRVAIKDAGVKVGEIDDVIL
FT                   VGGMTRMPKVQEKVKEFFGKDPRRDVNPDEAVAVGAAIQGQVLSGDRKDVLLLDVTPLS
FT                   LGIETLGGVMTKMINKNTTIPTKHSQVYSTADDNQGAVTIKVFQGEREMAAGNKLLGEF
FT                   NLEGIPPAPRGTPQIEVSFDIDANGILHVGAKDKATGKENRITIKANSGLSEAEIEKMV
FT                   KDAEANAEEDHKLRELADARNQGDALVHSTKKALTEYGDKLEAGEKEKIESALKDLEET
FT                   LKSGSSDKAAIEAKIEVVATASQKMGEKMYADMQAAQGAEAAAAGAAGAGGAGASAGGA
FT                   SQQQDDVVDAEFKEVKKD"
FT   gene            567331..568473
FT                   /locus_tag="Bxe_A3960"
FT   CDS             567331..568473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3960"
FT                   /product="Putative DnaJ chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3960"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29039"
FT                   /db_xref="GOA:Q145F0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F0"
FT                   /protein_id="ABE29039.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEG
FT                   HFKEVKEAYEMLSDSQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGGAARGGGGRAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKP
FT                   GTKPETCPTCSGSGSVRMSQGFFSIQQTCPKCHGTGTYIPDPCGHCHGAGKVKETKTLE
FT                   VKIPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFT
FT                   TAALGGEIEVPTLAGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPV
FT                   KLTEPQRDLLKQFEKALVEGGSRHSPQSKSWFDRVKSFFD"
FT   gene            568499..570421
FT                   /locus_tag="Bxe_A3959"
FT   CDS             568499..570421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3959"
FT                   /product="Para-aminobenzoate synthase, component I"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3959"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29040"
FT                   /db_xref="GOA:Q145E9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E9"
FT                   /protein_id="ABE29040.1"
FT                   /translation="MTADEHSAVFALLDDCDATAARPSSRLYTGFVHEWVCTQAAQLEA
FT                   VCESVAAQTRRGLHAVVLADYEFGRNLLDIKSHRSPKTQRGDATLRFLLFEHCEKRSRE
FT                   QVDAWLMARDEGAAEPSVAGTANVRASVDPAQFNAAIGAIHAALEAGDSYQVNYTYRLG
FT                   FDVFGSPTALYRRLRARQPVRYGALIALPDGDWVLSCSPELFVEKQGSVLHARPMKGTA
FT                   PRSDDPAVDRSTAEFLGNDPKNRAENVMIVDLLRNDLSRVAQTGSVKVPALFSVEPYAT
FT                   VWQMTSTVHAELRSGTSFAGLLRALFPCGSITGAPKHRTMQLIDELESTPRGLYTGAIG
FT                   WLDGHSAATGATGAHTPASAANETACGDFCLSVAIRTLTLSRSAQNGQLEGRMGIGAGI
FT                   VLDSVAADEYAECQLKARFLTNAEPGFELFETMYATREEGVRHLSRHLARLASSAAALG
FT                   FKLEDANVMGAEIAAKCASLPANIPHRMRVALSKNGTAQITAAVLAPLGESTVGVLLGP
FT                   DHAFPATDAGDLLLRHKTTRRAEYDRGWREAEAKGAFDTLFFNAQGELTEGGRSNVFVK
FT                   LAGRWWTPPLASGVLPGVMRSVLLDEASDLHAAERVLTRADLQNAEALMVCNALRGAVP
FT                   ARLVD"
FT   gene            complement(570763..571578)
FT                   /locus_tag="Bxe_A3958"
FT   CDS             complement(570763..571578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3958"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3958"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29041"
FT                   /db_xref="GOA:Q145E8"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145E8"
FT                   /protein_id="ABE29041.1"
FT                   /translation="MTYLQEASRNAVTVPKLQAMRDAGEKIAMLTCYDASFAALLDRAG
FT                   VDVLLIGDSLGNVLQGQTTTLPVSLADIAYHTASVARARPAALIVADLPFGTYGTPEDA
FT                   FRSSVELMRAGAQMVKLEGGEWLADTVRFLVERSIPVCAHVGLTPQSVHAFGGFKVQGK
FT                   TEAGATQLLRDSLAVQAAGAQLIVMEAIPTLLASDATKQLRIPTIGIGAGLDCSGQVLV
FT                   LHDMLGIFPGKRPRFVKDFMQGQPSILAAVEAYVAAVKDGSFPGPEHTF"
FT   gene            complement(571617..572297)
FT                   /locus_tag="Bxe_A3957"
FT   CDS             complement(571617..572297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3957"
FT                   /product="Putative deoxynucleoside kinase"
FT                   /EC_number="2.7.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3957"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29042"
FT                   /db_xref="GOA:Q145E7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E7"
FT                   /protein_id="ABE29042.1"
FT                   /translation="MNSSPLTVTAPQLRPPFGYLAIEGPIGVGKTSLARRLAQRWSMQE
FT                   MFERPQDNPFLERFYRDTVRYALPTQLHFALQRAQQAQDVSAAHLSGTPLIADFMTQKN
FT                   DIFARLTLQEDEWQLYRALAARLEVSAPAPDFVVYLQASPEVLFARIQKRAVPMELQIS
FT                   DAYLHALCDAYNEFFYHYDRTPVLTVNAEHLNPLDSDADLALLAERIETMRGRKEFFVK
FT                   GTSL"
FT   gene            complement(572294..572842)
FT                   /locus_tag="Bxe_A3956"
FT   CDS             complement(572294..572842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3956"
FT                   /product="7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase,
FT                   HPPK"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3956"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29043"
FT                   /db_xref="GOA:Q145E6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E6"
FT                   /protein_id="ABE29043.1"
FT                   /translation="MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAP
FT                   IDAGGDDYFNCVVKVDTTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLFGDQS
FT                   IDEADLIVPHPRLIERAFALVPLVEIDSALIIPQHGRAEALLSKVSDQRIEKVKGPCQC
FT                   PMLNALTVGEDKTGKGRCE"
FT   gene            complement(572891..574480)
FT                   /locus_tag="Bxe_A3955"
FT   CDS             complement(572891..574480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3955"
FT                   /product="Poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3955"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29044"
FT                   /db_xref="GOA:Q145E5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E5"
FT                   /protein_id="ABE29044.1"
FT                   /translation="MIKKFIRKLFGQDTAPADDTLPAEAEADETGNAPARTPSGASKAR
FT                   RKPARSSAPAKTVRDPDVPVIIPHDVHGIDQALISRNAIRVTEGLQQAGHRAFIVGGAV
FT                   RDLLLGIKPKDFDVATDATPEQVQKLFRRARIIGRRFQIVHVQFGQEIIETSTFRALVD
FT                   PPAADAPPARRLKRDELDRRTHAVDASGRVLRDNVWGEQHEDATRRDFTINAMYYDPAT
FT                   QTVLDYHNGMADMRARLLRMIGDPATRYREDPVRMLRVVRFAAKLDFEIEDSTREPIAG
FT                   MADLINNVPAARLFDEMLKLMLSGHALACLKRLRQEGLHHGLLPLLDVVLEQPIGEKFI
FT                   TLALNNTDARVRAGKPVSPGFLFATLLWHDVQQRWQKFEANGEYPVPALHRAMDEVLDM
FT                   QTEKLAIHKRFSSDMREIWGLQLRLEKRSGRSAVKLLEHQRFRAGYDFLLLRCESGELD
FT                   ESVGAWWTEFIEGDVAARETLLTQGGKDRSPRKRRRRSSGARNRKPGDGLEGGTPAERT
FT                   ADEAGHDGPRED"
FT   gene            complement(574477..575163)
FT                   /locus_tag="Bxe_A3954"
FT   CDS             complement(574477..575163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3954"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   hypothetical 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3954"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29045"
FT                   /db_xref="GOA:Q145E4"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E4"
FT                   /protein_id="ABE29045.1"
FT                   /translation="MANLALFDLDHTLIPTDSDHEWGRFMVKHGMVDAENFARENDRFF
FT                   ADYKAGKLDIHAYLIAMLTPLSRYTRAQLADFHAQYMHEVIKPAIFPAALELVKQHREA
FT                   GDLCCVVTATNEFITRPIAQAFGVDTLIACEAETVDGEPHSPYTGRPTGTPSYKEGKIV
FT                   RTEAWLASLGKTWSDFEHSYFYSDSHNDIPLLEKVTDPIATNPDDTLRAHAQAKGWRIL
FT                   ELFQPS"
FT   gene            complement(575156..575926)
FT                   /locus_tag="Bxe_A3953"
FT   CDS             complement(575156..575926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3953"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3953"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29046"
FT                   /db_xref="GOA:Q145E3"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E3"
FT                   /protein_id="ABE29046.1"
FT                   /translation="MLRQLTLDLGTPPPSTFDNFFAGANAELVTRLRELDNALAAGPVA
FT                   DRTFYIWGESGSGRTHLLQALVHEAPPGHARFAGPQSSLAAFGFDPRVALYAIDDCDAL
FT                   SAAQQIAVFNLFNEVRAHPTSALVAAGNAPPIGMTVREDLRTRLGWGLVFHLAPLPDED
FT                   KAAVLKHAARERGIMLADDVPAYLLTHFRRDMPSLMALLDALDRFSLEQKRAVTLPLLR
FT                   TMLASPDAEERRAAPGSAASSASPAASSKIGPHG"
FT   gene            complement(576000..577151)
FT                   /locus_tag="Bxe_A3952"
FT   CDS             complement(576000..577151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3952"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3952"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29047"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E2"
FT                   /protein_id="ABE29047.1"
FT                   /translation="MRFYPMPAHWLEFESSGPDDTWETTLQENSSILTPVQRRAFTWLA
FT                   IALGIGILLWLLSPVLTPFLLGAILAYILQPGVAWMVRRRVPRGLAALVMMLFFTLLMT
FT                   LLVLLVLAVVQKEGPQLRQQVPVLFAHANAWLQPKLALLGLADSLDFASIRDMVMGQLE
FT                   GSAQTVALYAWTSIRTSGNVMITVVGNVVMVPLVLFYLLYDWNRMLARMQTVVPRRWLD
FT                   KTLQLAHDMDQMLSQYLRGQLLVMGVLAAYYAIALSLARFEIALPVGIFTGLAVFIPYI
FT                   GFATGLALALLAALLQFGDWYGFGAVALIYGVGQILESFFLTPRLVGERIGLHPLAVIF
FT                   ALLAFGQLFGFFGVLLALPVSAILSVATRELRQSYLASSLYKN"
FT   gene            577235..578653
FT                   /locus_tag="Bxe_A3951"
FT   CDS             577235..578653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3951"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29048"
FT                   /db_xref="GOA:Q145E1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E1"
FT                   /protein_id="ABE29048.1"
FT                   /translation="MSTINTQHNPSFYSGKTATRSHYRLTTNRHGTYTLRLVVPKSLQS
FT                   LIQTKELKKSLRTRDFQKARMLAGHLSYQFDLMLATLMKKKLSDFNLDVINNIHKDLSV
FT                   TFNNVQYDFDINNEFERAEYLDLKARIEKHHADVGEVQKNVVVESSATQNSDKKYQSNF
FT                   KFVEVKDAFVKERMIKAGGKMTKSIDIYMASINEFWNKILSGTNPPITAINKLNARSFK
FT                   EHLIGTGITAQTVDNKVAHLQAFFTFIIKNYDYPFNNPFEGLKILNRAELKKVTNSFKP
FT                   FTMDELKIIFDVERYRAYYKKNIQLYFVPLIQLYSSMRVEEASQLHLDDIRQENGIYYF
FT                   NLNDDEDKSLKTINAFRNIPVHSKLIEIGLIKYYEERKKLGKRTLFDNQGEYVTTEFGA
FT                   YLKKLEIKKTARVHGTHSLRQNFNNALIDKDVISDVRCRLCGHELVGTNATVYGKDYKV
FT                   EELKRYIELVQFPI"
FT   gene            578807..579451
FT                   /locus_tag="Bxe_A3950"
FT   CDS             578807..579451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3950"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29049"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E0"
FT                   /protein_id="ABE29049.1"
FT                   /translation="MKNLLRYGCELIQEASDDESGINTNYKKLESLIKENPHLIASYDI
FT                   QTKNSLLFTAIQEESIEFVKLIKFYAEDKDLTAVVDNGSSPLSDVAMRNMIHNLDRFGQ
FT                   DAIETDNSLQIFKSVGELGGRLSKGLVLELEQDIAGANSLIKNAVEYDSVLKEKDALFS
FT                   KASTAKEKGFYNKLKQKIENFRVHLLALKDSADSDGPDALKNQKKGRKDKV"
FT   gene            579499..579873
FT                   /locus_tag="Bxe_A3949"
FT   CDS             579499..579873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3949"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3949"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29050"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D9"
FT                   /protein_id="ABE29050.1"
FT                   /translation="MLSIVDEILTQYDALGLFINFQISKINLEMSKILQLMAEGKTPQQ
FT                   VTIKVGGTYPNHVFLVMYLVDGRLEAEEVSEALCDELASKISGINQEEFLAYKLTKVKT
FT                   KALKMRKDAEDKPPTGNEPK"
FT   gene            complement(579985..580206)
FT                   /locus_tag="Bxe_A3948"
FT   CDS             complement(579985..580206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3948"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3948"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29051"
FT                   /db_xref="GOA:Q145D8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D8"
FT                   /protein_id="ABE29051.1"
FT                   /translation="MMLYGQRYERVRKVLKSVRVSANLTQIELAQKLSKGQSYVSKLER
FT                   GEQFVELLEFIEWCEACGIAPQTVIGEI"
FT   gene            580474..580920
FT                   /locus_tag="Bxe_A3947"
FT   CDS             580474..580920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3947"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3947"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29052"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D7"
FT                   /protein_id="ABE29052.1"
FT                   /translation="MLEHFHYSAADNFRDQLTNIKTAHENLQAQKDDYIRQLEAQARQI
FT                   ISERDQTIAKQSGQINEKNELINNNQETIHDLVKRNIQLQEAMKQQQALMEEFLARQKA
FT                   FQALAIKYGHKLNLSSDEKKENYEMAKKQVIEGVEPTNVQIKNI"
FT   gene            complement(580959..583877)
FT                   /locus_tag="Bxe_A3946"
FT   CDS             complement(580959..583877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3946"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3946"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29053"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D6"
FT                   /protein_id="ABE29053.1"
FT                   /translation="MIKTIINKKSLFAFSIFILTIFCSTSAFALDLNNLTDLFTVPSGD
FT                   VSASILKSLFGALPSLGGAGTDAFQQPIATFNQLVLIVGGVLAAYGILTGTVMTAHEGE
FT                   VAGRSIHSVWYPIRTAIGSALILPVFNGYCTIQVLVMWCVLQGVGLADAVWATFTSSSN
FT                   LSNMVSVSYNGPDVNKLAHDIVKAEMCMAAINTFYNSPAEQGGNPNLLPQAGINMAVTP
FT                   VTSTDSAPADMFNGAPASSITSTIYKFGNSTGAGGISVDYCGTVTVTPMTIASATANTS
FT                   STSQSLAWSIGATGPYTQQNINNINQAQSQAIQTMISDAQSLVSTTAQTIYSDSKNGIS
FT                   LTGSDIQSFNSSIDTMIGHYNQTVHAAAANAMNSAVSFSDISAEAQQDGWALAGAWFMK
FT                   FMYLQDRTQQAIANVPTSSAINSIPSDMMGDLGSIYMSGLNILASNSSVSGDYGITDDA
FT                   NKQSFVKDGDMGAAVTRLVGKALNFSINDNDNPVMTVKRLGDWMITVAGALATVKIATT
FT                   AGVVGKVLSFVGISDLITIVLSPIIMFLICLGFISSYIIPVMPFIMWFGIVTAYIILCV
FT                   EAVIAAPLWCVMLLNPQANGLLGEQKRGLQMVLNLMLRPTVMIFGLAASIILIQVMGTL
FT                   LNHIFSSVWVMSQSSSNILVAILGAGAGVLVYDVMAFLLIKKLFGAITQIPDQLFNWIG
FT                   GSPVGLESASSKLTAGMMQLNTHIGSAANQLRNIGGGAMARAIPNTTQTPPNLLSSSTT
FT                   QQKTEGSSNSGSTLSAMENSQNDSKTDETLGGMAEHSPNLAEAFSESGVMSNIGNSQER
FT                   KDSAIGFNSMVDQAHSMLGGSQSQASQAYSENLAEAIKANPFMNKGQMAHQSNSALVSS
FT                   MDHAYGSGATAITSAIATKQDGSISRTQVGNTAQTYKSLMGAMNNAGVDSSSQAAMLGT
FT                   MNSKTLEASQVDTNTSMSQHLQNHATQVIAGLGTSNSDENVE"
FT   gene            584206..584613
FT                   /locus_tag="Bxe_A3945"
FT   CDS             584206..584613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3945"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29054"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D5"
FT                   /protein_id="ABE29054.1"
FT                   /translation="MWILCASPPPTYMLNMEDLDKDVQDYFNHLIKIGFFTSTIEKDNS
FT                   LPGPVWYKFHFSQFVIDNLDVGEKKFIEFNEESIKILTDDCEFVPKLCFMRDLGEGEIY
FT                   AVFSELNNIRNQKNHFENLIGEAKPAKKDRF"
FT   gene            585227..586225
FT                   /locus_tag="Bxe_A3944"
FT   CDS             585227..586225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3944"
FT                   /product="Putative replicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3944"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29055"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D4"
FT                   /protein_id="ABE29055.1"
FT                   /translation="MANQVLDTFNEHLLNKTYSTNSFEEGLKVRKKQDAISYNYVGLNK
FT                   PLTKYIALDLDKGVESTYMFEKKNLPVPTLIVINRETGNCHYLYGLKKPVSFYKNSRLR
FT                   PQSYLKQTTLALTHELEADIAYAHTIVKNPNSKYWKILENDVYYDLEDFEEYLDINKFD
FT                   AKQSVVFDVAVGGRNVALFDNLRFWAYKEINIVDYLSYEAWLDSVSAKATQLNNYEAPL
FT                   DLKEVGHTAKSVAKWVWRNQDRVKGGVNRGVMSHLGLINDGMSLEQKQSASALFTNDSR
FT                   KSGTRGKITTAIIKLKCNGAKITQESISITSDVSVRTIRKYWDEFLPMINE"
FT   gene            complement(586495..586743)
FT                   /locus_tag="Bxe_A3943"
FT   CDS             complement(586495..586743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3943"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3943"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29056"
FT                   /db_xref="GOA:Q145D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D3"
FT                   /protein_id="ABE29056.1"
FT                   /translation="MGIDESFTILIVKCETQNACNFSRCMCSASLNQGYRMNKNKGIAV
FT                   VLALLLCASISHKRGVDVQVLHMTKETRTEAKLKAEF"
FT   gene            complement(586814..587203)
FT                   /locus_tag="Bxe_A3942"
FT   CDS             complement(586814..587203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3942"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3942"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29057"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D2"
FT                   /protein_id="ABE29057.1"
FT                   /translation="MNNTDIKENKFLKSANFLGELKKIGLIEDFIFAGSFLSKIQNARV
FT                   ELSYDFLRMSLQNDMAEEYPDGHYMSTFEYYITDIDNFLMCMNDNFLGFVNDREIENYY
FT                   NVLLERYNLDQALEESTESLKPNKI"
FT   gene            587322..587639
FT                   /locus_tag="Bxe_A3941"
FT   CDS             587322..587639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3941"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29058"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D1"
FT                   /protein_id="ABE29058.1"
FT                   /translation="MSDDFHVENGRKGGEARAKKFWPKIKHSIILFIRFPELNQDEIAK
FT                   RVGASQAFVSKHTSYNALKIARLSAQSDSMSEDELEALLEKIKLEVELKNEIVKPKRSK
FT                   L"
FT   gene            complement(587841..588134)
FT                   /locus_tag="Bxe_A3940"
FT   CDS             complement(587841..588134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3940"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29059"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D0"
FT                   /protein_id="ABE29059.1"
FT                   /translation="MSLNCDIFDAYKSIIPKNMNPTTFTAELVRQFLAENFSKITHKPT
FT                   LVSREDFDDFIHGIVTHSELNELAKAHELRKQIDTTKEKLALLKKHETVGQA"
FT   gene            588653..589348
FT                   /locus_tag="Bxe_A3939"
FT   CDS             588653..589348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3939"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3939"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29060"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C9"
FT                   /protein_id="ABE29060.1"
FT                   /translation="MAKTNKYKYVLNIQVDEPIYKKILARFEEENDENFSAFVRRIATK
FT                   KISLDVEVYEKVTASLNEIGRQINSIVKDLHEKTEVTFITLEEFKIKKQELEVLLVFLD
FT                   EWVNRRNKMVDFDFDGSEKIDRPAVKKRIYVMLSEQENHALMESMEKLCFNKKADFVRC
FT                   LLSNSRSLYVPRWKAIFYAEIRIKNNLSQVKRHINEANLLHMSLLHEVSDIAKTLKQLR
FT                   KNFDKGVEI"
FT   gene            589351..590610
FT                   /locus_tag="Bxe_A3938"
FT   CDS             589351..590610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3938"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3938"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29061"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C8"
FT                   /protein_id="ABE29061.1"
FT                   /translation="MLANCFDSGTSGGDAPVRYLLGNKDHKGSERSVKPKLFRGDPEST
FT                   KDLIDSINNKQKYTSGVLAFRENEVPSVKQMHQICDEFERYMFGGLSKDRVNILWVLHN
FT                   DKGRPELHFVVPKIDLKSGKQLNISPPGKQNQDYYRLFGAYINDKFGWEQVSPKKKWDL
FT                   KAAEYKSETVPALYKRALCKQINNNYETGMFKDRNDLIKWLEQNKIQVLKQADDFITIG
FT                   VGGNKLRMYGEIFKQNPDMSVGKPYVFNQHEKNRLEHYRVERVAYFDKRFNTPPKPRFT
FT                   ASPQGKTTVKPQVFQTVADRIKEREVASMVQNMASIGGDVADVMPKEQKPSSGVSSGGG
FT                   SSGGADTSLQKVALSLRRNDILRQLIDATPSQVAELQNELTNIDIALGRLKLQEMEEAG
FT                   REMDKLYELYKKPQIDEAPT"
FT   gene            591123..591590
FT                   /locus_tag="Bxe_A3937"
FT   CDS             591123..591590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3937"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3937"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29062"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C7"
FT                   /protein_id="ABE29062.1"
FT                   /translation="MGNRMAEDKQLGAQLDELLKKVASGKATPTEKIKLSTLLNESAKV
FT                   EAQQEKQEKIDKVLALIDELELSRSEVAEALNGPAEVLIRYVDDTGQVHERYDGETATN
FT                   KWLKALKEAGTHNFAQAKELIVAKSADGKAKATKTLDRLYHPEKYAKPAKA"
FT   gene            591828..592895
FT                   /locus_tag="Bxe_A3936"
FT   CDS             591828..592895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3936"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3936"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29063"
FT                   /db_xref="GOA:Q145C6"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145C6"
FT                   /protein_id="ABE29063.1"
FT                   /translation="MNQPKSAPNSTDSAQGLSYRDAGVDIDAGDALVDAIKPFARKTMR
FT                   DGVLGGIGGFGALFEVPKKYKEPVLVSGTDGVGTKLRLAFQLNKHDTVGQDLVAMSVND
FT                   ILVQGAEPLFFLDYFACGKLDVGTAATVVKGIAYGCELSGCALIGGETAEMPGMYPDGE
FT                   YDLAGFAVGAVEKSKIIDGSTIAPGDVVLGLASSGIHSNGFSLVRKIIERAQPDLNADF
FT                   DGRSLADALMAPTHIYVKPLLALMQQIAVKGMAHITGGGLVENIPRVLREGLTAELDHR
FT                   GWPLPPLFSWLQKHGGVADAEMHRVFNCGIGMAVVVSAADADAAIGLLSAAGEQVWKIG
FT                   VIRESAAGEAQTVVI"
FT   gene            complement(592983..593930)
FT                   /locus_tag="Bxe_A3935"
FT   CDS             complement(592983..593930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3935"
FT                   /product="tRNA isopentenyltransferase"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3935"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29064"
FT                   /db_xref="GOA:Q145C5"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145C5"
FT                   /protein_id="ABE29064.1"
FT                   /translation="MTSRTPTTVPCLLGPTASGKTAAALALAARHPVEIISVDSALVYR
FT                   EMDIGTAKPTAEERAVAPHHLIDIVDPTDSYSAAQFRADTLRLTGEIHARGRLPLLVGG
FT                   TMLYYKALTQGLNDLPAADADLRATLDADAAREGWPAMHARLAAVDPVTAARLAPNDSQ
FT                   RIQRALEVFMLTGQAMSALLAAPARVDDAAAAWRFVPVALEPSDRGVLHARIEKRFDAM
FT                   LANGFVDEVVKLRERGDLSPEMPSMRCVGYRQVWEYLDGAVDYSTMRDKGVFATRQLCK
FT                   RQLTWLRSMTERVVVDCCDPHATARVLEAIEALL"
FT   gene            complement(593976..596042)
FT                   /locus_tag="Bxe_A3934"
FT   CDS             complement(593976..596042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3934"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3934"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29065"
FT                   /db_xref="GOA:Q145C4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C4"
FT                   /protein_id="ABE29065.1"
FT                   /translation="MSEFSETPAGLDTAAAPAVSAATPAPRPLRAIQPLPDQLISQIAA
FT                   GEVVERPASVVKELLENALDAGAQSLRILLDEGGVKRISITDDGCGIPENELALALMRH
FT                   ATSKIRSLAELEAVATLGFRGEALASIASVAQMTITSRTADAAHAVRVDAQTGVLSPAA
FT                   GTQGTTIEVRELYFNTPARRKFLKSEQTELGHCLEQIRRAALARPDVAISVLHNGKAVE
FT                   HWNASEPPVRVAKILGDTFATAHLPLDESAGPLAVYGCAGLPTASRGRADQQYFFVNGR
FT                   FVRDKLLTHAVRAAYEDVLHGERYPSYVLFLDLPPEAVDVNVHPSKIEVRFRDSRSIHQ
FT                   FVFHAVQRALARHAGASPETTAGGHAAHLAPSVSGPASFGATPLGGAGVGGVGFGAGNG
FT                   AGGIGGGLGGASGGGFGSSSQQPGNTWMRQARMTQGTLPVAQPLAFYDALFGRKDTNAG
FT                   TAEGATLFEARDSAAEAPSPYNASAPYPAPAFHAADEQPLGFALGQIHGIYVLAQNAHG
FT                   LVIVDMHAAHERILYEQFKNALADRTIAVQPLLIPQSMQADPVEIGTVEEERDTLDALG
FT                   FDLAVLSPTTLAIRAVPALLKDADLQALARAVLSDLHAFGGSRVLTERQHELLGTLACH
FT                   HAVRANRRLTLDEMNALLRQMEATERADQCNHGRPTWYQLTLSDLDRLFMRGQ"
FT   gene            596249..596920
FT                   /locus_tag="Bxe_A3933"
FT   CDS             596249..596920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3933"
FT                   /product="Putative DedA family transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3933"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29066"
FT                   /db_xref="GOA:Q145C3"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C3"
FT                   /protein_id="ABE29066.1"
FT                   /translation="MDTLLHFVNLVLHIDKFLGDFIHVYGAWVYAVLFLIVFCETGLVV
FT                   LPFLPGDSLLFIGGAFCATGEMNIGLLIVLLLVAAISGNTVNYMIGRAIGPRVFNSHIP
FT                   FLERFLDRSALQKTHNFYEKHGGKTIVLARFIPVVRTFAPFVAGASEMTVSRFQLFNFV
FT                   GALFWVLLLTLLGYFFGNIPFIRQYLNVIVLVGIGAAVVPVVLGALWKMMRKNASSAGS
FT                   R"
FT   gene            complement(597074..597886)
FT                   /locus_tag="Bxe_A3932"
FT   CDS             complement(597074..597886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3932"
FT                   /product="Small Conductance Mechanosensitive Ion Channel,
FT                   (MscS) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3932"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29067"
FT                   /db_xref="GOA:Q145C2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C2"
FT                   /protein_id="ABE29067.1"
FT                   /translation="MDLETVRVFIMTRGIDLGTKVVGAIVLWIVGRWLIGMITGLLRKM
FT                   LSRNGRVDPTLAHYLGSILGALLNLLLILAILQVFGVQTTSFAALLAGLGLAIGTAWGG
FT                   LLAHFAAGVFMQVLRPFKVGDFVTAGGVTGTVSELGLFGTTIVTPDNVTTIVGNNKIFS
FT                   DTISNYSILPVRRVELTAKIANGVDPTDAMNRLKAAVTQIPNVAESPAPDIEVLGFTPE
FT                   GPLLCVRPYTHNANYWQVYFDTNRAIIQTFKEAGYPTPETPLAPRAVT"
FT   gene            complement(598109..598483)
FT                   /locus_tag="Bxe_A3931"
FT   CDS             complement(598109..598483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3931"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29068"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C1"
FT                   /protein_id="ABE29068.1"
FT                   /translation="MINFLFDLFSNLALLAFVLAACHLCNRRIPGASLDGSLIFAALAC
FT                   IAFMLDAALTFLVFADSQNRYGHLSTSTAFFERACAYWLAIIAALALRRAARRSRPAKV
FT                   GRGEALVIHTSPYSKSHLPM"
FT   gene            complement(598762..600561)
FT                   /locus_tag="Bxe_A3930"
FT   CDS             complement(598762..600561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3930"
FT                   /product="Putative voltage-gated chloride channel with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3930"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29069"
FT                   /db_xref="GOA:Q145C0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q145C0"
FT                   /protein_id="ABE29069.1"
FT                   /translation="MTADTHKRDFAENRRLPGIALLAAGIGVISTLAAFVLLNLIHLFT
FT                   NLFFFGGLSFAERSPAQNTLGAWVVLVPVAGGLIVGLMARFGSEKIRGHGIPEAIEAIL
FT                   FGKSRMSPKVAILKPLSSGIVIGSGGPFGAEGPIIMTGGALGSLIAQCVRVSAAERKTL
FT                   LVAGAAAGMTAVFGTPVAAVLLAVELLLFEWRPRSFLPVALACAVAGFARGALFGAGPL
FT                   FPLETAPPGALSLFTCVIAGLLSGALAAGLSAALYKTEDLFGKLRIHWMWWPALGGLVV
FT                   GIGGFIEPRALGVGYDVIGDLLHLHLALEIALALLLVKAVMWVVALGSGTSGGVLAPLL
FT                   MLGAGLGVVLSHLMPGGDPALWPLVCMAATLGATLGAPLTAIVFAFGLTNDSNALLPLL
FT                   AATLVAHGFATVVMRRSIMTEKIARRGYHIYREYGVDPLERHYVDEVMTRDVETIDAHS
FT                   TVDETLTRYFGPGQTHRAYPVIVDGAVTGVIDRAALERIPRTRDRQPGATTLLELMETR
FT                   APVVALPGETCRLVATRLAVHGLERMPVVSDMNTLRIVGIVARSDLVKPSLAHFDEEHK
FT                   KERFRRLGTRAAKRRLSPLRRSG"
FT   gene            complement(600610..601023)
FT                   /locus_tag="Bxe_A3929"
FT   CDS             complement(600610..601023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3929"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3929"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29070"
FT                   /db_xref="GOA:Q145B9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B9"
FT                   /protein_id="ABE29070.1"
FT                   /translation="MKTQRRELEKSDFEQLSEFRYQMRRFERFSEQAAQTEGITPLQYL
FT                   LLLHIKGYPQRDWATIGELAERLQAQHHGIVALVSRCEALGLVKRKVSETDRRQVEVHL
FT                   QKLGEKTLAKLAALHRAELKSLEGAFNVPQIDL"
FT   gene            complement(601109..602272)
FT                   /locus_tag="Bxe_A3928"
FT   CDS             complement(601109..602272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3928"
FT                   /product="CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3928"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29071"
FT                   /db_xref="GOA:Q145B8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B8"
FT                   /protein_id="ABE29071.1"
FT                   /translation="MPRSAVARWLARLAPPPIALAWKERLRSCVGALVGIAFTGAITHL
FT                   LLGSSGNIPLLVAPMGASAVLLFAVPASPLAQPWSIIGGNLVSATVGVACASWIGDPLQ
FT                   AAPLAVAAAICAMFALRCVHPPSGAVALTAVLGGPAVHSLGYRFVLAPIALQSAALLCA
FT                   AIVYHALTGHRYPHSARQTTSRSDPAARSRPGFTRADLDAVLKGQSELLDIAPDDLESL
FT                   LRALQLQTYARSFDELTCASIMSRGVITVSAHTRAATAWSILQRHGVKALPVTNEERHV
FT                   VGIVTRADLGGVRQPGALTRLLRRLPGRRRANEPTVGTLMTTHVHTVDTTTPIADLVPL
FT                   FADFGHHHIPVLDSRTRQLAGMVTQANLIAGLYRQPNTSMQASQRTA"
FT   gene            602624..603352
FT                   /locus_tag="Bxe_A3927"
FT   CDS             602624..603352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3927"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3927"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29072"
FT                   /db_xref="GOA:Q145B7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B7"
FT                   /protein_id="ABE29072.1"
FT                   /translation="MKDDVSAPSRYRPSIFAVPFQRHGDGTAVELLSPSEQDALIAISR
FT                   LVTVRRHTVLYPEGGDARFAYNIVSGVAETYQLLPNGDKRITAFLFPRDLMGLSENGAY
FT                   VATAQSLTPLVAYRIPVEALAEILERDPRLDIGLLCKLCHELRRSQHHTITVSKNEAPA
FT                   RLASFLVWIQHAYPEEGRAEGEVMLPMSRHDIADYLGLSVESVSRGLHVLEAQDAVRRK
FT                   GPRLVTVLDPAKLRRLAGQD"
FT   gene            complement(603411..604415)
FT                   /pseudo
FT                   /locus_tag="Bxe_A3926"
FT   gene            complement(604115..604717)
FT                   /pseudo
FT                   /locus_tag="Bxe_A3925"
FT   gene            complement(605011..606102)
FT                   /locus_tag="Bxe_A3924"
FT   CDS             complement(605011..606102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3924"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3924"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29073"
FT                   /db_xref="GOA:Q145B6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B6"
FT                   /protein_id="ABE29073.1"
FT                   /translation="MREAPIHTEESFRLLVEAIDDYAIFMLDASGNVVNWNTGARKMKG
FT                   YEVDEIIGRHFSVFYTPEDVAAGQPGLLLAAAVAQGRVVSEGWRVRKDGSKFWANVVIT
FT                   TVRTPTGELRGFAKVTQDLTERKRLEEFEQLRALAAHIQAAREEEQIRIARELHDDIGQ
FT                   QLTALKMALAGLDSIVRDQEAGAARTAPHIADMHQLIDATVASLRRIAAGLRPVMLETL
FT                   GLIPTLEWLIDDFMQRYDIAVEARIEADDMKLSEAADEGLFHIVQEALTNVARHAHADR
FT                   VTIDLARDGRTCVLRVTDDGQGMTPAAPSRPTSFGLLGMRERVHHLNGTMSIDSAPGRG
FT                   FRLTLIFPLDAVERKPSSPEGAA"
FT   gene            606316..606564
FT                   /locus_tag="Bxe_A3923"
FT   CDS             606316..606564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3923"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3923"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29074"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B5"
FT                   /protein_id="ABE29074.1"
FT                   /translation="MTSWGRGLAVWWLLAQPVLSRPFNRDPLIRNLNRSGRRRVRGRSR
FT                   CDPVRCGETLGKSWRAIGSCGYREHGAALKKKKGLRR"
FT   gene            complement(606588..606663)
FT                   /locus_tag="Bxe_AR0021"
FT                   /note="tRNA-Lys1"
FT   tRNA            complement(606588..606663)
FT                   /locus_tag="Bxe_AR0021"
FT                   /product="tRNA-Lys"
FT   gene            complement(606847..607596)
FT                   /locus_tag="Bxe_A3922"
FT   CDS             complement(606847..607596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3922"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3922"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29075"
FT                   /db_xref="GOA:Q145B4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B4"
FT                   /protein_id="ABE29075.1"
FT                   /translation="MTHRFSWLRFAAAACVAGTAFAAVPAHAGIFDDDQARQAILDLRS
FT                   KTDSLSGQLSAAQRTILDQSNRLDQLNQQVATLRGQNEDLGNQLATLQKQQKDYYTDLD
FT                   TRLKKFEPQQQTVDGVQGEVQPGETESFNAASQQFRNGDFKNAAASFRTFISRFPNSPY
FT                   QPTAQYWLGNALYALRDYKGSTAIWQGVVKNYPQHPRAPEALLAIANNQLEQGQKAAAR
FT                   KTLEQIVAQYSGSDVAQSAQSKLSQIK"
FT   gene            complement(607616..608125)
FT                   /locus_tag="Bxe_A3921"
FT   CDS             complement(607616..608125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3921"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3921"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29076"
FT                   /db_xref="GOA:Q145B3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B3"
FT                   /protein_id="ABE29076.1"
FT                   /translation="MMSKLRFAFAVLMVGALAACHSGVKLDENANKGGSVSAQPNPNDV
FT                   ATVNVDPLNDPNSPLAKRSIYFDFDSYSVKDDYQSLLQQHAQYLKSHPQRHVLIQGNTD
FT                   ERGTSEYNLALGQKRAEAVRRSLSLMGVTDSQMEAVSLGKEKPQATGHDESSWAQNRRA
FT                   DLVYQQ"
FT   gene            complement(608158..609450)
FT                   /locus_tag="Bxe_A3920"
FT   CDS             complement(608158..609450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3920"
FT                   /product="Putative periplasmic TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3920"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29077"
FT                   /db_xref="GOA:Q145B2"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145B2"
FT                   /protein_id="ABE29077.1"
FT                   /translation="MSLMTKLGLRTLVASCLIAVGGAANAQLNVLVTGVGSTQFPIATA
FT                   NFANEANSPQQVSTIVRQDLQRSGKFTNIDAGATPVSETDSVDLGSWKAKGANAFVSGS
FT                   VNRLPNGQYEVRFKLYDTVKGESLGGLVLVSPESGLRMSAHKVADYIYAKLMGGRGVFA
FT                   TRLSYVIKTGGRYQLQISDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIV
FT                   YIHDLPTGRRIVVSDQKGNNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQ
FT                   GSSIDTEPCFSPDGQSIYFTSDRGGQPQIYKMSAQGENAGAAQRVTFTGSYNTSPRVSP
FT                   DGKQLAYISRVGGGFKLYIQDLQGNTATGLTDTTHDESPSFAANGQYILYATQVNGRGV
FT                   LAAVSTDGRTRQVLSVQGGSVREPSWGPFMQ"
FT   gene            complement(609589..610632)
FT                   /locus_tag="Bxe_A3919"
FT   CDS             complement(609589..610632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3919"
FT                   /product="Cell division and transport-associated protein
FT                   TolA"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3919"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29078"
FT                   /db_xref="GOA:Q145B1"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B1"
FT                   /protein_id="ABE29078.1"
FT                   /translation="MIRKNSEYPLQPPRERGTGRAFVFALVMHALLGFFLYHGIQWQNS
FT                   TPEGAEAELWTEVPDTSIPRPVPPPVPVPVAPAPPMRDEQADIALQEKKRQQQEAAREA
FT                   QLAEQQRQQKLQAQQEAEAKRQQQLAADQAAQKAAAARQKQLQLQQQQQQQQQQQEASK
FT                   LKQQQLAEQQKQQQLKEQQQEQQQKQAEAEAQKKADAQKAAKAKAQADAAAQAKKLDAE
FT                   RRARLAQMQGLAATGTGSTTSDGLGKSGTGSGSGGTATSPGYSDKVRRAVRPNITWGGE
FT                   TSGLETVVSVRCSPTGTLLGATISRSSGNPAWDDAALRAVQRTDPMPQDINGKTPTSFL
FT                   ITLRPAG"
FT   gene            complement(610629..611075)
FT                   /locus_tag="Bxe_A3918"
FT   CDS             complement(610629..611075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3918"
FT                   /product="Cell division and transport-associated protein
FT                   TolR"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3918"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29079"
FT                   /db_xref="GOA:Q145B0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:Q145B0"
FT                   /protein_id="ABE29079.1"
FT                   /translation="MAGSRSSSMRGSRSRRAMADINVVPYIDVMLVLLVIFMVTAPLVA
FT                   PSIVNLPTVGGAAPQQQTPPVIVNIRADGNMSVKYKDDSGAQQQEDMTKADLNSFIAER
FT                   AQSHPDQPVVIAADKTVKYEVVMNVMSELKARGVKRVGLLVKSQ"
FT   gene            complement(611086..611763)
FT                   /locus_tag="Bxe_A3917"
FT   CDS             complement(611086..611763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3917"
FT                   /product="Cell division and transport-associated protein
FT                   TolQ"
FT                   /note="TC 2.C.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3917"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29080"
FT                   /db_xref="GOA:Q145A9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A9"
FT                   /protein_id="ABE29080.1"
FT                   /translation="MNTTQDLSIVSLVLNASLLAQAVMALLLLLSLLSWTFIFRKWFAI
FT                   RRARTQTERFERDFWSGGDLQALYQSAANNRHTIGALERIFESGMREFLKGKEKRLNDP
FT                   SAILDGARRAMRAAFQREMDVLEANLAFLASVGSVSPYIGLFGTVWGIMNAFRGLANVQ
FT                   QATLANVAPGIAEALTATAIGLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQR
FT                   QAQ"
FT   gene            complement(611920..612399)
FT                   /locus_tag="Bxe_A3916"
FT   CDS             complement(611920..612399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3916"
FT                   /product="4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3916"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29081"
FT                   /db_xref="GOA:Q145A8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A8"
FT                   /protein_id="ABE29081.1"
FT                   /translation="MHRMNISTSQPSAEIGYTWPIRVYYEDTDAGGIVFYANYLKFFER
FT                   ARTEWLRACGVDQNRLAEETGAIFIVRSTAVDYRAPARLDDVVSVVCRIERLGRASVDF
FT                   AQEAWREGTLLATGSIRVGCVDRIALRPAAIPPPVLAALRRGPGASASGVSTDND"
FT   gene            complement(612457..613203)
FT                   /locus_tag="Bxe_A3915"
FT   CDS             complement(612457..613203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3915"
FT                   /product="Putative short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3915"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29082"
FT                   /db_xref="GOA:Q145A7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A7"
FT                   /protein_id="ABE29082.1"
FT                   /translation="MIVFVTGASAGFGAAIARAFVKGGHRVVAAARRKDRLQALADELG
FT                   DALLPYELDVRDRAAVEAVPAALPADFAAIDVLVNNAGLAPDMEPAQKASLDAWTAMIE
FT                   TNCTGLVQVTHTLLPGMVERNRGHIFNLGSSAANWPYAGGNVYGATKAFVRQFSLNLRA
FT                   DLAGSALRVTDIEPGLCGGTEFSNVRFCGKDASAARMVENVQPLTPEDIADSIYWIATR
FT                   PAHVNINTIELMPVAQSFAGLTVYRG"
FT   gene            613720..614967
FT                   /locus_tag="Bxe_A3914"
FT   CDS             613720..614967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3914"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3914"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29083"
FT                   /db_xref="GOA:Q145A6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A6"
FT                   /protein_id="ABE29083.1"
FT                   /translation="MFDRAQSTIANVDPELWKVIEQENRRQEEHIELIASENYTSPAVM
FT                   AAQGSQLTNKYAEGYPGKRYYGGCEYVDIAEQLAIDRVKQLFGAEAANVQPNSGSQANQ
FT                   GVFFAVLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNEAEDIDYEAAEKLA
FT                   QEHKPKLIVAGASAFSLRIDFERMSKIARSVGAYFMVDMAHYAGLIAAGVYPNPVPHAD
FT                   FVTTTTHKSLRGPRGGVILMKAEFEKQINSAIFPGIQGGPLMHVIAGKAVAFKEALSPE
FT                   FKAYQQQVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKKITGKAAEAALGTAHI
FT                   TVNKNAIPNDPEKPFVTSGVRLGSPAMTTRGFGVKEAEQVGNLIADVLDNPEDAATIER
FT                   VRAQVAELTQRFPVYR"
FT   gene            614974..615456
FT                   /locus_tag="Bxe_A3913"
FT   CDS             614974..615456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3913"
FT                   /product="Protein of unknown function DUF193"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3913"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29084"
FT                   /db_xref="GOA:Q145A5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145A5"
FT                   /protein_id="ABE29084.1"
FT                   /translation="MHCPFCRHADTQVVDSRVSEDGATIRRRRRCPACDKRFTTYERVE
FT                   LALPSVVKKDGSRTEFDRRKIVASMQLALRKRPVAADAIEAAVARIEYQLLGSGEREVR
FT                   SERLGELVMNELRALDTIAYVRFASVYRRFEDVSEFEDVIEEFRRASSPPKPSRKR"
FT   gene            615670..616230
FT                   /locus_tag="Bxe_A3912"
FT   CDS             615670..616230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3912"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3912"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29085"
FT                   /db_xref="GOA:Q145A4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A4"
FT                   /protein_id="ABE29085.1"
FT                   /translation="MKWNAVGWPRCRGFTLVETLAVVALLAVIAVMSTPSFVAWYVRDQ
FT                   VDARAKALVATLAYARSEALRQGARVTVCRTDGARHCLAAGQPCGNGIADWSCGWAVLA
FT                   ERGGALSLLRAQPLLAAVSIAGTQTNLTFTPPAGQLIGTFRSFDIAPRAPSRATQGARW
FT                   RRCIRIAAGGRARITEGACGAAS"
FT   gene            616670..617479
FT                   /locus_tag="Bxe_A3911"
FT   CDS             616670..617479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3911"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3911"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29086"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A3"
FT                   /protein_id="ABE29086.1"
FT                   /translation="MMRRSNPACGHTLVEFAIAMALGLLVTAGAVSLYTTQRSAFEHAS
FT                   DAMRIREAGLIALTLIGQPLQMAGFVPADVSRYNSPAPLFGCSGGRPTGADDSLACENL
FT                   PSHSDGVAVRYVGDNVSTWPSASGQTTDCLGQAVTGGGAALGDRGVPVVNRFFARVSAS
FT                   TGEPELYCEGNGKTGSAQPLVEGVERVRIRYWLAGAPAAIDASAVMADQWAKVVAVDLC
FT                   VLVRGAPQGQRSRYVDCDGVSALAADSRPRQAFSRRVALRNHTEDSK"
FT   gene            617644..618090
FT                   /locus_tag="Bxe_A3910"
FT   CDS             617644..618090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3910"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3910"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29087"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A2"
FT                   /protein_id="ABE29087.1"
FT                   /translation="MMLATSAAWFETSLAAARGAINVREYLQAFHAADSALTLCVRNAI
FT                   AAAAVQTSAPPPIASGEPTQWKLEAAFEAGAILPVAQWPGSLRPPQCLIEAWRLASRAD
FT                   ARAYLLTSRGFGRTRESQVWLQIELVIDGDKIERHWRHVASRPF"
FT   gene            618101..618565
FT                   /locus_tag="Bxe_A3909"
FT   CDS             618101..618565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3909"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3909"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29088"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A1"
FT                   /protein_id="ABE29088.1"
FT                   /translation="MKPHTSAFTLLELMITLAIAAALAVFAVPSYRSHVARTHRIDAAS
FT                   ALYRAAQFVEGATSDSVPALPPGLDQAPQFGTPVYRLHALPADDANGGYAIEAAPSESG
FT                   PMRDDPCGIFTLDATGLRGNRSRTSGETGGRANSGSNASTPASGDCWNTT"
FT   gene            complement(618669..619148)
FT                   /locus_tag="Bxe_A3908"
FT   CDS             complement(618669..619148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3908"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3908"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29089"
FT                   /db_xref="InterPro:IPR021751"
FT                   /db_xref="UniProtKB/TrEMBL:Q145A0"
FT                   /protein_id="ABE29089.1"
FT                   /translation="MSQIHSDTAFRNKRHQAKDLSAPHLRALRKELLLVRADVERMELA
FT                   QATIELRQAVTHFSWLKFILPGFGGMQVGKGPKAGFINAGTIGALLKQYPIVSSIASLI
FT                   LAKPLRATVAAGAKPLLKWGSLGLAGWEAYRIWQQMKQESAASSDNRPDSTDSGY"
FT   gene            complement(619248..619634)
FT                   /locus_tag="Bxe_A3907"
FT   CDS             complement(619248..619634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3907"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3907"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29090"
FT                   /db_xref="GOA:Q144Z9"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z9"
FT                   /protein_id="ABE29090.1"
FT                   /translation="MTIDTQSQRGEHSPLRRIIGSVFAILQTRLELVGIELAEEKDRLL
FT                   GVLFLGLAAMMLATMALIALTALIAIAFWDTYRWQALAGITAVYAIAGLACALKARSGL
FT                   RNAPMVFEATIAEFEKDRDVFRKP"
FT   gene            complement(619767..620069)
FT                   /locus_tag="Bxe_A3906"
FT   CDS             complement(619767..620069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3906"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3906"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29091"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z8"
FT                   /protein_id="ABE29091.1"
FT                   /translation="MSEINKERLMSDIKTVLADAEDLLKQAASATGERASELRETALTR
FT                   LKQAREKAADVQVVVVEKGKKAARATDDYVHEHPWASIGIAAGAGVLLGLLINRK"
FT   gene            620409..621050
FT                   /locus_tag="Bxe_A3905"
FT   CDS             620409..621050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3905"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3905"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29092"
FT                   /db_xref="GOA:Q144Z7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z7"
FT                   /protein_id="ABE29092.1"
FT                   /translation="MMSLRLGDIAPDFEQQSSVGPIRFHEWLGDSWGVLFSHPADFTPV
FT                   CTTELGLTAKLASEFEKRNVKTIALSVDSAESHKEWIKDINETQAANVGFPILADGDRK
FT                   VSELYDMIHPNANETLTVRSLFVIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLTDS
FT                   HSVATPGNWKQGDDVVIVPSLKDEEIIKQKFPKGYKALRPYLRMTPQPNK"
FT   gene            complement(621191..622381)
FT                   /locus_tag="Bxe_A3904"
FT   CDS             complement(621191..622381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3904"
FT                   /product="Putative glutaryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3904"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29093"
FT                   /db_xref="GOA:Q144Z6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z6"
FT                   /protein_id="ABE29093.1"
FT                   /translation="MAEAAQFHWEDPLLLDQQLTEDERMVRDAAAAYAQDKLQPRVLEA
FT                   FRHEKTDIEIFREMGELGLLGPTIPEQYGGPGLNYVAYGLIAREVERVDSGYRSMMSVQ
FT                   SSLVMVPIHAFGSEAQKQKYLPKLATGEWIGCFGLTEPNHGSDPGSMVTRAKKVDGGYS
FT                   LSGSKMWITNSPIADVFVVWAKLEENGKDAIRGFILEKGWRGLSAPTIHSKVGLRASIT
FT                   GEIVLDEVFVPEENRFPEVSGLRGPFTCLNSARYGIAWGALGAAEACWHTARQYVLDRK
FT                   QFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGRMKDEGTAAVEITSIMKRNSCGKAL
FT                   DIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDIHALILGRAQTGIQAFF"
FT   gene            622451..623269
FT                   /locus_tag="Bxe_A3903"
FT   CDS             622451..623269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3903"
FT                   /product="transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3903"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29094"
FT                   /db_xref="GOA:Q144Z5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z5"
FT                   /protein_id="ABE29094.1"
FT                   /translation="MFCKHVRVYHPMTPASTLSEPLDERKFVVALARGLDLLRAFKPGE
FT                   TMLGNRDFVERTGLPKATVNRLAYTLTVLGYLRLDESLGKYALDAGVLSLGFALLSGTD
FT                   TLELARPHMRTFAREVGAAVSLGCRDGLDMIYLETIRSETALTLGLASGSRLSMLTSSM
FT                   GRAYLAVQPLDVRAALLAELRKAAGNEGDALVADAEKEIAAFAAQRCCYSFRAWHDDVN
FT                   AVAVPFREPREGRWLVLSCSGPASSMGEEVFRDNVAPRLMALARRLGDTG"
FT   gene            complement(623318..624229)
FT                   /locus_tag="Bxe_A3902"
FT   CDS             complement(623318..624229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3902"
FT                   /product="Putative diguanylate phosphodiesterase (EAL
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3902"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29095"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z4"
FT                   /protein_id="ABE29095.1"
FT                   /translation="MRTATIIGCGNRSGCRTPLYRHLHVYMIPPTIPDLITRAADHPFL
FT                   GAHLMMGHGLHHDVALAQFNGLELASGYEPIFDISVHALAQSLSSGVEGVDRFGDELGF
FT                   QAVTHRLDAAPSDVFDPFDRIADDRDLVALDRMSRALHAINFFGAQRHGLLFLRVHERL
FT                   LKSVKYDHGRHFSTVLVSFGLNPSRVVIELPAAAVAHKTFLGYLTKSYQHYGFKVAGNL
FT                   SNAGQILSVSETARLDFLKMDAGTALRDATVKPLVGYAGRLRIPLIFNRVVDEAQFEAL
FT                   QQYDVRFVQGPLFNAHYHDRAV"
FT   gene            624502..625866
FT                   /locus_tag="Bxe_A3901"
FT   CDS             624502..625866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3901"
FT                   /product="Major facilitator superfamily (MFS)
FT                   4-hydroxybenzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3901"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29096"
FT                   /db_xref="GOA:Q144Z3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z3"
FT                   /protein_id="ABE29096.1"
FT                   /translation="MSAKPAAAATNVIEVERVLAETHHPAFQLMLLVLCGLCLVIDGFD
FT                   AQAMGYVAPSVIGEWHVSKAALGPVFSASLFGMLLGALGLSVLADRVGRRPVLIGSTFF
FT                   FALAMLTTPFVTTIPALIALRFVTGLGLGCIMPNAMALVGEFSTPVHRVKRMMLVSCGF
FT                   TLGAALGGFISAALIPAYGWRSVFWVGGAAPLLLALAMLVALPESLQFLVLKGHNERAL
FT                   RWLAKFNPMLPIDANTRLVVREKGNDGAPVAELFRAGRGPVTLILWAISFMNLIDLYFL
FT                   SNWLPTVMRDAGYSPSTAVLVGTVLQTGGVVGTLLLGWFIERFGFVRVLFVCFAGAALA
FT                   VSTIGTVAHMLPWLLIVVFAGGFCVVGGQPAVNALAGHFYPTALRSTGIGWSLGIGRIG
FT                   SVIGPLIGGQLIALNWSNASLFHAAAVPVLCSALLVIGLAAATRQRGRPSEPRTA"
FT   gene            625901..627247
FT                   /locus_tag="Bxe_A3900"
FT   CDS             625901..627247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3900"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="Homogentisate pathway; Citation: Environ Microbiol.
FT                   2002 Dec;4(12):824- 41.J. Bacteriol. 186 (15), 5062-5077
FT                   (2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3900"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29097"
FT                   /db_xref="GOA:Q144Z2"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z2"
FT                   /protein_id="ABE29097.1"
FT                   /translation="MDTQTRTPNTVSSRLEIEPGYQSGFANEFATEALPGALPEGRNSP
FT                   QRVAYGLYAEQVSGTAFTAPRAHNRRSWLYRIRPAAVHKPFTPLPSERLVANFAEVPPT
FT                   PPNQLRWDPLPMPAEPTDFIDGWVTMAGNGAAESMSGCAIHLYAANRSMQDRFFYSADG
FT                   ELLIVPQEGRLDIATEMGRLEVEPFEIVVIPRGVRFAVSLPDGAARGYICENFGALLRL
FT                   PDLGPIGSNGLANPRDFLTPHAAYEDREGDFELVAKLNGNLWRADIGHSPLDVVAWHGN
FT                   YAPYKYDLRRFNTIGSISFDHPDPSIFLVLQSQSDTPGVDAIDFVIFPPRWLAAEDTFR
FT                   PPWFHRNVASEFMGLVHGVYDAKAEGFVPGGGSLHNCMSGHGPDADTFEKASHIDTSKP
FT                   AKVGDTMAFMFETRTLIKPTRFALETAQLQAHYYECWQGLKKHFNPEQR"
FT   gene            627244..628554
FT                   /locus_tag="Bxe_A3899"
FT   CDS             627244..628554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3899"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /note="Homogentisate pathway; Citation: J. Bacteriol. 186
FT                   (15), 5062-5077 (2004)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3899"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29098"
FT                   /db_xref="GOA:Q144Z1"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z1"
FT                   /protein_id="ABE29098.1"
FT                   /translation="MNASSDLQATLDPSRKSWVESANNPTGDFSIQNLPFGIFSDGLNA
FT                   TRRVGVAIGDSIVDLAALESAGLLSVPSTGAGDSVFVRDALNDFIALGRDAWRSVRVQL
FT                   SRLLSRDDATLRDDAELRGRALIRQADAQLHLPVQIPGYTDFYSSKEHATNVGSMFRDP
FT                   KNALLPNWSEMPIGYNGRASSVVVSGTPVRRPNGQLKLPDQERPVFGACRKLDIELETG
FT                   FVIGAGNALGEPVTCADAEAHIFGMVLLNDWSARDIQQWEYVPLGPFNAKTFATTISPW
FT                   IVTLDALEPFRVAQPAQDPQPLAYLRHDGEHAFDITLEVTLRPQQAKEASTITRTNFKH
FT                   MYWTMAQQLAHHTVSGCNTRVGDLMGSGTISGPTEDSFGSLLELTWNGKKPLELREGGT
FT                   RSFIEDGDELTLAGWCQGEGYRVGFGVCAGEILPALK"
FT   gene            complement(628685..629845)
FT                   /locus_tag="Bxe_A3898"
FT   CDS             complement(628685..629845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3898"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3898"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29099"
FT                   /db_xref="GOA:Q144Z0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Z0"
FT                   /protein_id="ABE29099.1"
FT                   /translation="MKVILTRDFLALILSVAVVGLGSGATLPLTALSLTQAGYGTDVVG
FT                   LLTAAQAGGGLAIVPLAGWIAARFGGRRVIVGAVLVVAFATALMQLTSNLWLWAVLRVL
FT                   CGAALMLLFTIGEAWVNQLADDASRGRVIAIYATNFTLFQMAGPVLVSQIAGFTHWRFL
FT                   MCGAIFLLALPMLATIRATPQASGDEHAAHGGWRHVLPQMPALVIGTGFFALFDTIALS
FT                   LLPLFAMSHGIASEVAVLFASALLLGDTTMQFPIGWLADRLGRERVHIGCGVLVVALLP
FT                   VLPWAVTSPWLCWPLLYVLGAAAGAIYTLSLVACGERFRGVALVSASSLVGASWSAASF
FT                   GGPLVAGALMKGVGNDAVVGVLLVAAVAFLAAVWWEKRRAPVRVGG"
FT   gene            complement(629910..631076)
FT                   /locus_tag="Bxe_A3897"
FT   CDS             complement(629910..631076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3897"
FT                   /product="Major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3897"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29100"
FT                   /db_xref="GOA:Q144Y9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y9"
FT                   /protein_id="ABE29100.1"
FT                   /translation="MPLPLLALAVAAFGIGTTEFVIMGLLPDVARDLAVSIPAAGMLVS
FT                   AYALGVTIGAPIVAIAVANMPRKKALMSLIGVFIVGNLLCAVAPGYAVLMAARIVTAFC
FT                   HGAFFGIGSVVAAGLVAPNRRAQAIALMFTGLTLANVLGVPLGTALGQAVGWRATFWAV
FT                   TGIGLVAAAALAVCLPAKIEMQKASLVHEFSVLKNPQVLMVLGISVLASASLFSTFTYI
FT                   TPILEDVSGFTPHAVTLVLLLFGLGLTVGSTLGGKLADWRLMPSLVAFLLAIVVILTIF
FT                   AGTMHSEIPAMITIFAWGVLAFAIVPPLQMLIVDRASHAPNLASTLNQGAFNLGNATGA
FT                   WLGGMAIGAGAPLTTLPWVGVATAIGALALTLWSVSIERRAQRVAVAG"
FT   gene            complement(631268..632092)
FT                   /locus_tag="Bxe_A3896"
FT   CDS             complement(631268..632092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3896"
FT                   /product="Putative enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3896"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29101"
FT                   /db_xref="GOA:Q144Y8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y8"
FT                   /protein_id="ABE29101.1"
FT                   /translation="MVTTQNFNDHVRIEANEDIGVATIVLERPARRNAVDRPVAEALSA
FT                   AFACFEAQPAWRAAVLFGAGGTFCAGADLTALADDTRRNELHADGSGPGPMGPTRTSFS
FT                   KPVVAAIAGYAVAGGLELAALCDLRVVEEDAVLGVFCRRVGIPLIDGGTIRLPRLIGLS
FT                   RALDLILTGRAVSAQEALGFGLANRVVAKGTARAAAEQLAAELAALPQATLLADRRSVL
FT                   ENSMLDDFAEALRREGAGGYRAVFEEGIAGAARFAEGTGRHGKTLDAGGGTR"
FT   gene            632322..632798
FT                   /locus_tag="Bxe_A3895"
FT   CDS             632322..632798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3895"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29102"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y7"
FT                   /protein_id="ABE29102.1"
FT                   /translation="MPLQEHSWYDHVRLKRVFVTDGTRHQVVLVDVRKLLVCADRDNTD
FT                   YVLKPVAEWHSGKVRGIREFLDPDNTRVPQMPYVTISTRRAPGLLGWVGLEREGVVAFR
FT                   NGQHRARYLAEAGARWFPVEVHEREALLLRELCGAADDARTVVRATSLNSGGGV"
FT   gene            complement(632795..633793)
FT                   /locus_tag="Bxe_A3894"
FT   CDS             complement(632795..633793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3894"
FT                   /product="Putative D-lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3894"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29103"
FT                   /db_xref="GOA:Q144Y6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y6"
FT                   /protein_id="ABE29103.1"
FT                   /translation="MRIILFSSRQYDSDTFTEANASHRYELHFQESHLDSETAVLAQGY
FT                   EVVCPFVNDHVDAAVLERLHAGGTRMIALRSAGFNHVDLDAAARLGITVARVPAYSPHA
FT                   VAEHAVGLILALNRRLPRAAARTREGDFSLHGLLGFDLHGKTVGVVGTGMIGRVFGRIM
FT                   AGFGMQVLAHDPGTPADDLLALGARYVPLDTLLAGSDIVSLHCPLVAGTYHLIDGPALA
FT                   RMKRGAMLINTGRGGLVESNALIGALKDGQLGHLGLDVYEEEGGLFFEDHSNLPLQDDV
FT                   LARLLMFPNVIVTAHQAFFTREAMSEIAQTTLANVAAWRNGTPRNVVRAPV"
FT   gene            634231..635913
FT                   /locus_tag="Bxe_A3893"
FT   CDS             634231..635913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3893"
FT                   /product="Aspartate/alanine exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3893"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29104"
FT                   /db_xref="GOA:Q144Y5"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR022457"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y5"
FT                   /protein_id="ABE29104.1"
FT                   /translation="MIGELLRSQPEIALFASLAIGYFIGSFRIGPIQLGGVCGTLIVAL
FT                   LLGQTGARLAPDLKNIAFALFIFALGFTGGPQFFANIGRGWRYGLLSVVEIVSVLALIM
FT                   IAVAAMRLDAGTAAGLLAGAATESAVIGTASEAISKLGFSEAETARLQANIVTAYSVSY
FT                   LFGLITIVLFTSQFAPLLLRINLRDEAERVWRKLGGDGAYGEGQLAAAPALVGRAFHVG
FT                   AAAGATIRAFEQQYGFNLTVERVRRNGANVPAEPQLTLASGDVILVGGRREAIVAAAAA
FT                   LGEEVDGSDFGPVIAEKLDVVLTRRDLHGLTVAQVREQATPENGRGVYIAAVTRLETTV
FT                   PALPGTELNRGDVLTLVGGKADVERGAKRLGYVVVATQKTDFVYLGLGVLVGMAIGHLG
FT                   GRIGGVSVALGTGGGCLLSGLLFGWIRSRYPVVGSLPSAAAQILKDFGLATFIAAVGLS
FT                   AGPDAIKLVREYGLALPVAGILMVLVPGLLSLWIGRMFLKLEAPMLLGAIAGQQCSTPA
FT                   ISALVGVTGNSTPVIGYTITYALSNILLPLMGPVVVGLAGKFH"
FT   gene            636067..637749
FT                   /locus_tag="Bxe_A3892"
FT   CDS             636067..637749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3892"
FT                   /product="Aspartate/alanine exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3892"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29105"
FT                   /db_xref="GOA:Q144Y4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR022457"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y4"
FT                   /protein_id="ABE29105.1"
FT                   /translation="MDWLHHIFQKSPEIALFLSLAAGYFIGQINFGKFQLGGVGGSLLA
FT                   AVVISQAGVTIDNGVKSVMFAVFIYAVGYDSGPGFFNSLNRKTLREIAMAVFLAVTALI
FT                   TVVVCAKLFHLNKGLAAGLAGGALTQSAIIGTAGDAIARLGLPADQVKSLQSDVAIAYA
FT                   VTYVFGSLGAIIVCVNILPKFMGQGLREASVEVERELTAGAAAAGPGQLSALPEMVGRA
FT                   YKIDVSAGKTVKAVETLHQDLLTIERIKRDGQPLDPAPGLILKPGDVVLVVGRREAVVE
FT                   FGAAGGEVATVEDVGAVMQTREAVFTRKGMNHTTIAAARAVVDRDMRHGVYIQSISRAG
FT                   QPLPVLPETKLEHGDVITFYGSPKDTKRAAEAAGYELPYSNKTDFIYMGVGIVLGLLIG
FT                   LIVVNVAGIPLTLGSGGGCLLAGLLFGWMRGKHPMYGAMPSAASQLLKDFGLAAFVAVV
FT                   GLNSGLQAVVTVKQSGMTIFLLGVFVTLFPLLLTMLFGRYVLKYNNSAILAGALSGSRS
FT                   ANPAFGGVLDKAESAVPTVPFAITYAIANVALTLLGPLVVGLV"
FT   gene            637839..639503
FT                   /locus_tag="Bxe_A3891"
FT   CDS             637839..639503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3891"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3891"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29106"
FT                   /db_xref="GOA:Q144Y3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022518"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y3"
FT                   /protein_id="ABE29106.1"
FT                   /translation="MAKEKGDKKHADTAEQDFSALSPFELKDELIKAAGGSAVERPANA
FT                   SMLNAGRGNPNFLATIPRHGFWQLGLFAMRESERSFAYMPEGVGGFPKREGLTERFELF
FT                   LRENRGVPGIDFLRGAVSYVRDQLGLSAGDFLYEMCEGILASNYPVPDRMLKLSEVIVG
FT                   QYLRREMIGKHPFIGEFDIFAVEGGTAAMTYIFNTLRENRLIKAGDTIALGMPIFTPYI
FT                   EIPRLNDYQLNVVNLNADVENNWQYSKAELDKLRDPKVKAFFLVNPSNPPSVRISDESL
FT                   EQIADIVKARPDLILLTDDVYGTFADDFVSLFALAPKNTILVYSYSKYFGATGWRLGTI
FT                   ATHRDNVLDRLIAELPKDVKKELHTRYESITTEPDKLKFIDRLVADSRTVALNHTAGLS
FT                   TPQQVQMVLFSLFSLMDTPDAYKNALKRLIRSRKRALYEEIGISFEDDDKNQVDYYTIL
FT                   DMEFLGERAFGREFVEWLFKNTEPSELLFRLAREARVVLLPGRGFGTKHPSGRVSLANL
FT                   NESDYRQIGRALRKLIEEYVERFNAATGKTLDKGKVE"
FT   gene            complement(640004..640453)
FT                   /locus_tag="Bxe_A3890"
FT   CDS             complement(640004..640453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3890"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3890"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29107"
FT                   /db_xref="GOA:Q144Y2"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y2"
FT                   /protein_id="ABE29107.1"
FT                   /translation="MTYHAVTVTLENIGGIVVVKDKYNSTTQGVTFNATIAGKRQYAVV
FT                   MRGNPRLDNGMVVTAVLRDPENWQTLAGWLNHATGEICGVDSPGQRGAICAFTILFGIV
FT                   FLLRALRPDTGTAFMVVLISVMVAGNAWSMLALRKSLIVYRLLKP"
FT   gene            640517..640804
FT                   /locus_tag="Bxe_A3889"
FT   CDS             640517..640804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3889"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3889"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29108"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y1"
FT                   /protein_id="ABE29108.1"
FT                   /translation="MPRKDSQQGEPRDRLSARSIAPRCAGCRYRTNLISARPDHVSVTS
FT                   LRSRTHCKLLAMKLYSSCSSSHGSGMRDMRPSSCVFIAASLTVAFYNGSS"
FT   gene            641497..641754
FT                   /locus_tag="Bxe_A3888"
FT   CDS             641497..641754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3888"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3888"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29109"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Y0"
FT                   /protein_id="ABE29109.1"
FT                   /translation="MLELLIDTGEDYQREAEIDSELYQVIALDAKEVPQSRIKARHAAN
FT                   LLAKALRKPSDNRERIGATRVVPSRAIRFKTMARRIATAH"
FT   gene            complement(642370..643581)
FT                   /locus_tag="Bxe_A3887"
FT   CDS             complement(642370..643581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3887"
FT                   /product="major facilitator superfamily (MFS) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3887"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29110"
FT                   /db_xref="GOA:Q144X9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023008"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X9"
FT                   /protein_id="ABE29110.1"
FT                   /translation="MSTDSATPHSEFATTLQIIPVVFFTFLCYLTIGIPLAVLPGYVHD
FT                   DLGYSAVLAGAAISVQYLATLASRPLAGRSADTLGPKRTVTIGLLGCGASGVLLLLAVL
FT                   CGRWSVLSLGLLVCSRLVLGFGESLCGTGAILWGIGRVGTSNNARVISWNGIATYGALA
FT                   VGAPLGVAIAHTVGFAALGILVILLAALGFYLARPIAPVPVVHGERMSYRSVFTRVLPH
FT                   GIGLALGSAGFGSIATFITLFYAAKHWPNAALSLTVFGTLFIGARLLFANTIKTYGGFR
FT                   VAIASFSFECAGLLMLWLAPEPHVALAGAALTGFGFALVFPALGVEAVGLVPPASRGAA
FT                   LSAYSVFLDLSLGITGPLAGYIAGEFGYGSVFLFAAVAAAVAVGLSTFLYLRNAKVTNL
FT                   PAAL"
FT   gene            643596..643979
FT                   /locus_tag="Bxe_A4507"
FT   CDS             643596..643979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29111"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X8"
FT                   /protein_id="ABE29111.1"
FT                   /translation="MNSAGRRDFHMEPILLQNLLNKSTRKGPFQEPYSGPVSARSGLFS
FT                   RHEQQKRFATDCLLSNIKIKNKAKIQMHHKSTAPQTHLDIFLRICPSCDRSYGLCLLTV
FT                   IVFKPSLLHVPADTEHSRVTRHD"
FT   gene            643972..645495
FT                   /locus_tag="Bxe_A3886"
FT   CDS             643972..645495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3886"
FT                   /product="Putative xanthine dehydrogenase"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3886"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29112"
FT                   /db_xref="GOA:Q144X7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012175"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014307"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X7"
FT                   /protein_id="ABE29112.1"
FT                   /translation="MTEPIRFYHRNAIREIKDAPVTRTVLQYLREDAHCTGTKEGCAEG
FT                   DCGACTVVIGERNEAGGVDFKAVNACIQFVPTLDGKALFTVEDLRQPDGSLHPVQEAMV
FT                   ECHGSQCGFCTPGFVMSMWSLYEKHGHEHSCANRTVPSREAISNALTGNLCRCTGYRPI
FT                   VDAAVRMFEAPAPKAPVNVEALVRALGTLERTDTFHYEHAGQQFDAPRTVEALARIKEA
FT                   EPATRILAGSTDIGLWVTKQMRELGNIVYVGQIAGLQKLETNGEWIEIGAGVSVEKAYA
FT                   EIAKQYPELNEMWQRFASLPIRNAGTLGGNIANGSPIGDSMPGLIALGARVIVRGGEIE
FT                   REMPLEDLYLAYQKKDMAEHEFVVGLKVPTRSGVRQNLQFRTYKLSKRFDSDISAVCAA
FT                   FAFIADGNLIREPRIAFGGMAATSKRATHAEAVLRDAEWHEATAQAAMLALGNDYAPLS
FT                   DMRATSNYRLESAKNTLYRFWLETRPDNPLPKSALDVRAVAAACAPAGV"
FT   gene            645525..647891
FT                   /locus_tag="Bxe_A3885"
FT   CDS             645525..647891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3885"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein / Xanthine oxidase"
FT                   /EC_number="1.17.1.4"
FT                   /EC_number="1.17.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3885"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29113"
FT                   /db_xref="GOA:Q144X6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR014309"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X6"
FT                   /protein_id="ABE29113.1"
FT                   /translation="MNQQAEPFLKNLQDPDDFTQVHISRPHESAHLHVSGRATYTDDIP
FT                   TLAGTLHAALGLSSKAHAKIVSISLDKVRATPGVVAIFTADDIPGVNDVGPIIHGDDPI
FT                   LADGLVQYIGQPIFIVVATSHETARLAARRAEIVYEELPAILTAQQARAANQHVLPPMK
FT                   LARGEAGTKIARAAHREAGEMLLGGQEQFYLEGQISYAVPKDDDGMHVYCSTQHPTEMQ
FT                   HLVAHALGVASHNVLIECRRMGGGFGGKESQSGLFACCAALAAWKLLCPVKLRPDRDDD
FT                   MMVTGKRHDFHYTYEVGYDDKGVIDGVTVDMTSRCGFSADLSGPVMTRALCHFDNAYWL
FT                   PDVTIDGFCGKTNTQSNTAFRGFGGPQGAFAIEYIMDNVARSVGEDSLDVRRRNLYGKT
FT                   ERNQTPYGQIVEDNVIHELIDELEATSEYRARRAAINEFNANNAILKKGMALTPVKFGI
FT                   AFNVTHFNQAGALVHIYTDGSVLVNHGGTEMGQGLNTKVAQVVAHELGIGFNRIRVTAT
FT                   DTSKIANTSATAASTGSDLNGKAAQDAARQLRERLSAFAAERFGAGQVSASEVRFAHDR
FT                   VVVGDSVVPFEEVIAKAYLARIQLWSDGFYATPKLYWDQSKLQGRPFYYYSYGAAVSEV
FT                   VIDTLTGEMRVLRADALHDVGASLNPALDVGQVEGAFIQGMGWLTTEELWWNAGGKLMT
FT                   HAPSTYKIPTVNDTPPDFRVRLFKNRNAEDSIHRSKATGEPPLLLPFSVFFAVRDAVSA
FT                   VGGHKVNPPLNAPATSEEILKAVGAVRAATAAPRR"
FT   gene            647935..648537
FT                   /locus_tag="Bxe_A3884"
FT   CDS             647935..648537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3884"
FT                   /product="Putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3884"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29114"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X5"
FT                   /protein_id="ABE29114.1"
FT                   /translation="MDNTLTGIGTIAMNDFSSVQIGRRGAVQMPRPAPMHIVLFGAGHV
FT                   GHALIKLLGSLPCVVQWVDERDELFPDETPANVQIEATDTPDAIVDAVPPGAYFLVMTH
FT                   HHALDFSLAARIMRRRDFTYFGMIGSKTKRVKFERRLLDRGVDPDRLVEMTCPIGVAGI
FT                   VDKAPAAIAVAVCAELLQIRTRQMVAQAATQKLYASV"
FT   gene            complement(648619..649599)
FT                   /locus_tag="Bxe_A3883"
FT   CDS             complement(648619..649599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3883"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3883"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29115"
FT                   /db_xref="GOA:Q144X4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X4"
FT                   /protein_id="ABE29115.1"
FT                   /translation="MDDTAASLDIWLVRVLRTLLVERSVTQTALRLNQTQPAISTALRK
FT                   LRETLNDPILVRGKSGMVPTEYGESLLASAQRVLREVDFVATPHGDFDPGRSRRTFRVA
FT                   APDYLNDFFMPTVIAQFREAAPHARLEIDSLSPMLDHCAALDAGELDLVIGNWPKPEPR
FT                   FERSDLFSDTVVCMMRADHPLTRVPLTREAYLAAPHLAPTPYSGASSGAIDMGFARARA
FT                   ERRIVATLPYFGLVPQTLLQSDLIFTTTRRFAMHYADMLPLAVVEVPIPFPRIKCYQLW
FT                   HPQPDRPSDVGWLRALMSRVSDGLVAQKVRRAKRAPQKERSAATG"
FT   gene            complement(649845..650495)
FT                   /locus_tag="Bxe_A3882"
FT   CDS             complement(649845..650495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3882"
FT                   /product="Putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3882"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29116"
FT                   /db_xref="GOA:Q144X3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X3"
FT                   /protein_id="ABE29116.1"
FT                   /translation="MTVGIDARQPLWFYDFVSPFTYLLLEQHDKWPGFDFVFTPVVLND
FT                   LYRHWGQRPAYGVPSKRTFMYRHALFRAEQLGIPYRMPPAHPFDSMKPLLLATAANGDV
FT                   NFVREIFRFIWREGRDPSTNEAFAELCERVGLPEGPELIKDPEVKAQLQRNTADAIGLG
FT                   VYGVPTFRLNDQLFWGEDALPMVLYCARTPNWLESKEVKRISTLPSGLVDSQT"
FT   gene            complement(650599..652083)
FT                   /locus_tag="Bxe_A3881"
FT   CDS             complement(650599..652083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3881"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3881"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29117"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X2"
FT                   /protein_id="ABE29117.1"
FT                   /translation="MKPATGRRSPPRLVARFVAISWRDLAVSFGPILLIAAVAIWVAVR
FT                   LIQPAPPNTLTISAGPEGSTFWNAAQKYKEILARNRITLNVLSSEGSLQNLKRLSDPKS
FT                   NVDVGFVQDGVAPGPAARGLMSLGSVAYVPLAIFYHGPTVTRLSEFKGERLAVGAEGSG
FT                   TRELALALLKANGIVPGGATRLLPLSGDDAASALVSGKVDAAFLAGDSAQPAVMGKLYR
FT                   TPNVQFYDFSQADAYTRRFPYLTQLTMPMGAFDLGKNLPAAPIHMVAPTAELVARDSLH
FT                   PALSDLLIEAAREVHGKANILQRAGEFPAPLAHDFPISDDAARYYKSGKSFLYRILPFW
FT                   LASLADRLLVVVVPLIVLLVPALRLVPSLYAWRVKSRIYRWYGALIAIERSALSDHSPT
FT                   ERASLLERLDAIEESVNGLKMPLAYADQFYVLREHIGFVRQRLTQPRETQRDGAGNETQ
FT                   GTGNGPGEAGAPPAPSAANEAAEIGETPNGGAAKPY"
FT   gene            652627..652980
FT                   /locus_tag="Bxe_A3880"
FT   CDS             652627..652980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3880"
FT                   /product="Putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3880"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29118"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X1"
FT                   /protein_id="ABE29118.1"
FT                   /translation="MKSVGFLKTLGSVVAMVVACNVYAQASDATATGTTAAPAASAKTV
FT                   KKANSQLGRKVRSALAKAQGIDVSSIAVRARGGAVTLTGSVPDQGQIDAAGQVAKGVAG
FT                   VTSVSNKLTVMQQ"
FT   gene            653231..653479
FT                   /locus_tag="Bxe_A3879"
FT   CDS             653231..653479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3879"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3879"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29119"
FT                   /db_xref="UniProtKB/TrEMBL:Q144X0"
FT                   /protein_id="ABE29119.1"
FT                   /translation="METSLLRYTDLPISDRAAFELVCARHGFAPAHFDISACADPDDAA
FT                   HERLVTVRRGGWAQSYHDRHGQWVRQFEADLTCRFFK"
FT   gene            complement(653545..654333)
FT                   /locus_tag="Bxe_A3878"
FT   CDS             complement(653545..654333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3878"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3878"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29120"
FT                   /db_xref="GOA:Q144W9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W9"
FT                   /protein_id="ABE29120.1"
FT                   /translation="MALPHIDLLYSVSGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPA
FT                   TAVGTDLLYAAATKATGTLVHGLKGSVDWQITLRLAAGSVPAATLTLILLHRYGMDTPG
FT                   AGRLIQIVLGAALLITAVALVFRPQLAALGARKQRTPRQGRTLALTMLTGAVLGVLVSL
FT                   TSVGAGAIGVTVLLLLYPLLPTTRIVGSDIAHAVPLTLLAGAGHWLLGSIDWSMLLSLL
FT                   VGSLPGIAIGSYLSSRAPDALLRNLLAATLTLVGVRLVLA"
FT   gene            complement(654539..655204)
FT                   /locus_tag="Bxe_A3877"
FT   CDS             complement(654539..655204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3877"
FT                   /product="Putative amino acid exporter, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3877"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29121"
FT                   /db_xref="GOA:Q144W8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W8"
FT                   /protein_id="ABE29121.1"
FT                   /translation="MSTTSLFFTAAGVGLAIAAPVGPMGMLCIRRTLTGGPRAGLAIGF
FT                   GIATGDAAYGLIAALGLVGISQFMLAYDRPLHLLAGLFLLYLGVRTLLQKAPAEAANGP
FT                   SPTGDTTNGNGKLAQVGRAGALRAYVSSLLLTLTNPQTVIMFAALFTTLAPRGAFSSSI
FT                   ALTTVGGVFCGSIAWWCFLVTVVSLARHAIGSRLRVAIDRIVGFTLAAFGVVEIRRAL"
FT   gene            655319..655705
FT                   /locus_tag="Bxe_A3876"
FT   CDS             655319..655705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3876"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3876"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29122"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W7"
FT                   /protein_id="ABE29122.1"
FT                   /translation="MSIGSIDSIGSARAVLPASPGVCLVLKGNTISRNYYANQAQPYLK
FT                   SGNGIRLFAEPDFSDILRERIRGREMFSAASQWTECGFISAAMAIMMPATGTLWPKIRD
FT                   VVLRDMPFWMNTRRAAAGLLMRSC"
FT   gene            complement(656018..657997)
FT                   /locus_tag="Bxe_A3875"
FT   CDS             complement(656018..657997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3875"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29123"
FT                   /db_xref="GOA:Q144W6"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W6"
FT                   /protein_id="ABE29123.1"
FT                   /translation="MISQRIAYGLMKTQLLLLSTLSLALAACGGGGGGDSAGGASANQA
FT                   NGTGGTSSSASTSAAGNASTGTVALNATGGTAAMSCASPTTSAGSGSATISADTPSADG
FT                   TRIFASGSTFQLAFNTNAPAADTLNWAVTDTLGRVAASGTAAVPGGAHTITFNCTSTLA
FT                   GYFAATGTLAKSGGQLPQAGTRPVGIATFGVTPNLSGAVPAVTYAREEQHRFGMQGAND
FT                   NGPLLAALGISSTIDDRQLSTMEPNGPNTFNPSADNLDPFYKSGNVMRLIRLDGIPAWA
FT                   SSTGAFQDDTTLPSDISYYQSYMSRVGTESNAIRAAYFPTQSANYYQVTWEPNQMWTDT
FT                   DANFVALYKSVYQGIHSTDPHAMVMGPADAFPSLTTSHLQRLASLGFGQYIDAVATHGY
FT                   YDAGTSPSHPPERYDSDPSTASGSLRGQMRNLRAEMAADYRSGMHLFSTEAGISYDLGT
FT                   SYGPNYPSANVLYAQAAVAARMHIITLGEGADQTYVFYGADYPDEVGYGTFFDLSDPQG
FT                   AFGATNLSPKPVAMAISAMTHTLDGTTTLGPVNGTPTGIYAYAFQQVGNGAVITALWAH
FT                   NNDVWSASAGFSSSYGVAYSLNVDGPGTNGTVKVIDMMGNATNANYSNGVLKLNLTESP
FT                   VYVVSNNASVTRANATTPVGYVGM"
FT   gene            658814..659899
FT                   /locus_tag="Bxe_A3874"
FT   CDS             658814..659899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3874"
FT                   /product="Putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3874"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29124"
FT                   /db_xref="GOA:Q144W5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W5"
FT                   /protein_id="ABE29124.1"
FT                   /translation="MRILQLVHAPRLSGAEVLVKGLAIHHQRGGHEVCMTSLLPQQDDF
FT                   ADIRAELQAAGVTCLFPDVRYGRVGKLLHLYRVVRRFRPDFIVAHATLAALYVRLLPVH
FT                   TPIAWVMHSGVNDFENGALKRAERLLSRRARAIIGVSQQNIDDYLREIGRHPSMVVIPN
FT                   GVDAQLFSEANDACAPDVEVYPKQIVQLGRYIEGKSQLDTIRAFERVLQAEPEARLLLC
FT                   GVVEDLDYHRAVLSLVRELGLESRVTVGGPRSDVAAILRASRVFAMPSRFEAQSIGFLE
FT                   ALASGIPVVASRIPSFGFASAFAGVNLVDTTDPEAYGGALLSALGTPRANRQLAGYTLH
FT                   DTADRYMTIARKFVQPLRVSA"
FT   gene            complement(659927..662317)
FT                   /locus_tag="Bxe_A3873"
FT   CDS             complement(659927..662317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3873"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3873"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29125"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W4"
FT                   /protein_id="ABE29125.1"
FT                   /translation="MRPSAIRLVRDSFIACFALFVFAFLPASAHAADCGAGTLVTVVAH
FT                   LDDDLLFVDPAISERLDARWCITTVHLIGGANGADFAYVQTRERASRLAYARMAGVPDE
FT                   WLESNVTIAGKLVHQMVLKARPQVRLLELRLPGGAVRGGREPLGLLWEQHATLSTYPMN
FT                   ADGSVRVKYDRDALSATLKAILAQATLIYTLNPDTVPFIEHPDHIYAARITRHVAQTLG
FT                   KSVPIVYHVTYPTGGWPGNLPAAEVQRKRDIVASYFSIDGSESSHVFGEFQWDGNWISR
FT                   RYAFADRTDRRVPDFVSHPIQLFNAAASRCLSSAGPGRAPALAACTGSPAQQWRWDPLT
FT                   VYPGNARNAALVSVATSQCIAERDGYLVAETCDQWDMAQRWTPWDFGLVYTPMRHCLGE
FT                   NDGKLTMRGCTALTTRYRWATTQRTQANDLRLATAMTGDIAGSGEQSVVYVQRQHDGPG
FT                   FNVYAASLANASPPALWYANVVPFDPQATAPSCAGDRLCFDSVRFLLGDFDGDGKADLM
FT                   IVAAREGGTAFWLLRSAGDHFEAPRLWLQTSNAFRPELTQQYVAADFTATGRASVLIAQ
FT                   KRADSGLDLWMASPQRSGGPAGSAPTLWAQARSLPQNVNLLVRETVGARAALVAVSSTN
FT                   GRLALTPIANEGARMSVGERNVLPASFDPDFVKVTMGAVHGRDSNTLILLTPHLGESSE
FT                   EAMIDVATLDTSGAGNTPAQAATLHGLSWSDVFPAFVRDKQGAALVLFRRTDATLGDFY
FT                   FTGGAPALSRYPSGNGLALGEAQELGKLPGLFSETVRIDRLTQ"
FT   gene            complement(662449..662901)
FT                   /locus_tag="Bxe_A3872"
FT   CDS             complement(662449..662901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3872"
FT                   /product="Putative GDP-mannose mannosyl hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3872"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29126"
FT                   /db_xref="GOA:Q144W3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR028613"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W3"
FT                   /protein_id="ABE29126.1"
FT                   /translation="MLTEIDFLDVVRLTPLVAFDLIVSDARGRVLIGRRRNRPARGTWF
FT                   VPGGRIHKGETLDAAFARIADAELGIANLARSAARFEGVFEHHYSDNFAGEPDVSTHYI
FT                   VLAYALTLAGTAPPGRPEQHSEYAWLAPAELLARADVHDNTKAYFR"
FT   gene            complement(662984..663133)
FT                   /locus_tag="Bxe_A3871"
FT   CDS             complement(662984..663133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3871"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3871"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29127"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W2"
FT                   /protein_id="ABE29127.1"
FT                   /translation="MNGLAWMMLVLAAMFGAFLFATIGAVLLALFLASVSSRLTRNDDH
FT                   HRDY"
FT   gene            complement(663248..665479)
FT                   /locus_tag="Bxe_A3870"
FT   CDS             complement(663248..665479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3870"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29128"
FT                   /db_xref="GOA:Q144W1"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W1"
FT                   /protein_id="ABE29128.1"
FT                   /translation="MSRGLRISLVASAAAVILLGLPAVRCAAADAAPQANGASAGNGEF
FT                   TADGRKWTLCAAEYGTCRFSGTRDVLYGTVQQHVVKTFTDSAECNNAVFGDPAPGVEKR
FT                   CAMTQAAQAAAPVANKDTASDTAVRSAALAELKAPPGQGLRCSAPSLQVPTAQNGDLLE
FT                   ADTPSDGTRLFAVARPFALVFTTRPAQSDTLTWQIRDTWNVVRASGRFPVAAGATLSTL
FT                   SCASSVAGYFAVSASLERAHGQLESRGTRPAGIVTFGVLPDTSAALPAVRFPYEDLHRF
FT                   GGQGAAYLAPGQQCCDGDGYRPVYTALGLSWVNDNRNWYMEEPKKPGTFDPATKQLTPF
FT                   FRRGDLMRLIQLDGIPQWASPTGKETHSYAPTSLAQMKDYMARVGAESNRVRMTYFPKQ
FT                   RDNYYQVTWEPDADGGLPWRDTDANFIAMYKAVWEGIHQTDPHAVVMGLTYSSVQGNVT
FT                   WMRKLGPLGIGRYMDGMTIHGYYDIGTTPSHPPERVTDTGNQGTVPGALPAAMRALRHE
FT                   MRLYLKPGAPLFVTETGISYDIGESYGKNYPGADVLYAQAAVTARTHLILLGEGADMTY
FT                   VFYLADMPDAAPGYGIFFELDHPTGAYGPTRISPKPAALAVAAMTRIIDGTVTLGPLKG
FT                   VPKGVYAYAFRRLGGGRIVTALWTHDNDAWSARTGFDASRGVDYRLRVDAPGSTGEVTV
FT                   FDMMGNATTLPYRDGVANVKLSPAPVYVVSGNADVFSNAVMTPEGYVAR"
FT   gene            665860..666162
FT                   /locus_tag="Bxe_A3869"
FT   CDS             665860..666162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3869"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3869"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29129"
FT                   /db_xref="UniProtKB/TrEMBL:Q144W0"
FT                   /protein_id="ABE29129.1"
FT                   /translation="MFVLLIATPQIYRQKKCRLALARSRCRYSEGGCAHSDVAAGKSHF
FT                   KSVWRRMVRIVTRPFSSSRCVCGGVRNASFICINIRRMPIHSYVESAINPLKRQR"
FT   gene            666335..667327
FT                   /locus_tag="Bxe_A3868"
FT   CDS             666335..667327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3868"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3868"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29130"
FT                   /db_xref="GOA:Q144V9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR025628"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V9"
FT                   /protein_id="ABE29130.1"
FT                   /translation="MTMTCASLESAMLRWVHAPNKGMRRIAILMFNDCSLQGAGVVAEV
FT                   FQAANEMASSGAGGWLYDVSFLSADGGMVTSSSALRVWTDGLDARHYGGFDALYVAGGK
FT                   GALAAASDERLIAWLRRVRRNTGMIRPIAEGRALLDAAYVPDSSREAGDAQAQPIPARQ
FT                   PEQTADAGDRLESMRSALAMIKRDLGSATARTVAERLLADSCSNLAPLLGEDGGLSPGD
FT                   KVRAAARWLQENCQQAISIADAAQFAAMSERNFLRRFKMEMGITPSSFLLHERLAVTCS
FT                   LLTESELPVDKIARRTGMGNGDRLAKVFRKRMRISPTEFRIQSRRLVGE"
FT   gene            667416..668975
FT                   /locus_tag="Bxe_A3867"
FT   CDS             667416..668975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3867"
FT                   /product="mannose-6-phosphate isomerase, type 2 /
FT                   mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3867"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29131"
FT                   /db_xref="GOA:Q144V8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V8"
FT                   /protein_id="ABE29131.1"
FT                   /translation="MLTQAAMSALSIDPNSAGAATAHGRCARIVPVILAGGSGTRLWPV
FT                   SRENYPKQLIDVVGSDSLLQATARRMDGFPAGWKVDASPVIVCGEEHRFVIAEQLHENG
FT                   VDARLIVEPARRDTAPALTLAASLACADGGDAILVVMPADHSIADVPALQAALERAAQY
FT                   AEQGSIATLGVPPTRPDTGFGYIRIGAELAGGGHAIDGFVEKPAEELAAKYVAAGMYWW
FT                   NSGIFIVRASVWLDTLKRLQPEMHSACERAFSGGRQDGAYFRPLVEAFLSAPANSIDYA
FT                   VMERLTETAEPDATDGAAASAPAQPAGVVIGLDAGWSDLGSWDAVWAAMEKDANGNAGR
FT                   GRVTFEGAVSSYAHSEGRLVACVGTTNVVVVETADAVLVVDRSHVQDVKGLVSRIKAQH
FT                   APEADAHRKVRRPWGFYDSIDHGERFQVKRIVVTPGAQLSLQLHHHRAEHWVVVRGTAL
FT                   VTRGDEQFLLSENESTYIPLGTRHRLENPGKVPLEIIEIQSGTYLGEDDIVRFNDNYGR
FT                   CS"
FT   gene            669029..670414
FT                   /locus_tag="Bxe_A3866"
FT   CDS             669029..670414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3866"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3866"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29132"
FT                   /db_xref="GOA:Q144V7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V7"
FT                   /protein_id="ABE29132.1"
FT                   /translation="MRKFQDLLARVFDVALVLAGAAVASQIRFDYLAQSGFYWALVMFS
FT                   AAFALAIFPAFGVYESWRGRSKLVLAGQVSLAWLMVQGSALVLMYSLHRIDFVSRLWFS
FT                   YWTAVTGGLLIAYRLMTHAVLASARSAGMNLHQVAIVGSGSQCDAIIRRINAAPTTGFR
FT                   ATAVYNARPDVSQVISQGVPVFESVEALAGYMRTNDVHELWLMLSLSEEPLICSLVSEF
FT                   RDDLVNIRFMPDVRSLALFEGSGVIDLLGVPAINLVASPLSASSMLKKEIFDRLFALTA
FT                   LIALAPLMLAIAIAVKLSSRGPVLFRQKRKGADGHVFTIYKFRSMRLHTEQKGTVRQAT
FT                   RNDPRVTRVGAFLRRTSLDELPQFFNVLRGDMSVVGPRPHALEHDDLYQKVVAGYINRY
FT                   RIKPGITGWAQINGFRGETDRIEKMERRVEHDLYYLGHWSFALDMRIIGATIVAGLVHR
FT                   NAY"
FT   gene            670482..671621
FT                   /locus_tag="Bxe_A3865"
FT   CDS             670482..671621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3865"
FT                   /product="Putative polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3865"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29133"
FT                   /db_xref="GOA:Q144V6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V6"
FT                   /protein_id="ABE29133.1"
FT                   /translation="MSSLGLRTGSLLVFATAALLSGCGIAPGQRMVTPAAIQDTGGDYS
FT                   TEANSQQQIPITDINLALLRKMNQAQTTAPLSPQMLALFGKPTPYKVGPGDVLQIVVWD
FT                   HPELAAALGQPAQNSKTTDAAPGFLIDENGDVQFPYAGTVHVAGKDVAAIQKELHRRLS
FT                   TVYQKPEVTVRVASFRAAQVYVDGEVRTPGAQSVNDIPMSLTTAISLSGGLSPNADRSR
FT                   VVLIRNGVPYQLNMDDLIRRGRNPSDIYLQAGDMLRVASREDSGVYVMGEVNKPATILP
FT                   MRNGSLTLSQAISDSGSFDSNTAAARQLFVIRNSTSEAPEVYHLDATSPVSMVLANQFE
FT                   LQPKDVVYVGQGGLVRFNRVLNLLLPAINAAVTGAVLAK"
FT   gene            671672..673906
FT                   /locus_tag="Bxe_A3864"
FT   CDS             671672..673906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3864"
FT                   /product="Exopolysaccharide export associated tyrosine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3864"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29134"
FT                   /db_xref="GOA:Q144V5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005700"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V5"
FT                   /protein_id="ABE29134.1"
FT                   /translation="MAINFENRYTDVSGPDELHLSDYLRTIVRGWRTIAMVTLIALALG
FT                   CAYAFLAPPTYRADVLFHVEDKTANANANGKDSLPPLTGMFDTKPSTAAEIELLKSRLV
FT                   TEETVKKLHLDISAAPRYFPVIGGMIAGLVNGQWGFRLPQFINLSGYAWGDEAITVSQF
FT                   DTSKDMYDTTFTLIAGNDGSYVLRDRNGIAILSGKVGETVETDTADGPITLHVDKLVGP
FT                   AGSRFELSRASTLSTVDRLQKALVVQETTLQSGVIRASLEGGDSALTAAIVNSMAREFV
FT                   RQDVESRSTEAEHMLAFLDQQLPGLRKELDDAEQRYNKFRNTHGTVDLGEESRLLLQQI
FT                   VDNKTKLMDLQQQRAEMSQRFTANHPAVAALDAQIAALQGAAANMNRSVAVMPDTEQTA
FT                   LRLLRDVHVDTELYTNLLNSAQQLRVAKAGQVGSVRVVDFAEAPDDPVRPKRVIAILIA
FT                   LGGGLVLGILLTFFKRAMYGGVERPDELEGMLGVPVFAVVPRSQTQLKLQENVMLRRRG
FT                   LHVLAQQAPEDIAVEGVRNLRTSLQLSLDHAENNVVMITGSRPDSGKSFLSVNLAALVA
FT                   SANKRVLIIDGDMRRGDVHSHFGIGHQPGLSDVLSGGDLNAMIQRDVLPGLDVLAKGTL
FT                   PSHPAELLMSKRFETMLEELKSHYDLVIVDTPPVLAVTDSTLIGKYAGTTLLVVRHGRH
FT                   PLNEVMETAKRLRNGGVALRGVLLTDVPQEGAFLGSGYQGGYYGYDSIAG"
FT   gene            673991..675109
FT                   /locus_tag="Bxe_A3863"
FT   CDS             673991..675109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3863"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3863"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29135"
FT                   /db_xref="GOA:Q144V4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V4"
FT                   /protein_id="ABE29135.1"
FT                   /translation="MKRKVALITGITGQDGSYLAELLLAKDYDVHGIKRRSSLFNTDRI
FT                   DHLYRDPHDPDQRLFLHHADLTDSTSILRVIQRVEPDEIYNLAAQSHVAVSFEEPEYTA
FT                   NADGLGALRILEAIRILGLQEKTRFYQASTSELYGLVQQVPQSETTPFYPRSPYAVAKL
FT                   FAYWTTVNYREAYGLYACNGILFNHESPVRGETFVTRKITRAVARIAVGMQKTLYLGNL
FT                   SALRDWGHARDYVEMQWRMLQQEQPEDYVIATGVQYSVRQFVQHAAAELGVTVRFEGTG
FT                   VDEIGIVEKVEGREIKMSPGDVIVRVDPRYFRPAEVETLLGDPSKAHAKLGWQPTTSFA
FT                   SLVKEMVRADYQIARRDALVTLAGFTALEHHE"
FT   gene            675116..676075
FT                   /locus_tag="Bxe_A3862"
FT   CDS             675116..676075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3862"
FT                   /product="Putative nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="1.1.1.271"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3862"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29136"
FT                   /db_xref="GOA:Q144V3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V3"
FT                   /protein_id="ABE29136.1"
FT                   /translation="MNKQARIFVAGHRGMVGSALVRRLAADGYQNVITRSRQELDLTDQ
FT                   GAVNRFFESERIDVVLLAAARVGGILANATRPGEFIYENLVIETNVIHAAYRARVERLV
FT                   FFGSSCIYPKQCPQPIREEYLLTSPLEPTNDAYAIAKIAGVKLCEAYNREYNTQYVALM
FT                   PTNLYGPNDNYDLNSSHVLPALLRKAHEAKLNGDATLSVWGSGTPRREFLHVDDLAAAT
FT                   LFVLEHNVTEGLFNVGVGKDLSIRELAECICKVAGFDGELMFDASKPDGTPRKLLDVSR
FT                   LAQMGWQASIALEDGIASTYRDFVESHAGSTPAAAVEV"
FT   gene            676135..677331
FT                   /locus_tag="Bxe_A3861"
FT   CDS             676135..677331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3861"
FT                   /product="Putative glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3861"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29137"
FT                   /db_xref="GOA:Q144V2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V2"
FT                   /protein_id="ABE29137.1"
FT                   /translation="MRTHARCTQDDFSRSGIKMTASVTIFHNVVWSRHKGVVFSALHNI
FT                   SASGAIRYSMVQIADTEHDRVGFSDVDYSFHRYPMQKLFDGCYEDVPTMKLIARLTWEV
FT                   LRTKSDLIVLPGYHRPEYWAMLAACIVTGKRRAVFCDSTARDRPKKLLTSIPKRVFFSL
FT                   CDGYFGFGERSREYLLSLGAKRDKIFVPCQAAALPGSFSPERALVERVAARAGNPPVFL
FT                   FVGRLSEEKGIGTLIEALAGLRRRIPAAKLRIVGTGPMADALHAKVAELELGDAVTFVG
FT                   SLQDEPLTQEYYGATCMVLPSYSEPWGLVVNEALAHGCPAVVSESCGCVPELVIDGVSG
FT                   YAFTAGDVAGLQRTMLKAMEAFADAGGTARRCMDVIRRFDPPSAAANIARGCALMLSD"
FT   gene            677389..678741
FT                   /locus_tag="Bxe_A3860"
FT   CDS             677389..678741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3860"
FT                   /product="Putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3860"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29138"
FT                   /db_xref="GOA:Q144V1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V1"
FT                   /protein_id="ABE29138.1"
FT                   /translation="MKILIYGINYAPELTGVGKYTAEMAVLLADRGHEVRVVCAPPYYP
FT                   EWRVSEGYASWRYQHETRDGVAVWRAPLWVPSRPSGLKRMLHLATFAATSLPLLAWQAL
FT                   WRPHAVMLIAPTLMCAPASLMLARITRASAWLHIQDYEVDAAFDLGLLKSSRAARTARW
FT                   IESALLKRFDAVSSITRQMSARATTKGVDASKVVCLPNWVDVSTIFPLARPSEFRRLLG
FT                   IPAEQKVVLYSGNMGAKQGIETLADAAVALAARPDLTFVFCGSGAARENLLERCSGLTN
FT                   CVFMPLQPVERLNELLNLADIHVLPQRGDAADLVMPSKLTGMFASGRATIAMARRGTAL
FT                   YEAVAPRGVVVPPDNVKALAAAITVLAGDAERRTALGKAARNYAERALSPESTIRTFEE
FT                   RLAVLLRESGLEDAEDAKRAKGAPPSFGPRPSGAAGRRRRKPATAEEAAPD"
FT   gene            complement(678773..679267)
FT                   /locus_tag="Bxe_A3859"
FT   CDS             complement(678773..679267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3859"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3859"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29139"
FT                   /db_xref="UniProtKB/TrEMBL:Q144V0"
FT                   /protein_id="ABE29139.1"
FT                   /translation="MTTSLRHTASWMFFAIASCALPAFAQNAAPNPAAAAPAATAANDY
FT                   GVNAQLPANRRTAHRNSEQALLGAPNPYGTDNAQDNTDDAQRTALLDTQRMTVLGGGQG
FT                   AQPALGKGQRKAPAAANGQVRVAGQPGRPNPANALTPEAAATTTYADPYASKRGVYRSP
FT                   W"
FT   gene            679453..680073
FT                   /locus_tag="Bxe_A3858"
FT   CDS             679453..680073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3858"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3858"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29140"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U9"
FT                   /protein_id="ABE29140.1"
FT                   /translation="MGNVADDPQIGRLPQAGDARKDGRVINLRQAGKGNYQARRGALVE
FT                   LIWFVLEACVINNKLLPLSSVRVALLRLFGAKIGTGCRFVHPVRVKAPWNLEVGDNCWF
FT                   GVDVWIYNQTLIRIGSNVCISQGTFLTAGSHDMSTTMDLHVAPIVIEDGVWITSKCVVQ
FT                   MGVTIGRSAVVTPLSVVHRSLEAEGVYGGNPCRFIRKRFDSVT"
FT   gene            680295..682034
FT                   /locus_tag="Bxe_A3857"
FT   CDS             680295..682034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3857"
FT                   /product="Putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3857"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29141"
FT                   /db_xref="GOA:Q144U8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U8"
FT                   /protein_id="ABE29141.1"
FT                   /translation="MFIDTRTVEQNTVIETTVCIIGAGVAGITLALEMSRAGIDACVLE
FT                   SGGFGPDDATRDLYRGENIGLPYTFADGSRSRYFGGSSNCWGGWCRPLDPWDFEKRDWI
FT                   AHSGWPFGLDELAPYYARTHELLKLGPQNFDPAYWEREIGRQDVRRLPLATGDMRDTVA
FT                   QFSPPVRFGKAYREELSRSTRVRVFLHANVLNIDADAQGTAISRVKIGTISGRRLTMTA
FT                   RIFVLATGGIENARLLLASNNVQAAGLGNANDLVGRYFMDHPRMMSGKVRFRPGIARNK
FT                   LYDIKYHYQNAAVSAHGTKISSQFAPKQEWMEREKLLNSRVWLYSKWYGEGSAGSEALI
FT                   RLKEALMGKDQPGRSLKRDIETMIAHPLHTVGFGLTRLLQWPALITDVTLQAIVEAVPN
FT                   PDSRVTLSADRRDHFGMPRVRVEWRLGEQVQRTFDKTFQLLAQELQMANVADVTLDESL
FT                   EGRTWPAKLEGTWHHMGTTRMHDSPREGVVDRDCKVHGISNLYIGGSSVFPTVGANFPT
FT                   ITIAALALRLAGHLKRQLDLPELVGITRGDAANSAAMSLQAPPQVDTLPIAASTLTPLM
FT                   KEQ"
FT   gene            complement(682175..683389)
FT                   /locus_tag="Bxe_A3856"
FT   CDS             complement(682175..683389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3856"
FT                   /product="Putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3856"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29142"
FT                   /db_xref="GOA:Q144U7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U7"
FT                   /protein_id="ABE29142.1"
FT                   /translation="MKILHLLASVDPRAGGPVEGVRRSGAAMQQAGHEIEVATCDAPSE
FT                   AYLAAYPFPVHAFGPTRGRYSFSERLALWLAANAKRFDAVIVHGLWQYHGFAAWKALHG
FT                   SDVPYYVYVHGMLDPWFKEAYPLKHLKKWLYWPWAEYRVLRDARAVIFTTEEERTRARQ
FT                   SFWLYKAHERIVPFGTSVPQREGAPLREAFLHAIPSLRGKRIVLFLGRVHAKKGCDLLI
FT                   DAFARIASRDQTLHLVIAGPDETGWGATLRTRAQAAGVAHRVSLPGMLQGELKWGAFHA
FT                   SDVFILPSHQENFGVAVAEALGCGLPALISDKVNVWREIEADGAGMVAADTVDGTEKNL
FT                   IRWLELDDTARDAMRAQAARTFNARFRVETMVSSLTALLESKGSHEEVRETTLTTLREA
FT                   TQQSR"
FT   gene            complement(683386..684879)
FT                   /locus_tag="Bxe_A3855"
FT   CDS             complement(683386..684879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3855"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3855"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29143"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U6"
FT                   /protein_id="ABE29143.1"
FT                   /translation="MRHQYATPWIWIFLIPLAFDYKATDANTGHFAQFIFVLPAIAAGI
FT                   ALLLIAPRFHERSRLRSAVTWSMMLCVFGSIVAQLVQDNDSGNYLRVLLPFILFMLGYL
FT                   VACRPWSEFRIAQFEKALFIANVISLVFTMVYGLATGGDLEDVRFRILSVTLLGLQGVL
FT                   LHEFVVAKRFSFFTVGVFALSILIELLSVTRSVLVGTVLLFLIAVALSAPSIQHIWRAM
FT                   SRSIIIGAVLAGIAGVAALSFPTVAEHWTQRIFASEETRSGKDPTTITRLAEMRDQYDQ
FT                   VTADPAALWFGEGYGHYYRYSPVYLPDLAGQISEKDFYAINEWAAGHNFWVYQFFAGGL
FT                   LFGLAMPLVTLAALAICFFSYRYWRSVVPDAPMLPVLGRAIMLFAALPATSIGGNPLGP
FT                   RFSGLIFGVALGLMIATHARLQRALPARARRLRRPPYVRPDAMPELPGRVQPGMGRADL
FT                   PSTLGMSRTAHTARDSGQFGALVPHTPPRHRSNRPDIVR"
FT   gene            685267..686418
FT                   /locus_tag="Bxe_A3854"
FT   CDS             685267..686418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3854"
FT                   /product="Putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3854"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29144"
FT                   /db_xref="GOA:Q144U5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U5"
FT                   /protein_id="ABE29144.1"
FT                   /translation="MKLFGGAGPATAGRAVELDFVRGIAIIMVMGFHFHAVHTGNYLIQ
FT                   IIEYPLKNFGREGVNLFFTLSGFLVGGLLLRQYAETGHVDARRFIIRRIFRIWPAYYVL
FT                   IIFHVLAGRHPWNTFLIQNLTHLQNYLGTSITQTWSLAVEEHFYLVLPALLLLFARWRL
FT                   GAWTIVGVLTGICAVVLTARCFAVAGGNLEAAFAYTQYRIDSLLVGVILSAIYWMKPGV
FT                   YHQLARRKWLLVFSVVLLCAWLAFATKNLALDESIGYTIQAIGFAALIVLVLEYSGSLR
FT                   TLWIYRGVAWIGLYSYGIYLWHSLALAPGDMLIRKATAMGLAPSLIWVVALTAQFAIAI
FT                   TIGYVTTRAIEYPFLLMRNALFPEKRSSSVREEVPVAAGGQLS"
FT   gene            complement(686515..688209)
FT                   /locus_tag="Bxe_A3853"
FT   CDS             complement(686515..688209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3853"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3853"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29145"
FT                   /db_xref="GOA:Q144U4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U4"
FT                   /protein_id="ABE29145.1"
FT                   /translation="MLMIHRGRSCLFQSRLSGRAARSALVVLLAFSSGSYAQVKLQLVN
FT                   APGSQVTPASGKKVLRFEVLPPDIPRATKITVGVYPYDSDGKVLPTRLASYENTIGRMQ
FT                   DDKAFNVAVTIPRMGLFRIEATLKSPDGETLDKTTSTLAIVTKRTELGPPDFGVGTHFG
FT                   QDGTPPPSVLLPLVKQAGFSWIRDDIYWDTVEKKAGVFVFPKRYDAYLALSKQLGISPL
FT                   VVLDEGNPRAYPKLFSKSNFPLSPEARARFADYVDAVVARYGDNAVTAPYGGAVQYWEV
FT                   WNEPDFSKISYADYAALLWETFGAIKDVNPAASVIACGGGGAGGGPGGDCVVGLIKEGA
FT                   LNDQSGFSIHPYMSPHTPEKGYKTEGAPIDFVNIPTVWPYLRDFTADHMKTDGRPLQVW
FT                   VTEMGWPVNPKEPGQDEATQAANLVRSYLLSRRYGTVRVLFWYDFVDDGTDLDNIEHNF
FT                   GLLHHDLTPKPAFVAASVLSSTVGKRAWAKALVDDESVKAYQYGTDDPVFVGWTVDGSQ
FT                   RVASISLPPGEYIQRDWQGVDTPVTITAQNFRWRVGPVPRYLMPARR"
FT   gene            688497..688874
FT                   /locus_tag="Bxe_A3852"
FT   CDS             688497..688874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3852"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3852"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29146"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U3"
FT                   /protein_id="ABE29146.1"
FT                   /translation="MRCLPLSVGRGHLNEACLAGLASSVRLSTYVRSRCWGALRNPHGF
FT                   ARFPTTRRDCAAAYGQRITRLKKIQLFSGEAVVASIRSVGMIFHRVRPVVVALRVGILI
FT                   LADYQIIIHTNKNALTIRMNK"
FT   gene            689201..690652
FT                   /locus_tag="Bxe_A3851"
FT   CDS             689201..690652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3851"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3851"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29147"
FT                   /db_xref="GOA:Q144U2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U2"
FT                   /protein_id="ABE29147.1"
FT                   /translation="MTFANRPKKQQVLPHSLYSSDPAASVPRRKFLAGLVAGAGTIALS
FT                   ACGGGGGDSPAAVANDATVANKAGSSGFTVTAPAANATVSGTITVSGTAGSNWRNVAVY
FT                   DHATVAKIGADTTPSGGKFAIQLDTTKLAAGSRQIDVVAFSVPAGQAGGTKTTQTITVN
FT                   VTRAASGSTSGALFYGMNGHLAWPDGIYHTMSAAAQLALLKDLGVTNYRVDVADAGMAQ
FT                   TVANALTGAFAGSGVAIMPCINAWSTSYNQYGSESAAYTLGYNLGASIAKPLKGLVKYI
FT                   ECGNELDSDGLITNGDGSNTNNYSPAIWPAFRGVIRGMIDGVKAIDPTIQCGVNVGVPL
FT                   AYRALQMLWSGITPDGSVNGVSGAAPIRWDYTTFHWYQSSGDIICGWRNNACVNVLQIL
FT                   KDSFNVPIWLTEWGWQGSQVTPAQQASYVTTALTEYRSLKDQYNIQSVQMYCLIDPDFG
FT                   LLQADGVTKNPSYSAFKKFVAANPV"
FT   gene            690982..693336
FT                   /locus_tag="Bxe_A3850"
FT   CDS             690982..693336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3850"
FT                   /product="Protein-tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3850"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29148"
FT                   /db_xref="GOA:Q144U1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U1"
FT                   /protein_id="ABE29148.1"
FT                   /translation="MNSSVSRTPPVMLRNNVDAFSIGELARHVVDNVWLVIGIVAVVTG
FT                   AAALYAFVATPIYSADALVKVDFPQPNALGEASKAQEQVVPPTLPTEAEIQIIQSRSVI
FT                   APVISKFRQDISITPNRIPVIGALISQFAAPGTPMAAPFGLGSFAWGGEEASVGSLTVP
FT                   AWLEDESLTLTVLPGGHYRLTDPKGRTLLTGAPGVPTQANGVALTMDRLIARPGTEFTL
FT                   VRFSDVKAIERFQHQLKVSESGKDTGVVQIIYENPDPELARAIANGIAQGYIASHIAQH
FT                   RAEALTTREFIVGELPQLHANLTQAEAELSQFRTASSSMQASTEAASYLQGSIEFDRQI
FT                   AMLKVQKAGLESHFAANSRDVQAIDNQLQLLENAKSAFEARFDQLPASERRSADLTRNV
FT                   KVAEDIYVAMVNKSNELAVTQAGTLGNVHIIDTALLPVDPVKPKRPLVIAVGAAGGLIL
FT                   AILYVFIRRLSSSALGNSIVAERHLNLPVFGHVLFSDEQARLDRVQNSNSQLAKKGLSG
FT                   KVQQTVAASATGSALRLTYSGVTPQDSMLAGGRFLLATDGYDDIPLEALRGIRATLQRQ
FT                   IQDAANNVLVVTGATPGTGKSFISSNLAVLSAEAGKRVLLIDGDMRRGQLAAIMKQTGA
FT                   GGLSEVLTGRIDVDHVIRNTDVHGLSFIAAGRYPSNPSQLLSTSRMQQLLERLGELYDV
FT                   VIVDTPPVLAVSDANLIASLAGSTVLVVRPDAQSDRELEEAAQRLDRAGARLVGMIFNA
FT                   MPRRRSEKRSYGYAAAYSAASVPPQQQHGAS"
FT   gene            693387..694547
FT                   /locus_tag="Bxe_A3849"
FT   CDS             693387..694547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3849"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3849"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29149"
FT                   /db_xref="UniProtKB/TrEMBL:Q144U0"
FT                   /protein_id="ABE29149.1"
FT                   /translation="MYPRLVSLLFYMFFTCVILNPQVNGITLYFYLVIPFLDPDFSRFL
FT                   ASTARRWAGPLLIAVIASALTSPSSAVRILSIGICIGYLMYTTERRIGYLHTWMVINIL
FT                   FATVQFAMYYINRDFSIQLGPTNLSTLIWGDYATMTNTNFYEVFYFTRVSGFSREAGFF
FT                   SSLLVASLILHLFSDSPNKKLIALYLFGLFISFSKSSMVLFLFAALYPFRDRLRQVHPL
FT                   VVMIAYYVVVSAISVYLAHNDFFGSDTFAHRLAGYAFMFDARLEDIVKGITAQDMMAHY
FT                   KYLPYIRLIQDDMSLGALFGGLPGTIAELGIFSALVVFAVIAFTASDGFVMMIFLFISA
FT                   TVSVTTVTSFIPLAYLICYWPRFVEYSAQRVKSAHHYQPLPGYCKT"
FT   gene            complement(694684..695889)
FT                   /locus_tag="Bxe_A3848"
FT   CDS             complement(694684..695889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3848"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3848"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29150"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T9"
FT                   /protein_id="ABE29150.1"
FT                   /translation="MAADAMEQDYVLIVEPNLTGHRWRYVEWTMQACAEAGYPCMLVTE
FT                   CANEDHRLARQITAANRPDQQIAFVDPEERPRNRLREPNEYWRFHRYFRRVYTIISRMQ
FT                   AIRLVVVPYVDYFFYSLPFLGSPFGDTPWIGITMRATFHHHKVGIKAPDRPFVNAIKAQ
FT                   LFKRAIRTTGLRTLLTIDPTLPEWAARSTSKHSAAIAYVADPFPDEQAENPALARQRLG
FT                   LDPDQRYLLVYGAITERKGIYELVHALTRLDHAPTLIVAGEQDAGTRHFMRNHVRSLKP
FT                   APLILDAFISNDTERDLFSACDAVWLGYKGHYGMSGVLVQAYRFGKPVIATEDGLIGWF
FT                   SRRCELGPILSDLSSASIGRAITETMTSWPHAPQAAPSARDDLLSRHTLGQFKQTLLQQ
FT                   MA"
FT   gene            696156..697469
FT                   /locus_tag="Bxe_A3847"
FT   CDS             696156..697469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3847"
FT                   /product="Polysaccharide exporter, PST family, MOP
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3847"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29151"
FT                   /db_xref="GOA:Q144T8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T8"
FT                   /protein_id="ABE29151.1"
FT                   /translation="MREIAVRGRVNGAAIRRRNSLRAIRLPAFSMAGSFGASAATWVLL
FT                   QQFAVRGLVAIKFLAIGRMLGPAAIGSVSVALLAVAIAEALSDTGLAQAVIQGEHPPSR
FT                   SQLGAVWTTLTARGVLISLLLVALAPLLSSQFHLNGSLVLIQLAALLPLLRGLASPAYY
FT                   VVQRERRFQHIAGVEVAAAFVDCAVGLVLAYFGAGAASVLIGLVAGESLKSTLTWATMK
FT                   PRPPIRAVWSGIGHYVGFSRWIWASSVINLLLNQFDKVVVGKLLGPAQLGSYQMSSRLA
FT                   QMLLADAAIAMSQYLFPTFAAHYRRNPQAASRVIKIYLLVIAIGLTAFVALLRLIAEPL
FT                   FSLILGAAWLPAVPLFRILVINMAIGALIAVLVAYLRAVGDAKATVHASAIQVVVLLLS
FT                   APPAVHFWGVTGIAWSMTLGLGCAAAWMLFRTLTARTS"
FT   gene            697466..698542
FT                   /locus_tag="Bxe_A3846"
FT   CDS             697466..698542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3846"
FT                   /product="Putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3846"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29152"
FT                   /db_xref="GOA:Q144T7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T7"
FT                   /protein_id="ABE29152.1"
FT                   /translation="MMRVFHLVLAPRLSGAEVLAKDLALDQCAEGMAVCVASLLPAHAE
FT                   FAPLQDDLQRHGVQCVFPRRRHRALVKLCHLFGAVRRFRPDVIFAHATIPSFYARALPL
FT                   RVPVVYVMHSATNDFERPLFRRIEHILSGRARVVIGVSEQGVTDYVQAIGPHPSMTVVP
FT                   NGVDLARFSFTDGVERDGRTPQVVQIGRYAAVKNQLATVRAFSEVLMKGKDARLVLYGV
FT                   VEDPDYQRAVVALAKELGIAERVVVAGPRTDVATVLSESNVFVMPSQSEAHSVAFLEAL
FT                   ASGVPIVASKIPAFAFANGFPGVQLIDTDNVQCYAEAVIAALGQERAQRSLTGLTLRDT
FT                   ADRYRAIARQVSLAVPAR"
FT   gene            complement(698599..699723)
FT                   /locus_tag="Bxe_A3845"
FT   CDS             complement(698599..699723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3845"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29153"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T6"
FT                   /protein_id="ABE29153.1"
FT                   /translation="MLSDLTSDQHDSPRCGHCGVPLAGRFTPCPSCHQRPVDAPRAHAA
FT                   PRPSLKVPLNEPLNDPQSLVDSRLPARKLWDPSSRALVNSYEFVEEPAVAVSAYQRLRQ
FT                   PLVVAASALTVTSAVYLGFIHSNDSKVGTPIAVSGKVQTQNAAPLAVVPQQPAAAVTQR
FT                   SATAIPQKSITILAQTPAAAVPQKPAAIVVAQKPASGAAIRSAPVRSPPAPPAAATPPL
FT                   SRRVASVEPDAKRNPGGQSGKPPDKPRADVSRHLRAARADLQQNNLSATRVRLAAAISV
FT                   QPDNRDALNMRATLNAREQQRDALLSLARGCGYIARWNCVSHNAGTALQIDSSSKEAQR
FT                   LVMLAQHEAQLQIPPPVEPAPEPAPDMRDLNSHH"
FT   gene            complement(699803..700411)
FT                   /locus_tag="Bxe_A3844"
FT   CDS             complement(699803..700411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3844"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3844"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29154"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T5"
FT                   /protein_id="ABE29154.1"
FT                   /translation="MQIKTYTVLTLVVFSSAAFAWQPLTYPIRSQSPYQRSIDTAMCYA
FT                   TANRQTKVNIAREPQTPPRKPAAAKTSSTGVPSRPPLPSSTFSSTPIGASMPAAAEAPG
FT                   ASAPAATTAAAARGAAAPKAASATQAGTTTTATATAATGASATSADNGASETAAASAAQ
FT                   VAAASGVKLPPLPAPEPPMTQYWAAYGACMQARGYVVAQ"
FT   gene            700621..701115
FT                   /locus_tag="Bxe_A3843"
FT   CDS             700621..701115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3843"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29155"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T4"
FT                   /protein_id="ABE29155.1"
FT                   /translation="MAEKSGVSLGDAAFLRDLWIGLGAARLLDVAEPVFRARAFGNGGL
FT                   RPSRDQFTIDELIAPFHPVPDGFLFSQPFRLGCHGTVIDRRSGTSTDAYAGNPRAALVG
FT                   FGPYDDLKLAIRNSACRHRFLLCSVRDRHSARLLPARAHHAVIPSPPTAGYSAWFRRGE
FT                   A"
FT   gene            701202..701582
FT                   /locus_tag="Bxe_A3842"
FT   CDS             701202..701582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3842"
FT                   /product="Transcriptional regulator, TraR/DksA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3842"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29156"
FT                   /db_xref="GOA:Q144T3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T3"
FT                   /protein_id="ABE29156.1"
FT                   /translation="MAQQQSELSGEFIAQQRERLEALRREVLGGEENTLSEEQAAQGER
FT                   GDEAEEYEDEAQTMAQKEVSQALRDVNEHRIADIQRALQKIEQGTYGLSDESGLPIPKA
FT                   RLEATPEAIFTVEEQSRRETGK"
FT   gene            701767..704049
FT                   /locus_tag="Bxe_A3841"
FT   CDS             701767..704049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3841"
FT                   /product="Oxidoreductase alpha (molybdopterin) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3841"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29157"
FT                   /db_xref="GOA:Q144T2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T2"
FT                   /protein_id="ABE29157.1"
FT                   /translation="MTTRREVPGIRPYDGPAGGWGALRATAQAVRTQMENIEAPITLMR
FT                   TNQPDGFDCPGCAWPDKEHKSTFQFCENGAKAVTWEATTRRVGPEFFENNTVSSLLQRS
FT                   DFELEDLGRLTHPLVYDRATDKFRAVEWEDAFARIGEVLRGLSSPDEAEFYTSGRASNE
FT                   AAYLFQLLAREYGTNNFPDCSNMCHEPTSVGLPQSIGIGKGTVSLDDFDSTELILSIGH
FT                   NPGTNHPRMMGTLHECSRRNVPIIVFNPLRERALERFADPQSVVEMATFGSTRIASTYF
FT                   QVDAGGDAAALKGIMKALLVMDAEQGKTVLDHEFIATHTQGFEAFAADLEATSWDDIEK
FT                   ASGLTREDLEEVAIAYAKSNATIVTYGMGVTQHNKGTANVRLIADLLLLRGNIGKPGAG
FT                   ICPLRGHSNVQGNRTVGITEKPSEAFLKQIENVLGFKPPAAHGHDAVQAMQAMIAGTAR
FT                   VLICLGGNFAVALPDSGQSFPAMSKLDLSVHLGTKLNRSHLLVAKETYVLPVLGRTELD
FT                   IQANGRQSITVEDSMSMVHASSGKLKPASEHLRSEPAIIAGIATAALPNSKVAWSELVA
FT                   DYDRIRDLIEQTVPGFEAFNARIRVPGGFRMPLPPTERAWPTPSGKAMFSVYGGVREDA
FT                   DVLGADNVLRLITIRSHDQYNTTIYALDDRYRGVFGRRDVLFMNEDDLAERGLEHGDLV
FT                   DIETVLAGRQLRLKKITAIAYNIAPGSVAAYYPEANVLVPLDFIDKESGTPSYKSVPVH
FT                   VMRSAET"
FT   gene            704094..705482
FT                   /locus_tag="Bxe_A3840"
FT   CDS             704094..705482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3840"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3840"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29158"
FT                   /db_xref="GOA:Q144T1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T1"
FT                   /protein_id="ABE29158.1"
FT                   /translation="MEIFDAFHLARLQFAFTVSFHIIFPAISIGMASFLAVLEWRWLLT
FT                   GDVAYKDMFLFWSKIFAVGFGMGVVSGVVMAYEFGTNWSGFSSVAGNITGPLLTYEVLT
FT                   AFFLEAGFLGVMLFGWERVTPRAHFFATLMVAVGTLISTFWILASNSFMQTPQGFAIEG
FT                   GRIVPVDWMKVIFNPSFPYRLAHMTIAAFIVAGFIVAACGAWHLLQGRRDKPVTRSFSM
FT                   ALWILLFLTPIQIFVGDAHGLNTREYQPAKIAAIEGLWETEKGGTALNLVGLPDMDAEV
FT                   TRYTLQVPHLGSLILTHSWDGEIRGLKEFPPQDRPYSPIVFWTFRIMAGLGMLMLLTTL
FT                   LGLVLRVRGRLYETRWFQRFVLCMGPSGIVALLAGWITTEVGRQPWTVYGVLRTADSVS
FT                   PIGSQQAGVSLLIFVMVYFLVFGMGFYYMMKMMKRGPEEHVERRDSRRHPVLRNRPLDA
FT                   LEGE"
FT   gene            705487..706494
FT                   /locus_tag="Bxe_A3839"
FT   CDS             705487..706494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3839"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3839"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29159"
FT                   /db_xref="GOA:Q144T0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q144T0"
FT                   /protein_id="ABE29159.1"
FT                   /translation="MQIDLPVVWAAIIGLGVFIYVMLDGFDLGIGLLFPFFEEKGDRQV
FT                   MLNTIAPVWDGNETFLVLGGAGLYGAFPVVYSTLLPANYLPLILMVVGLIFRGAAFELR
FT                   GKAVRTQHAWDLAFMGGSALAGLCQGIVLGSLLQGIRIVDGRFAGGPFDWLSPFSLFCG
FT                   IGVLTTYAALGCGWLILKTDGELQRKMREVMRPLVSVLLGVMAVVSLWTVIGLPAVAHR
FT                   WFGSGNLGWFLPVPVLVIVCVWGIFRSLRLRHEATPFLLTLALCFLGYSGLLISIWPNI
FT                   VPPSLTIWEASSSHSSQLFTLVGTVIVLPVILVYNVMQYRVFRGKVREGDAGYH"
FT   gene            706532..707443
FT                   /locus_tag="Bxe_A3838"
FT   CDS             706532..707443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3838"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3838"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29160"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S9"
FT                   /protein_id="ABE29160.1"
FT                   /translation="MIVRPGQNWFRLLFVWNGSVLQSIIPQLIFMAIVSSLAVLTQGRI
FT                   FGAKIPLNTAPFTLFGLALAIFLAFRNNASYERFNEARHLWGSLLISARALTSQMLCYV
FT                   PRGEDRIRMAHGLIACVYALKHQLRGTDPNPDLIRFLGRTRTEALQHACYKPAALLNEL
FT                   RRDFADLQVRAVVSETKLWMFDAQVNELGKTIGGCERIASTPIPFAYSVLLHRTVYAYC
FT                   VLLPFGLVDSTEFFTPLLCVFISYTLIALEAIASEVAEPFTVAPNALALDAMTRNIERS
FT                   ILELCGCELPDEVVPVRPYQLT"
FT   gene            707718..708788
FT                   /locus_tag="Bxe_A3837"
FT   CDS             707718..708788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3837"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3837"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29161"
FT                   /db_xref="GOA:Q144S8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S8"
FT                   /protein_id="ABE29161.1"
FT                   /translation="MASRFGVTAGGVVSTFDKLGRPLRDLRLSVIDQCNFRCTYCMPRE
FT                   TFGADYPFLASSERMSFEQILKLAKAFTLLGVEKIRITGGEPLLRRGLESLIEQLAKLT
FT                   TASGKPVELALTTNGSLLAAKARSLRDAGLGRVTVSLDAVEDAVFRRMSDVDMSVARIL
FT                   DGIEAARAVGLEPIKVNSVIERGVNESQILPLVRQFRGTGVAVRFIEYMDVGGAGGWSN
FT                   TKVMTAREIRGIVESEFPLVPVVVREQSGTAVNYLHADGAGEVGFIASVSQPFCGSCSR
FT                   ARVSADGQLYSCLFATHGTDLRPWLTDTATAGQLAERVRSRWTQRDDRYSELRSTQRKP
FT                   ASGKVYPTVRMSLVGG"
FT   gene            complement(708872..710296)
FT                   /locus_tag="Bxe_A3836"
FT   CDS             complement(708872..710296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3836"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3836"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29162"
FT                   /db_xref="GOA:Q144S7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S7"
FT                   /protein_id="ABE29162.1"
FT                   /translation="MNLYEKLAEDIETSIRQGVYRHGERLPSVRQISQQHRISVTTAIR
FT                   AYLLLESRGLVTSRPQSGYFVNRRDESERKALELRPSKPIPISSPVDVSRLVLSTLRSI
FT                   GVDDAVPLGSPYPDPSLFPFERINRYAYDAGRGKAQWGVTDALPPGNAKLVRQIARRYL
FT                   ENGMAVDPNEIIITVGATEAINLCLQAVAKPGDVIAVESPTFYAMLHAIERMGMKAIEV
FT                   STHPEHGIDIEALAAIVESQPIAACMVMPNFQNPLGFLMPDERKRELVELLTKRNIPVI
FT                   ENGVYNELHFDSPHPSTLKSFDTKGLVLHCSSFSKSLTSAYRIGWALPGRYRDQVEKLK
FT                   FLNTLTSPSIPQLAIAEFLERDGFEHHLRKVRKAYAQQANLMKAIVSRFFPEGTRMSNP
FT                   AGGYVLWVELPPRVDSMRLYKLALDQGITIGPGYMFSVSETTYRNFIRLNYSSPWSGEI
FT                   EQAVITVGKLVSMCAS"
FT   gene            710567..711556
FT                   /locus_tag="Bxe_A3835"
FT   CDS             710567..711556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3835"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3835"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29163"
FT                   /db_xref="GOA:Q144S6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S6"
FT                   /protein_id="ABE29163.1"
FT                   /translation="MNLLEAMRIYVRVVERGNISSAARDLDIGQPAASERIDRLEKYLG
FT                   CRLLLRSARALNCTPDGVTFYERSRRILNAVEQAVAEVSNEEQALRGTVRIAAPHCFGE
FT                   TVVPRALTLVRAAYPQLDLELILNDRTVDLATEGVDASFRLGQLGEGAFIACQLGQVGR
FT                   VLVAAPEYLSRHGPVAAPPDLVKHPFIRLQGMFGTDQLPLRRMENVVESAPVHTVVKTS
FT                   HWRPMYEMIVSGAGIGVVEEPACVDALTDGRLVRILPRFDALPFDLHVLTQAQRPVPAR
FT                   VRMVVTMLKTCIQEILLGVHVDGRSVASRLEVLPEDEASTLLKSSLRA"
FT   gene            complement(711716..712519)
FT                   /locus_tag="Bxe_A3834"
FT   CDS             complement(711716..712519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3834"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3834"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29164"
FT                   /db_xref="GOA:Q144S5"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S5"
FT                   /protein_id="ABE29164.1"
FT                   /translation="MNNLHRELAPISRAAWSQIEDEVARTFRRSVAGRRVVDVKGPGGT
FT                   ELSGVGTGHQTAIAAPQQGVVAKLSEVKSLVELTVPFELQREAIDSVVRGAKDADWQPA
FT                   KEAAKQLAYAEDRAIFDGYQAAGIGGIREGSSNPSLALPADVSDYPNAISNALEQLRLA
FT                   GVDGPYSVLLGADAYTALGEARDQGYPVIEHIKRIVNGDIIWAPALAGGSVLSTRGGDF
FT                   ELHLGEDLSIGYTSHTDTVVRLYLRETLTFLMLTSEASVSVTQAE"
FT   gene            complement(712512..713576)
FT                   /locus_tag="Bxe_A3833"
FT   CDS             complement(712512..713576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3833"
FT                   /product="Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3833"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29165"
FT                   /db_xref="GOA:Q144S4"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S4"
FT                   /protein_id="ABE29165.1"
FT                   /translation="MPKDIPEPQAICNDVTRSAIFIVATIEAGRDHADKVRAWCGDVAA
FT                   LVRSVGRRVPSGNLSCVCGFGSDAWDTLFGAPRPAGLHPFREFGSGERLAVATPGDILL
FT                   HIRAEHMDLCFELATQLLGALGDAVTVTDEVHGFRNFDMRAMVGFVDGTENPAGRAAEK
FT                   FTLIADEDPEFEGGSYVIVQKYLHDMAGWNALSVETQERIIGRTKLSDIELDEAVKPSC
FT                   SHSSLTTLTENGEEVKILRDNMPFGRPGAGEFGTYFIGYARSPAPTEQMLENMFVGRPP
FT                   GNYDRLLDYSRAVTGGLFFVPSATLLEALADRDPQASAAAADGGQQPDTSSSAEPQEGG
FT                   SLNIGSLKGISQYE"
FT   gene            713767..714033
FT                   /locus_tag="Bxe_A3832"
FT   CDS             713767..714033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3832"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29166"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S3"
FT                   /protein_id="ABE29166.1"
FT                   /translation="MTARRSWRSRFSQILYRCGTLWKLHKGIGVQFPYACLVDTAWRYH
FT                   DCFPILDIGIRSFLFSVTWLLKCIAPDSGSERGRVAGSRTENV"
FT   gene            714092..714532
FT                   /locus_tag="Bxe_A3831"
FT   CDS             714092..714532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3831"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3831"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29167"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S2"
FT                   /protein_id="ABE29167.1"
FT                   /translation="MTLPADEHLTRQTIEGFYRAIEQKSVALLRQVVTPDWEYIPEPVG
FT                   AAAGPDQMVQFFENIAKAIPDMKVTILDVLVHGDRVGVRAEISGTQTGTLLGIAASSKH
FT                   IRFAIHSFHQMRGNLIAKTWHLEDWLSVFRQLGALPQTLERS"
FT   gene            complement(714740..714988)
FT                   /locus_tag="Bxe_A3830"
FT   CDS             complement(714740..714988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3830"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29168"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S1"
FT                   /protein_id="ABE29168.1"
FT                   /translation="MGRSGFTSIARTDVSHHQLEQDLAHLEHIFPQLVANSALGLGYWR
FT                   QRITALETEQGSLPDGARRVTRLLSMIDQIDDAIRLP"
FT   gene            715723..718083
FT                   /locus_tag="Bxe_A3829"
FT   CDS             715723..718083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3829"
FT                   /product="Cation/heavy metal (cadmium/manganese)
FT                   transporting (P-type) ATPase"
FT                   /EC_number="3.6.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3829"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29169"
FT                   /db_xref="GOA:Q144S0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:Q144S0"
FT                   /protein_id="ABE29169.1"
FT                   /translation="MPAPIPEAASQPDAVPGTGLSSTEARRRLAESGANTLPDTAASTW
FT                   RMMLGKFWAPVPWMLEAAVVLQCVLGRFVEAGIIAGLLVFNAILGVFQESRAQATLAAL
FT                   KSRLAMNASVLRDGAWSIVPAADLVKGDVVKLSLGGVVAADMRIVSGNALLDHSMLTGE
FT                   SVPIEATSGTQTFAGALVRRGEALALVTATGTHTRFGRTAELVRTAHIASSQQTAVLLV
FT                   VRNLAAFSVAVIALLVGYALYLHMPLADIVPLILTAVLASIPVALPATFTLSAALGARA
FT                   LAAQGVLSTRLSAVDEAGTMDVLCADKTGTLTCNALTVSTVAPMPGFDMNRVLILAALA
FT                   SAAGSQDPVDKAILDAASSVAPTPEDSVLKLVALKPFDPSTRTSEASVSDPSHGIQRIV
FT                   KGASAAVISLSQASPEAAARTAELEGQGLRVLAVAAGTADALQVVGLVALSDPPRADSA
FT                   AFIEELHGLGVRVVMVSGDAPATAASVAQAIGLTGPVCPPGSMPDRADPQSFAVFAGVL
FT                   PEDKYKLVKAFQQTGHTVGMCGDGANDAPALRQAQIGIAVSTATDVARSAAGMVLTEAG
FT                   LGGIVTAVKEGRLTFQRILTYMLNSVLKKIATAFMLVIGLLVTGHAILTPLLMVILMIA
FT                   GDFLAMSLTTDRVEPSPSPNVWRISNLTVVGVFVGFALVAFCSGVLALGKFAMGLNLDA
FT                   LRTLTFVLLVFGGQATLYAIRHRRHMWGTRPSVWVMASSVADVLIAAGLAIGGIAMTAL
FT                   PPMLIGGVLAATVVFAFVLAAAKIPLFARLKIS"
FT   gene            complement(718165..719250)
FT                   /locus_tag="Bxe_A3828"
FT   CDS             complement(718165..719250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3828"
FT                   /product="Conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3828"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29170"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R9"
FT                   /protein_id="ABE29170.1"
FT                   /translation="MSTPQRRSASTPLMPESGALPPPAKPGVETGLVRIAPGLLGKTSR
FT                   LRSVMVWVVGVMGCIAVILVVLHLGSLQKMAELIRSARPGWMLVALAVQCGTYVSAAFV
FT                   WRQTLREAGHPLSLRTLTPLGIAKVFTDQVLPSGGISGTMLVVRGLTGRHVPAGIAMAA
FT                   MLVGMVSYDIAYLLVVLASAGMLWWQHRLNTALVIGVAVFVVVTVAVPAAVLGLKQWGQ
FT                   RAPIAWLSKWLGVTTLLRQLTDAPTHLLRSPRLLLQTVGLQLAIFVCDALTLWLAFNAI
FT                   GEVPPLWVVFVSFIIASMVATIGPIPVGLGTFEATSVGMLNLLGVSVEAALAATLLLRA
FT                   LTFWLPMLPGIWLARREIRLH"
FT   gene            complement(719400..719963)
FT                   /locus_tag="Bxe_A3827"
FT   CDS             complement(719400..719963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3827"
FT                   /product="Putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3827"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29171"
FT                   /db_xref="GOA:Q144R8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R8"
FT                   /protein_id="ABE29171.1"
FT                   /translation="MYKRILVAIDGSETSGHAFDTALQLARDNGAQLQPLYVIDNPLMA
FT                   YDASGYDPTALRDASMQEGRQLLADALARMKHENVAGEPRIVDVAPIGEDISERIRISA
FT                   NEFNADLLVLGTHGRRGFKRLFLGSVAERVVRSASLPVLLVPSRQAQTTVVQAARPGHA
FT                   DVAAAMYELPVSGGHVHGGDAQPQ"
FT   gene            720325..721710
FT                   /locus_tag="Bxe_A3826"
FT   CDS             720325..721710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3826"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3826"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29172"
FT                   /db_xref="GOA:Q144R7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R7"
FT                   /protein_id="ABE29172.1"
FT                   /translation="MTFLKSPPPTPEDVADEYAATISGSSLPKYRIPEASSDRRAVFDL
FT                   VRDELFMDGNSRQNVATFCTTYADDEVRHLMDLSIDKNMIDKDEYPQTAEIEMRCVHML
FT                   ADLWHASKAWKTTGCSTTGSSEACMLGGLALKWQWKKRREAQGKPTDKPNFVCGPVQVC
FT                   WAKFARYFDVEMRQVPLRGEATGLTPEDLAEYCDENTIGVVATLGITFTCVYEPVKALA
FT                   GALDALQANVGLDIPIHVDAASGGFVAPFIQPDLEWDFSVPRVKSINASGHKYGLAPLG
FT                   VGWVVWRSTQDLPDELIFRVDYLGGDMPTFALNFSRPAGQIIAQYYMLLRLGREGYRRI
FT                   QQECADTAQALADGLAKIDQLEMIYDGRGALPAVCYKLKHPETAGFTLFDLSDQVRMRG
FT                   WQIASYELPAGREDTIVQRVLIRRGVTRDMAAMLLEDIRHAIGHLTKNPVLHSSAGPTF
FT                   HHN"
FT   gene            721738..723258
FT                   /locus_tag="Bxe_A3825"
FT   CDS             721738..723258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3825"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3825"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29173"
FT                   /db_xref="GOA:Q144R6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R6"
FT                   /protein_id="ABE29173.1"
FT                   /translation="MDNTVTAAAAAPAADAAKRGKYLSVTAIGLMTAAAVVTSLRGLPL
FT                   LAKEEMTMFVYLAFTVVFYLIPASLISAELGGAFADRPGGIYTWVAEAFGTRWGFLAIW
FT                   LQWIQNVVWYPVALTFGAAALAYTIGRPELAKNGVYVGIFCIVAYWLATWVVLQGVEVF
FT                   ARIANWTFVIGTIVPGLVLLALLGYWISSGHPLGWQHLNDAALSQDGHARFWPAIHGFG
FT                   TISFLAGIMLLFAGVEVQAVHVIDMRSPSRGYPAAIGLGALISVLIFALGALPIAAILP
FT                   YEKISLQSGVFDAFSAVLVDIWHMNWAVSALSLLVGVGAISGVLAWLGSPSRGLLETAH
FT                   EGELPPILQAKNRKGMPTHILLVQGLIVTVISCFYFVIRDVSVAFFLISAMTIALYLIA
FT                   YMLMYAAAIRLRYSAPALPRPFTVPGGFAGMWLTAGIGFAGVLFSFVVSFFPPDQLPVG
FT                   SPWLYTGLVVIGIVVFAGIPLIIHHVRRSDWASVHDTPRVPPAVIPVE"
FT   gene            complement(723373..723924)
FT                   /locus_tag="Bxe_A3824"
FT   CDS             complement(723373..723924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3824"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3824"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29174"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R5"
FT                   /protein_id="ABE29174.1"
FT                   /translation="MTPYDVVIAVFDDHHNADAAVRKLIDGGFDMKNFSVIGKGYHTEE
FT                   KIVGLYTVGDRMKMWGKYGAFWGGLWGLLMGGVFLTIPVLGPVVVLGHLAVMIVSAVEG
FT                   AVVVGALSALGATLVHMGLPKDSVIHYEAAIKADGFIVMGHGTPDEMARAKAVLALHQP
FT                   TRLDSHEGLTPAEPSTHETA"
FT   gene            complement(724326..724658)
FT                   /locus_tag="Bxe_A3823"
FT   CDS             complement(724326..724658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3823"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3823"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29175"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R4"
FT                   /protein_id="ABE29175.1"
FT                   /translation="MRCRADRGPRRIRTVPDQSKTKVPGSIKTREQVMRQNIQKLCQAR
FT                   IHTFTPECVELQDGTFDFHLRHAVEGTLPSADRHYEVGVFSTSEEGYAAALAYGDKYIA
FT                   EHKFGM"
FT   gene            complement(724655..725461)
FT                   /locus_tag="Bxe_A3822"
FT   CDS             complement(724655..725461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3822"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3822"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29176"
FT                   /db_xref="GOA:Q144R3"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R3"
FT                   /protein_id="ABE29176.1"
FT                   /translation="MLRSIQDLHGSTVSALDGDIGSVVQAYFDDESWGVRYLVVDTGNW
FT                   LNDRQVLVSPYSVEHTDPGSDIVHVSLSRQQVSDSPILDTHKPVSRQHEIEYLHYYSYP
FT                   TYWGGPNLWGMGAYPAYDPTGVAPDAVPDAPPDPTLPANDTQPDVHLRSTNEVKGYHLK
FT                   TADGSIGHVSDFIYDDTDWAIRYLVVETRNWWPGGKAVLIATRWIDAVNWLDSTVSTAL
FT                   TRDVIRNSPAYDDSMPVGRRYEVDLHRFYDKQGYWPGAGDEKIPSQ"
FT   gene            complement(725535..726125)
FT                   /locus_tag="Bxe_A3821"
FT   CDS             complement(725535..726125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3821"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3821"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29177"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R2"
FT                   /protein_id="ABE29177.1"
FT                   /translation="MLRRTFIWGTPGSLLALGTVLSGCTTTPSSDASRSEQRDKRRSID
FT                   AGVDSTLARVYGLAGGSRELVGKAHGVLTFPSVIDAGFVVGGQYGEGSLRVGGRTVGYY
FT                   STATGSIGWQIGAQSRAIVFLFMTDDSLNRFRSRDGWSAGGDASVAVLKVGANGDLDTS
FT                   TASGQVDAFVLTNTGLMAGASLQGTKVTRLTSL"
FT   gene            726573..727292
FT                   /locus_tag="Bxe_A3820"
FT   CDS             726573..727292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3820"
FT                   /product="Cyclic nucleotide-binding domain (cNMP-BD)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3820"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29178"
FT                   /db_xref="GOA:Q144R1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R1"
FT                   /protein_id="ABE29178.1"
FT                   /translation="MAQGHQENENHLLAVLPDLEWERLAPHLVLMDMPLGNVVYESGDR
FT                   LNYVYFPTTCIVSLLYVMEDGASAEIAIVGNEGLIGIALFMGGETTPSRAVVQSAGKAY
FT                   RLDAQILKEEFHRAGPVQRLLLRYTQALITQMAQTAVCNRHHSIDQQLCRWLLLSIDRL
FT                   SSNELKMTQELIANMLGVRRSGVTEAALKLQDAGLIRYSHGHIEVQDRPGLEKRVCECY
FT                   GVVKREFDRLLPALKAL"
FT   gene            complement(727439..727879)
FT                   /locus_tag="Bxe_A3819"
FT   CDS             complement(727439..727879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3819"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29179"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:Q144R0"
FT                   /protein_id="ABE29179.1"
FT                   /translation="MLRVASLQEDNRMINEADLDMDAHDLNPAALERALRSASLDLQQI
FT                   IATVAGRYLDSGRRRYSSGARSPTWRTLLTIDEQVFENRGFRARHNEAVRSTFVRFGDS
FT                   RLSGVDLDEPVDWKRDDDDLPAVYLLVRALVQADATDMATQD"
FT   gene            complement(727879..728160)
FT                   /locus_tag="Bxe_A3818"
FT   CDS             complement(727879..728160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3818"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3818"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29180"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q9"
FT                   /protein_id="ABE29180.1"
FT                   /translation="MNQLIRILNDGDRETLEWLRKHVGDVRVAAAARHLGSNGKPYLSA
FT                   VCRYLGVRPPMPRQPGRPVEDCTVGDDYLAQIRQLLAQRNRASLKHQL"
FT   gene            728243..728653
FT                   /locus_tag="Bxe_A3817"
FT   CDS             728243..728653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3817"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29181"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q8"
FT                   /protein_id="ABE29181.1"
FT                   /translation="MAEKEDGGQGRCAIGGRASSGGRRTSTVPRGARWAVYKDHESSGP
FT                   HDIGSAAIGGGVASATVGSGVSGDARERISVRAGTNQFMVIAPTTNKSSKGFPWTAGPT
FT                   TPDERTPPDRALRRTVVWPYCACDVANRWVLL"
FT   gene            728918..729208
FT                   /locus_tag="Bxe_A3816"
FT   CDS             728918..729208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3816"
FT                   /product="10 kDa chaperonin, GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3816"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29182"
FT                   /db_xref="GOA:Q144Q7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q7"
FT                   /protein_id="ABE29182.1"
FT                   /translation="MNLRPLHDRVIVKRLDQETKTASGIVIPEAAAEKPDQGEILAVGP
FT                   GKRDDKGAQIALDVKVGDRVLFGKYAGQTVKVDGNELLVMREEDIMAVVQK"
FT   gene            729263..730903
FT                   /locus_tag="Bxe_A3815"
FT   CDS             729263..730903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3815"
FT                   /product="60 kDa chaperonin, GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3815"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29183"
FT                   /db_xref="GOA:Q144Q6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q144Q6"
FT                   /protein_id="ABE29183.1"
FT                   /translation="MAAKDVVFGDSARAKMVEGVNILANAVKVTLGPKGRNVVLERSFG
FT                   GPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGM
FT                   KYVASGMNPMDLKRGIDKAVFAAIEELRKISKPCTTNKEIAQVGAISANSDSSIGDRIA
FT                   EAMDKVGKEGVITVEDGKSLQDELDVVEGMQFDRGYLSPYFINNPDKQVAVLENPFVLL
FT                   HDKKVSNIRDLLPILEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVAKENTTIIDGAGEAA
FT                   NIEARVKQVRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVAGGGVALIRARTAIAGLKGANADQDAGIKIVLRAMEEPLRQIVTNG
FT                   GEEASVVVAAVAAGTGNYGYNAATGEYVDLVDAGVVDPTKVTRTALQNAASVAGLLLTT
FT                   DAAVCELPKEDAPMAGGMPGGMGGMGMDM"
FT   gene            complement(731091..731951)
FT                   /locus_tag="Bxe_A3814"
FT   CDS             complement(731091..731951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3814"
FT                   /product="Putative hydroxymethylpyrimidine kinase"
FT                   /EC_number="2.7.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3814"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29184"
FT                   /db_xref="GOA:Q144Q5"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q5"
FT                   /protein_id="ABE29184.1"
FT                   /translation="MPSDTPPIVLTFGLSDPTGGSGLQADLMTLASMGCHGVSVLTGYT
FT                   VRDSASCDEVTGLDPEVVATQARMLLEDMPIAAFKVGACTRAEVVSAIAEVVADYDDIP
FT                   LILAPDFTLDDEHVLSADELREAIADLLAPQTTLLVADATTLLALAQPDGDAEAPSLDA
FT                   AISHLLSQGCEYILSTETGTHRHVNTLFSEDGQLRQDMWDRGSHRIMGLTDTLGSAIAA
FT                   LLANGQEPAEAVREAQEYLYQAVRNAFRPGMGAYMPDRFFWARSSDDETPPAAGKDAAP
FT                   GEARH"
FT   gene            732241..732411
FT                   /locus_tag="Bxe_A3813"
FT   CDS             732241..732411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3813"
FT                   /product="Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3813"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29185"
FT                   /db_xref="GOA:Q144Q4"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q4"
FT                   /protein_id="ABE29185.1"
FT                   /translation="MEYQSWMCLICGWIYDEEAGLPEEGIAPGTRWEDVPINWTCPECG
FT                   ARKEDFEMVQI"
FT   gene            732681..734093
FT                   /locus_tag="Bxe_A3812"
FT   CDS             732681..734093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3812"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3812"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29186"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q3"
FT                   /protein_id="ABE29186.1"
FT                   /translation="MTLRSAAPVSFDALPNPRGGAVRPAELALAEALLAFEQHGESTSA
FT                   LLRASHALRGAGWLSAQRFADALVRLSPLAAGDPAEAASARPVFGAALRDFRAALERHN
FT                   LRELSCSPVLFDHYRALCAHLSEHTPGSTVAFEDLALTARPVPPVSLHARSADQLAHLR
FT                   ARYERALLPVLRSQADTGSAAALAVTNAALDELDAVFSELAGPDPYDFWRLAKACGKAL
FT                   RAGGRAAGETDARRFYARCNLALADHARGIELAPRSLVRATLALLWRDYALFGAAAEDA
FT                   DQVELLHDYGLTVDWHVAGTQASEMLWEAGALQAQAVSATRSALTRELGVLTVNANAYE
FT                   DFLQTADASIAALTEHARAADQPEKADPSEALQAGDAAYRLGSAACALGLGHVALLADA
FT                   LGLAWRRRAHAGVSTPAVRAHVIVGAPAASTLEQAAEALRATLHKVAAGVAPAGGNAAL
FT                   AALTRSIEQGGA"
FT   gene            734284..734949
FT                   /locus_tag="Bxe_A3811"
FT   CDS             734284..734949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3811"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3811"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29187"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q144Q2"
FT                   /protein_id="ABE29187.1"
FT                   /translation="MAHGSLHGTHRGSTLKAPPSCIVFAKIRTMSKSTDRINLTNQFLI
FT                   AMPNMADPTFSGTVVYLCDHSERGALGLVINRPTDIDLQALFSRIDLKLEIEPLLHVPV
FT                   YFGGPVQTERGFVLHDPKDGNAYTSSMSVPGGLEMTTSKDVLEAVASGTGPERFLLTLG
FT                   HAGWGAGQLEEEISKNGWLTVEADPKIVFDVPAEERLEAALALLGINLSMLSGEAGHA"
FT   gene            734946..735386
FT                   /locus_tag="Bxe_A3810"
FT   CDS             734946..735386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3810"
FT                   /product="Conserved hypothetical protein 250"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3810"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29188"
FT                   /db_xref="GOA:Q144Q1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q144Q1"
FT                   /protein_id="ABE29188.1"
FT                   /translation="MSLAAGREATLLAFDYGEKRIGVAVGNSLTKSARPLVIVQNRSRE
FT                   YRFEAVGKLIAEWKPNALVVGLPMHPDGTPHEMTQLAKRFGNQLNGRFNLPVTWIDERY
FT                   SSVEAKAEIRAGNGRADMLDAEAASIILQQYLDGLSDDHEFH"
FT   gene            735373..735927
FT                   /locus_tag="Bxe_A3809"
FT   CDS             735373..735927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3809"
FT                   /product="Putative bifunctional regulator/uracil
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3809"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29189"
FT                   /db_xref="GOA:Q144Q0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:Q144Q0"
FT                   /protein_id="ABE29189.1"
FT                   /translation="MSSIDAEALYRALLDQIRAVYGDRLGAAQDGNEGAVLAGIYSGGA
FT                   WLAGRLARDLNLPGFGVVNVALHRDDYAKKGLHSQASPTSLPFPVDGRRIVLVDDVLYT
FT                   GRTIRAALNELYDYGRPAAVDLAVLADRGGRELPVAARFVGGVVDIPADATLVLARTES
FT                   SEADGTPGSQRFTFHTEARVD"
FT   gene            736152..737177
FT                   /locus_tag="Bxe_A3808"
FT   CDS             736152..737177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3808"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3808"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29190"
FT                   /db_xref="GOA:Q144P9"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q144P9"
FT                   /protein_id="ABE29190.1"
FT                   /translation="MNTATQAPKDSADSATERFRYGFLKGNPQLTKNGELKHLLSIEGL
FT                   PKAIVNHILDTADQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSAD
FT                   VLNLNINASSTSKGESLLDTINNLSAMHADMFVVRHASSGAPYLIAQHCAPHVHVINAG
FT                   DGRHAHPTQGLLDMYTIRHYKKDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAI
FT                   GPRTLLPGGLEQMGVRVFHNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLT
FT                   PERLALAAPEAIVMHPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNH
FT                   D"
FT   gene            737297..738577
FT                   /locus_tag="Bxe_A3807"
FT   CDS             737297..738577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3807"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3807"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29191"
FT                   /db_xref="GOA:Q144P8"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P8"
FT                   /protein_id="ABE29191.1"
FT                   /translation="MKIHIQGGTLIDPAAGTEQQQDIFIAAGKIAAIGNAPADFNADKT
FT                   IDAQGLHVMPGLVDLSARLREPGYEHKATLESEMTAALAGGVTSLVCPPDTDPTLDEPG
FT                   LVEMLKFRARNLNQAHVYPLGALTVGLKGQVITEMVELTEAGCIGFSQADVPVVDTQVL
FT                   LRALQYAKTYGYTVWLRPVDAYLGKGGVAASGALASRLGLSGVPVSAETIALHTIFELV
FT                   RVTGARVHLSHVSSAAGIALMRAAKAEGLPVSCDVTVNHVHLIDLDIGYFDAQFRLDPP
FT                   LRQQRDREAIRAGLVDGTIDAICSDHTPVDDDEKLLPFAEATPGATGLELFLSLTVKWA
FT                   DEARVPLAKALNRITAAPAKVLELDAAGRIAVGGVADLCVFDRNAHWRVEPRALKSQGH
FT                   NTPFLGYELPARVHATIVSGHVAFEQR"
FT   gene            738651..739529
FT                   /locus_tag="Bxe_A3806"
FT   CDS             738651..739529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3806"
FT                   /product="lyso-ornithine lipid acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3806"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29192"
FT                   /db_xref="GOA:Q144P7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P7"
FT                   /protein_id="ABE29192.1"
FT                   /translation="MKLALRKARLVVHLLHGMWTVATRFPKASADVRHTLNREWSLKML
FT                   RLCGMRLVVHNDSARLDRGALVVANHISWIDIYVINAWRPTPFVSKAEIRQWPVVGWLA
FT                   QQLDTVFIQREKRSDAKRIMHELSDRLGAGELMCVFPEGTTSNGLAVLPFHANMFQAAV
FT                   SASVPVQPLCIMYEDAQGRQSTAPAYIDDLSLADSLNLLLRGGPLTAHVHVGAPLAPGA
FT                   DRRTLAAEAEGVIVAALRQMQSGSAISGAVMAGQAATPAPTATRIEPANQAGQAGQVDE
FT                   VDQIDQSGRSA"
FT   gene            complement(739552..740430)
FT                   /locus_tag="Bxe_A3805"
FT   CDS             complement(739552..740430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3805"
FT                   /product="Bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3805"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29193"
FT                   /db_xref="GOA:Q144P6"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P6"
FT                   /protein_id="ABE29193.1"
FT                   /translation="MTPATSSPAPSGQPLVPLAFGDLQGCRTPFQQLLAKAAPPAGTPL
FT                   WFAGDLINRGAESLATLRDVIALGERAVPVLGNHDLHLLSVSAGIRKSKKGDTIDEILT
FT                   APDAADLLDWVRHRPLAHFDNGMLMVHAGVLPQWDVTMTLELADELHRALCAPNWKETL
FT                   AGLYGNEPNRWKPGLKGIERLRLTCSALTRMRFCTAEGVMDFSSSGGLNAAPPGCMPWF
FT                   DVPSRETAGVTVVFGHWAALGLTLRDNLIGLDSGCVWGEKLSAVRLAQNPAERTLTQVG
FT                   CENCRAPGGGN"
FT   gene            740635..741546
FT                   /locus_tag="Bxe_A3804"
FT   CDS             740635..741546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3804"
FT                   /product="Putative UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3804"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29194"
FT                   /db_xref="GOA:Q144P5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P5"
FT                   /protein_id="ABE29194.1"
FT                   /translation="MSSLHAKQPIRTLVTGASGFTGRYLVDNLLGRGHTVIETVAGRDE
FT                   PETPTRVRLDITSPDACRRAIEIARPDYIVHLAAISFVGHNDPLDFYRVNVIGTLNLLE
FT                   ACAAVGHTPRKLLIASSANVYGNVTSEAIDESFPVTPVNHYAASKAAMETMVRTWFDRL
FT                   PILIVRPFNYTGRGQASNFLVPKIVGHFARREASIELGNIDVARDFSDVRYVASAYEAL
FT                   LDSEAAAETVNVCTGTPFTLREILAAASDLTGHELEIQINPAFVRQTDVKMLAGSPARL
FT                   RTLVPTVEAIPFMDTLRWMLAA"
FT   gene            742012..743064
FT                   /locus_tag="Bxe_A3803"
FT   CDS             742012..743064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3803"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3803"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29195"
FT                   /db_xref="GOA:Q144P4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P4"
FT                   /protein_id="ABE29195.1"
FT                   /translation="MILVTGGAGFIGANFVLDWLNASDEAVLNVDKLTYAGNLGTLKSQ
FT                   QGNPKHVFVRADICDRSALDALFAEHKPRAVLHFAAESHVDRSIHGPADFVQTNVVGTF
FT                   TLLEATRQYWNALGEAGKAAFRFLHVSTDEVFGSLSATDPQFSETTPYAPNSPYSATKA
FT                   GSDHLVRAYHHTYGLPVLTTNCSNNYGPYQFPEKLIPLMIANALAGKALPVYGDGQNVR
FT                   DWLYVGDHCSAIREVLARGTPGETYNVGGWNEKKNLEVVHTLCDLLDQLRPKAGGSYHD
FT                   QITYVKDRPGHDRRYAIDARKLERELGWKPAETFETGLAKTVQWYLDNQAWSDEVASGE
FT                   YRKWVAKQYA"
FT   gene            743057..743974
FT                   /locus_tag="Bxe_A3802"
FT   CDS             743057..743974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3802"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3802"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29196"
FT                   /db_xref="GOA:Q144P3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P3"
FT                   /protein_id="ABE29196.1"
FT                   /translation="MRDKASSVPILLVTGSRGQVGFELRRSLASLGNVVALDRSVCDLR
FT                   SPDSIRSVVREVQPDVIVNPAAYTAVDAAENDAELAYAINGVAAGVLAEEAKSLGGLLV
FT                   HYSTDYVFDGRKDGPYVETDVVNPQSVYGKSKLAGEQAIAERGATAIVLRTCWVAGAHG
FT                   SNFAKTMLRLGRERDSLRVIADQYGAPTTAALIADVTAQIVARHWLHGDRAAFASGVYH
FT                   LAAAGQTSWHGYATEVLQFAAARGVELKVDLARIEPIATADYPLPAPRPANSRLDTHKL
FT                   RQTFGINLPDWRDGVHHLLEQILP"
FT   gene            743984..744862
FT                   /locus_tag="Bxe_A3801"
FT   CDS             743984..744862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3801"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3801"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29197"
FT                   /db_xref="GOA:Q144P2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P2"
FT                   /protein_id="ABE29197.1"
FT                   /translation="MRKGIILAGGSGTRLYPITRSVSKQLLPVYDKPMIYYPLSTLMLA
FT                   GIRDILVISTAEDTPRFAEMLGDGSAWGIDLQYAVQPSPDGLAQAFIIGREFIGSDPCT
FT                   LILGDNIFHGHDLVRQLTRAGQSEQGATVFAYHVHDPERYGVVEFDENFHALSLEEKPL
FT                   KPRSNYAVTGLYFYDNQVCDIAADVKPSARGELEITDVNKRYLEIAQLDVEIMGRGYAW
FT                   LDTGTHDSLLEAASFIATLQSRQGLMVACPEEIAYRSHWISAEQVERLAGPLAKNRYGQ
FT                   YLKQIISEAVK"
FT   gene            744859..745410
FT                   /locus_tag="Bxe_A3800"
FT   CDS             744859..745410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3800"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3800"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29198"
FT                   /db_xref="GOA:Q144P1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P1"
FT                   /protein_id="ABE29198.1"
FT                   /translation="MSMTVIATEIPDVLILEPKVFGDDRGFFYESFNARRFEELTGVKR
FT                   EFVQDNHSRSARNVLRGLHYQIQNPQGKLVRVVTGEVFDVAVDLRKQSPTFGRWVGVTL
FT                   SAENKRQLWVPEGFAHGFVVTSEYAEFLYKTTDYWYAEHERSIVWNDPQIGIQWPIVGQ
FT                   PALSGKDAAGVSFESAEVYR"
FT   gene            745407..746237
FT                   /locus_tag="Bxe_A3799"
FT   CDS             745407..746237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3799"
FT                   /product="ABC O-antigen/lipopolysaccharide exporter,
FT                   innermembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3799"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29199"
FT                   /db_xref="GOA:Q144P0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q144P0"
FT                   /protein_id="ABE29199.1"
FT                   /translation="MNPHAPYSTGPLSVVRSVTNHRQLIRQLVAREVVGRYRGSIMGLA
FT                   WSFLNPLLMLIIYTFVFSVVFKARWGTGGTEDRSEFALILFAGLIMHTLFSECVIRAPG
FT                   VVLGNANYVKKVVFPLEILCWVSLGSALFHALVSCGVLLVAMVVIRHTMPWTVVLFPLV
FT                   LIPFVLGVIGLSWALAAFGVFVRDIGQLMGMVTTILMFLTPIFYPVTSLPERFRVWVYL
FT                   NPLTWVVEQARNTLIFGKVPSFHGWAISMILGALVAWGGFWLFQRLRRGFSDVI"
FT   gene            746227..747573
FT                   /locus_tag="Bxe_A3798"
FT   CDS             746227..747573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3798"
FT                   /product="ABC O-antigen/lipopolysaccharide exporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3798"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29200"
FT                   /db_xref="GOA:Q144N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N9"
FT                   /protein_id="ABE29200.1"
FT                   /translation="MSSEIVIRVKNLSKCFNIYDQPRDRLKQAILPRLQRLFGRPQKSY
FT                   HKEFWALRNADFEIRRGETVGIIGRNGSGKSTLLQLLCGTLTPTHGDIEVTGKVAALLE
FT                   LGAGFNPEFTGRENVFLSGSFYGLTREQVQERFDRIAAFADIGDHIEQPVKTYSSGMFV
FT                   RLAFAVIAHVDADILVIDEALSVGDAVFTQKCMRFIRSFQEKGTLLFVSHDMQSVVNLC
FT                   RNAIWLNAGETRMKGTSKNVSEAYLKYTLQEVYGEEAILLSAAPKESTLDAPMFEEAGP
FT                   PMLDYEAVASVSSNLFDAKGWKTGDAEIEAVQLESLTGENDGILRGGELVRMVVRARAH
FT                   QPLERPVIGFMVRDRLGQNLFGENTLSLTALDQARVAAGQMFEGEFVFRLPMLPDGQYS
FT                   VTASVADGDLHNNVQHHLLHDALIINVASSKVRWGLVGVPFERVTLNCI"
FT   gene            747570..751904
FT                   /locus_tag="Bxe_A3797"
FT   CDS             747570..751904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3797"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3797"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29201"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N8"
FT                   /protein_id="ABE29201.1"
FT                   /translation="MMKSIRQLYKEHEGKVSDKWSLYLDEYNRLFAPYRDQPIRMLEIG
FT                   IQNGGSLEIWSKYFAQARTLVGCDINPDCSKLIYADPRISVVVGDANTDESAAEILGHS
FT                   ARFDVVIDDGSHRSSDIVRSFARYFPALNDGGIFVAEDLHCSYWQDFEGGLYDPYSSIN
FT                   FFKRIADVVNHEHWGVAKANRTVLQGMFKRYGCELSDAELDRIHSVEFINSICVIRKAP
FT                   PDQNRLGKRFIAGELEVVVPGHRALLGTDADVPDQSANPWTVMAMPPDEEYELLKTQIE
FT                   YLKRAASVHDQELRARDTVIRQRDQEIERLNGVVNEFKNEIGKYHGVVMSRDAELEAIR
FT                   TSNSWRITAPLRRVGGVAPKLRYRVGGVAGLVRRHGVGYLAGKAWDIFRQQGAGGLRQR
FT                   ASLTLRQHHLSVAPPVALRHPEANYFPVTPVDRPPLPAVTVDVVIPVYRGLDETRKCIE
FT                   SVLKAHCAANMRVIVIDDASPEPAVSAYLDSLPQTPEFKVMRNEVNLGFVKTVNRGMRL
FT                   EPANDIVLLNSDTEVADGWLDRLVWHAYSQSKIASVTPFSNNATICSYPTIYGTRVLPH
FT                   GETLEALNQAFYTANAGRAVELPTGVGFCMYIRRACLDELGLFDEEAFGKGYGEENDFC
FT                   LRALARGWTHLLATDTFVYHAGEVSFADSSSPGKARAMEVLRERYPDYETRIVEHVTQG
FT                   DAEPFRIAATAARFRLSRKPVTLMIGHHLGGGTEKHLLDLADSLVPDAFCLVLSPASDV
FT                   ANRIVLRAANVADSFELPLDLPQHERFLWELLKSFGVTRVHFHHLLGLPESVREVVRQL
FT                   GVPHDFTVHDYYTICPQVNLAIEGRYCGEPENGKCNACIAKRPSHGAQDIDWWRQKHAW
FT                   VIDDAARVMCPTHDVAQRIRRYRPAANTVVASHECAAPVPVKAPTLSADEPLRVVMLGW
FT                   LATHKGGPLVAECVDFARRQKRPMHFHLIGRSVDPIETSSTYSETGEYTDDNVQSLITE
FT                   ADPHLIWLPSTWPETYSYTLSAALTAGVPVAAPNIGAFPERLSGRDWSWIVPWDSTALQ
FT                   MLDFFEEARAFLERGLSPAPGEGGEAPPQGFYNGAYQAELTNAQVTPIDLRRPGVPSVL
FT                   AVVETYGKHASPCAYIRVLLPLLKIASKRPLTVKVVEADYLSDYVADVVYTHRVALSGG
FT                   DALTAVEHCRRNDMRLVYDLDDDLLAIAESDHPEREAYAGYAQSIRLLVSEASSVHVST
FT                   DPLRQKLAAFSRHVKLVPNALDDGLWHLSDARPARASGQSVSILYMGTQTHAVDFEMVK
FT                   PALARLKSKYRDQVRICVIGVTQDREKSDVYEFVDAPSRVSGSYAAFVEWLVEKGNFDI
FT                   GIAPLLDSEFNAGKSGIKFLDYAALGLAIACSDVRSYRSVVRHEETGVLVKNDENAWYE
FT                   ALDRLVSDSQYRTRLATNGRADLIAHHTLSSVYENFPGMWLL"
FT   gene            752028..753653
FT                   /locus_tag="Bxe_A3796"
FT   CDS             752028..753653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3796"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29202"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N7"
FT                   /protein_id="ABE29202.1"
FT                   /translation="MRELSPQTMDVRVDESTEARLSSKGWIAVAALAVVTYFIRDCYQF
FT                   LKPQFWAEDATIFLAMSVREALLNLVHPYAGYFHFAPRTLALLGAFFPTVLAPAVFYYG
FT                   AVAAAVASCVAIYLMVGTFPTHLRILFALAPMLVLPAGEVYGNVTNIQWFFGVAFGVLV
FT                   LTYRGDTFRSRGWLVMGEVLALTGPFSVVFWPCLLVWSWLTGRLPVNAKMLVVVGIGAF
FT                   VQLAAVVLMGVNKYGVGIAAASAWVRAVKIFVGSFVTLSGVTGGVAVLAIFVLLAFGLR
FT                   RNFVERLRGGYLPFGLVCMALLTLLMGLWTHKHMPDEINPLGPGERYFFLPFNFLFMAV
FT                   IASAQAVGKKYHWFCLVVALSLVFGWSRHFRKGELSDFRWRDYYALSQVTQDSLIPIQP
FT                   GWVLRLNNDRPDRLVSVMPVDLSRLEPFYGVLHTDGDETTLIEERVSGDPASQIVFDVP
FT                   SSCLKTEHRFVRVALKDAARVHLYLPDVNDISSKSASLIWHVGANDHWYFDVPNRVSTK
FT                   IVRLGVTSDSGGIVRGLKLSWVCW"
FT   gene            753725..754723
FT                   /locus_tag="Bxe_A3795"
FT   CDS             753725..754723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3795"
FT                   /product="Putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3795"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29203"
FT                   /db_xref="GOA:Q144N6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N6"
FT                   /protein_id="ABE29203.1"
FT                   /translation="MTARKLTCGIAMCTCNGAAYLGAQLSSLIEQTRLPDSIAISDDRS
FT                   DDGTWDVLNAWAAEVRSVHAIQVVLMRNETRLGVTRNFEQAIGALDTDIIFLADQDDIW
FT                   ANNKIEMLAGTLETDSDVLLVHSDAFLIDEDGADIGRSLFEALYLTSADRELARQQRFF
FT                   EVYCRRNLVTGTTAAFRRKLLELALPFPDTWIHDEWLAACAAAWRRVAMLPDKLTFYRQ
FT                   HGRNVIGVPAGRLSLLVRYVRRVLEIPRDDYLAGKINRLGALHKRLDETSLARDDAQVL
FT                   LVEAEQHFIRRRAFNRRFPSRLVSIIRESRRNGYRRFADGAAGMLRDIIDL"
FT   gene            complement(754881..756503)
FT                   /locus_tag="Bxe_A3794"
FT   CDS             complement(754881..756503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3794"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3794"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29204"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:Q13P86"
FT                   /protein_id="ABE29204.1"
FT                   /translation="MRFHGAWGSGRLVCMTLPADLNALSPEQLRALAAQLIAQVQDRDR
FT                   EIEEKTREVEENERELHYRQTRIEQLSHEISILKRQQFGRRSEQFTSEQMSLLDEAIDA
FT                   DLAAIELELEQLQPQAPADQSTQQPKRTSLPAQLPRTEIHHEPDSILCHCGCERVRIGE
FT                   DISEKLDYTPGVFAVERHIRGKWVCKNCETLIQAPVPAHVIDKGIPTTGLLASVLVAKY
FT                   ADHLPLYRQEQIFARAGLAIPRSTLGAWVGTCGAQLQPLVDALHQELLQQGVLHADETP
FT                   VQMLSPGKGKTHRAYLWAYTPTHFSELRAVVYDFAVSRAGEHARAFLADWQGKLVCDDY
FT                   GGYKAGFQQGITEIGCAAHARRKFFDLHANHSSQVAGQAMPFFAALYDIERDAAVLDAE
FT                   ERRKLRQSRAKPLCDALYEWMVAQRKLVSEGSAIAKALDYSLKRWEALTRYLDDGHVPI
FT                   DNNWVENQIRPWAIGRANWLFAGSLRAGQRAAAIMSLIRSAQLNGHDPHAYLKDILTRL
FT                   PIHKASDISALLPHRWQPTGIVD"
FT   gene            complement(756525..756893)
FT                   /locus_tag="Bxe_A3793"
FT   CDS             complement(756525..756893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3793"
FT                   /product="Putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3793"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29205"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N4"
FT                   /protein_id="ABE29205.1"
FT                   /translation="MRRLAAGVARVIRIDEVWLAVEPLDMRAGFDTALARVVKVFGAAH
FT                   PHHAYLFANRRANRLKVLVHDGIGIWLAARRLNEGQFAWPHAGSEPKQHALTQEQLAAL
FT                   VVGLPWQRIGPNGVIRVV"
FT   gene            757692..758519
FT                   /locus_tag="Bxe_A3792"
FT   CDS             757692..758519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3792"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3792"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29206"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N3"
FT                   /protein_id="ABE29206.1"
FT                   /translation="MSSHNFEHLPNPIRFLRGCAKVLRPGGVISMAIPDRRACFDYFRP
FT                   VTTLSAWIAAFLEDVSRPSRAQYFDMVTCTGLFDTGDSKTISFHRGVEPEKVSAGLRLD
FT                   ESFAEWTDQSRDGEYFDSHCSVFTPSSFELLIRDVAYLGLAPFEVVEIFDSPGVEFYVR
FT                   LKMNDSKEALRPEGYEEMRNLLLHRILDEAAETSSTYMTARELPGTVASLQERLAAFQK
FT                   STAVLEEDLETRRAEVERLAERGRILESDLQAIRASTSWKVTSPLRRMIGKFR"
FT   gene            758744..761104
FT                   /locus_tag="Bxe_A3791"
FT   CDS             758744..761104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3791"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29207"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N2"
FT                   /protein_id="ABE29207.1"
FT                   /translation="MDSTPSQIQSSTTSTRGPFAAPLAIFALVLSALLVIPFLPAMPSS
FT                   GLDASWGYALNEAIDRRIVFGKDLIFTFGPLGSAYTQMYHPATDGIMLLTCTVLSVALC
FT                   AGFAVLAIPRRPLALLLLPVVLATAQSRDAIFVAIPFCMAMATFVVTRRGRGGVTRALP
FT                   KPVCAALIFIGAACGMLPLVKGSFVAVTLFLCCCSIVLLARARHFKLAVAIPIVVLVSM
FT                   VGCWIGVGQSLFTLPNFFIAQLPIISGYAGAMSSEGSFWVVAIWLLPTAAALAIVYFCL
FT                   SRGEGADGVVLWIGVLGYFFITFKASFVRQDDGHLYTALAALSLVSLIFVMSVRLRIAL
FT                   LYAVLAFFSWSSIEIQTNNFHPRQTAMSTWYAVHRTAVGMKLRLASPRRLRTDFDNANS
FT                   AIRAAFPIGKVEEPVDIYPTELAPIFAHDLKWAGRPVPQSYSAYTPTLDLKDAEHLKGA
FT                   NAPRTVFYSVASIDLRLPSLEDSSSLPILLTQYRVAGRSETALQFVRSPHPAAIDFRKL
FT                   DEREAELNKDINVPPSRDPVLAKIVVRQTILGKLMSAAFKLPSLYIETKFEDGRVQRNR
FT                   FIPGMAKNGFVVAPYVGSVDSVVDIAADMSTKEVKQIRIVGSEAGYWRKKIHVEFFSFP
FT                   VSPQDTAMSLAGVAPKSASPALLHGVSSTLAQCYLESINGVSKAKFPADGVETGNAASV
FT                   VGWASPSTEKGIAPDEIWLALASESGATEFYKARIKERSDVAAAFHHAEMANVGFNVKV
FT                   RETATGPMSISILTVREGVVQDCGIRQRVIFAK"
FT   gene            complement(761173..761598)
FT                   /locus_tag="Bxe_A3790"
FT   CDS             complement(761173..761598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3790"
FT                   /product="Conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3790"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29208"
FT                   /db_xref="GOA:Q144N1"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N1"
FT                   /protein_id="ABE29208.1"
FT                   /translation="MTRAHTVVKRAFVSKSFLLFLLAGGFAAAVNWCSRMVYNLWMPYS
FT                   AAIVVAYITGMITAFVLAKLFVFTESTQSTGRSVFFFTLVNLVAVVQTWAVSVGLAYYV
FT                   FPRTGMTWHARDVAHAVGVAVPVFTSYVGHKRWSFKH"
FT   gene            complement(761595..762878)
FT                   /locus_tag="Bxe_A3789"
FT   CDS             complement(761595..762878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3789"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3789"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29209"
FT                   /db_xref="GOA:Q144N0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniProtKB/TrEMBL:Q144N0"
FT                   /protein_id="ABE29209.1"
FT                   /translation="MSAERIAVLGAGPMGLGAAYQLVKDGRKPIIFEADDRVGGMAACF
FT                   DFGGLSIERYYHFHAISDHAFFELLRELGIEKKMQWRETKMGYFYQGRVQPWGNPMALL
FT                   KFKGLSLQAKFRYGLHAFLSTKRNDWEPLDHVEATGWIRRWIGEEAWEVLWRRLFDYKF
FT                   YDYAYNLSAAWIWSRIRRIGRSRYNLFHEKLGYLEGGSDTLLNGMRDYIVANGGEFRLG
FT                   TPAQKVVIENGEVTGIEAGGEFLPFDKVISTIPLPYVPGVIPDLPASILDAFRSVKNVA
FT                   VVCVIAKLKKPVTENFWLNTNDPEMDIPGIVEYTNLRPLDHHVVYVPFYIPGEHPKYQE
FT                   ANSVFIDKVKRYLMKINPALTQGDFIDVRASRYRFAQPICEPGYLDRLPPIQLPVKGLL
FT                   VADTSYYYPEDRGISESIGLSRKMAKMI"
FT   gene            complement(762893..763831)
FT                   /locus_tag="Bxe_A3788"
FT   CDS             complement(762893..763831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3788"
FT                   /product="putative transmembrane oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3788"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29210"
FT                   /db_xref="GOA:Q144M9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M9"
FT                   /protein_id="ABE29210.1"
FT                   /translation="MNQTRILLPGGAGLVGQNLVARLKARGYSNLVVIDKHKANLEVLR
FT                   QVHPDVTAIYADLAERGEWEQHFKAADLVVMLQAQIGAPTLEPFIRNNITSTRNLLEVI
FT                   KRYQIPYTVHISSSVVNSVGEDFYTDTKREQEEIVLASGIECVVLRPTLMFGWFDRKHL
FT                   GWLSRFMHRVPVFPIPGSGRYMRQPLYVGDFCNVIISCIESRIKGQAFNITGLERVDYI
FT                   DIIRQIKRATKARCAIVRIPYGLFYVLLKVYALFSKNPPFTADQLKALTAGDEFEVIDW
FT                   EGIFKIRATPFAKAMDETFNDPTYSHIALEF"
FT   gene            complement(763948..765660)
FT                   /locus_tag="Bxe_A3787"
FT   CDS             complement(763948..765660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3787"
FT                   /product="Putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3787"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29211"
FT                   /db_xref="GOA:Q144M8"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M8"
FT                   /protein_id="ABE29211.1"
FT                   /translation="MSRGERIGNFAVFALGVFTLTTTTLGVWQHFSPLPFGDSWDGAIG
FT                   FYMRAIQNPWHAFFEQHNEHRLAFSRLIFFADVRFFGGRNVFSLVANLALAALLAMTFF
FT                   RIAVHHCATLGREARLGLAGAVLVFVFSWAQKENFTWGFQSQWFAVYLFALLAFHALDR
FT                   TAEALAQSERAKSHGWLAVALISATVAAYSMSSGVLVFPVLIVQAIYRRLRRRDLTVIC
FT                   AVTVAVWVVYFVDWQKSASSGDLMTSLPQHPFAALQYMLLYLGAPAFNVRLGVPASYVT
FT                   GALALTALAVYSINAVKSGESRPRGVSLLAFALFVTGNALLTASGRLWFGLGTALASRY
FT                   TTASLMGWLAIGIFAVLNVEAGKQCRRVLFVTVLATLLVASGQRLSFRADRDVSYARLV
FT                   AGLALRAHVYDPDITKAVYPFPEILVNDAKLAEAAQLSIFAPNQPDYLVAPVTVDPTVL
FT                   CDGSLDRISATTTPGVYRATGWIYETARGHTPRAVVLTDATTHATLGTGVTGGERNDLR
FT                   GTYSGNALHSGWTAFFTAPASGGIRVNGQTAGDEYCALAADRPMSATLQIPAR"
FT   gene            complement(765674..766414)
FT                   /locus_tag="Bxe_A3786"
FT   CDS             complement(765674..766414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3786"
FT                   /product="Putative short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3786"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29212"
FT                   /db_xref="GOA:Q144M7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M7"
FT                   /protein_id="ABE29212.1"
FT                   /translation="MKNILIVGATSAIAIACARKWASEGARFFLVARNGERLQQIADDL
FT                   TSRGAQLAACHQLDIDSLDRHAGMLERCKTELGALDIVLVAPGTLPDQARCQADPALAV
FT                   REFNTNAVSVIALLTPIANILEAQKRGALAVISSVAGDRGRPSNYLYGSAKAALSAFCE
FT                   GLNARLFKSGVHVMTVKPGFVATPMTAGLPLPGPLVATPDQVATDIVRAVEKRKDVLYT
FT                   RWFWAIIMLIIRCVPRFLFKRASL"
FT   gene            complement(766411..767727)
FT                   /locus_tag="Bxe_A3785"
FT   CDS             complement(766411..767727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3785"
FT                   /product="Hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3785"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29213"
FT                   /db_xref="GOA:Q144M6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M6"
FT                   /protein_id="ABE29213.1"
FT                   /translation="MSTVLSWGRYPHLPQEVHGVAWRDSAQAAWLDASRESGTTLAFGN
FT                   GRSYGDSCLAASGHVVQTLALDRLIAADWQTGVLRAEPGVTLEQILDVAIPRGWMLPVT
FT                   PGTKYATLGGAIANDVHGKNHHVRGTFGRHVRRFALARSDGTQFECSPDEQPEFFAATI
FT                   GGLGLTGLILWAEIQLMPIRSSMIAMKSIRFTNLDEFFALSERLDPLHEYSVAWVDCQS
FT                   RGSALGRGIFMVGDHATEGPLEVERRTKRIVPFTLPIPVFNRVTLRALNELYYQKQQSG
FT                   EVSATVSYDTYFYPLDSLLEWNRIYGRAGFQQYQCVVPPSSAREATREILDAISESGTG
FT                   SFLAVMKRCGDLRSPGLLSFPREGTSLALDFPQRDALNTRLFARLDAIVSEAGGRIYPA
FT                   KDAHMSGADFRTAYPQWHQLEALRDPALLSRFWERTTRT"
FT   gene            complement(767731..769155)
FT                   /locus_tag="Bxe_A3784"
FT   CDS             complement(767731..769155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3784"
FT                   /product="Putative transmembrane potein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3784"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29214"
FT                   /db_xref="GOA:Q144M5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M5"
FT                   /protein_id="ABE29214.1"
FT                   /translation="MRSKPLVVDLDGTLIRSDVLIESGFAYLKAAPHRFYEPLLWLARE
FT                   GKPGLKARLAGATNVDVAVLPYDATVLEWLKTERKSGRTLVLATASHERYAQAISAHLG
FT                   LFDKTFASNENVNLSAHKKREKLVAEYGEKGFDYAGNSHDDVAVWQSADRAYVVNPSNG
FT                   VERAAREIGNVERVIESRPPFARTWAKSLRLHQWLKNLLIFVPLLAGHKLSSPDLAIAA
FT                   IVAFLTFGLCASSVYLLNDLLDLEDDRHHPVKRRRPLASGALPLTWGLGLFPVLLVGSF
FT                   TMAWFFLPWRFSVVLLGYYALTLAYSMFLKRQVMVDVVVLAMLYTIRIIAGTAGVGAQL
FT                   TFWLLAFSMFIFLSLALVKRYAELHSMKERGLVKTRGRGYVASDLSLISSLGTSSGYLA
FT                   VLVLALYIQDAKTAGMYRHPQVIWLACPLLLYWVSRTWIIAHRGLMHDDPIVFAARDRV
FT                   SLAVVVLCGLVFWAAI"
FT   gene            769502..770347
FT                   /locus_tag="Bxe_A3783"
FT   CDS             769502..770347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3783"
FT                   /product="Putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3783"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29215"
FT                   /db_xref="GOA:Q144M4"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M4"
FT                   /protein_id="ABE29215.1"
FT                   /translation="MKATHAPHSESEGLSVSVVTYRPDIEQLTSTLAGLAAACDALRVG
FT                   RPALPVVLFLVDNGGLPAIQAALAELQRHDVSTTIIAGHGNVGYGRGHNLAIERSASQY
FT                   HLVLNPDIDLARDALSEAFDFFEAHAEAGLITPWIGDEHGDQQFLCRRYPTLIDLFARG
FT                   FLPAGLRRLFSRRLARYEMRDQINARDIVWDPPIVSGCFMLFRTSVLKRLAGFDTRYFL
FT                   YFEDYDLSLRAHDVTRVVYAPSVRVLHHGGGAVRKGSAHIRMFMASAYKFFNRFGWKWL
FT                   "
FT   gene            770344..771300
FT                   /locus_tag="Bxe_A3782"
FT   CDS             770344..771300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3782"
FT                   /product="Putative epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3782"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29216"
FT                   /db_xref="GOA:Q144M3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q144M3"
FT                   /protein_id="ABE29216.1"
FT                   /translation="MSHVLVTGANGFVGHALCRALLNAGHTVTGLVRRSGQ