spacer

EBI Dbfetch

ID   CP000088; SV 1; circular; genomic DNA; STD; PRO; 3642249 BP.
XX
AC   CP000088; AAAQ02000000-AAAQ02000019;
XX
PR   Project:PRJNA94;
XX
DT   09-AUG-2005 (Rel. 84, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Thermobifida fusca YX, complete genome.
XX
KW   .
XX
OS   Thermobifida fusca YX
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Streptosporangineae; Nocardiopsaceae; Thermobifida.
XX
RN   [1]
RP   1-3642249
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Di Bartolo G., Chain P., Schmutz J.,
RA   Larimer F., Land M., Lykidis A., Richardson P.;
RT   "Complete sequence of Thermobifida fusca YX";
RL   Unpublished.
XX
RN   [2]
RP   1-3642249
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C., Glavina T.,
RA   Hammon N., Israni S., Pitluck S., Di Bartolo G., Chain P., Schmutz J.,
RA   Larimer F., Land M., Lykidis A., Richardson P.;
RT   ;
RL   Submitted (25-JUL-2005) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 22e5831b34e3cac80e8d5c0ec22e3348.
DR   BioSample; SAMN02598543.
DR   EnsemblGenomes-Gn; Tfu_R0001.
DR   EnsemblGenomes-Gn; Tfu_R0002.
DR   EnsemblGenomes-Gn; Tfu_R0004.
DR   EnsemblGenomes-Gn; Tfu_R0005.
DR   EnsemblGenomes-Gn; Tfu_R0006.
DR   EnsemblGenomes-Gn; Tfu_R0007.
DR   EnsemblGenomes-Gn; Tfu_R0008.
DR   EnsemblGenomes-Gn; Tfu_R0009.
DR   EnsemblGenomes-Gn; Tfu_R0010.
DR   EnsemblGenomes-Gn; Tfu_R0011.
DR   EnsemblGenomes-Gn; Tfu_R0012.
DR   EnsemblGenomes-Gn; Tfu_R0013.
DR   EnsemblGenomes-Gn; Tfu_R0014.
DR   EnsemblGenomes-Gn; Tfu_R0015.
DR   EnsemblGenomes-Gn; Tfu_R0016.
DR   EnsemblGenomes-Gn; Tfu_R0017.
DR   EnsemblGenomes-Gn; Tfu_R0018.
DR   EnsemblGenomes-Gn; Tfu_R0019.
DR   EnsemblGenomes-Gn; Tfu_R0020.
DR   EnsemblGenomes-Gn; Tfu_R0022.
DR   EnsemblGenomes-Gn; Tfu_R0023.
DR   EnsemblGenomes-Gn; Tfu_R0024.
DR   EnsemblGenomes-Gn; Tfu_R0025.
DR   EnsemblGenomes-Gn; Tfu_R0026.
DR   EnsemblGenomes-Gn; Tfu_R0027.
DR   EnsemblGenomes-Gn; Tfu_R0028.
DR   EnsemblGenomes-Gn; Tfu_R0029.
DR   EnsemblGenomes-Gn; Tfu_R0030.
DR   EnsemblGenomes-Gn; Tfu_R0031.
DR   EnsemblGenomes-Gn; Tfu_R0032.
DR   EnsemblGenomes-Gn; Tfu_R0033.
DR   EnsemblGenomes-Gn; Tfu_R0034.
DR   EnsemblGenomes-Gn; Tfu_R0035.
DR   EnsemblGenomes-Gn; Tfu_R0036.
DR   EnsemblGenomes-Gn; Tfu_R0037.
DR   EnsemblGenomes-Gn; Tfu_R0038.
DR   EnsemblGenomes-Gn; Tfu_R0039.
DR   EnsemblGenomes-Gn; Tfu_R0040.
DR   EnsemblGenomes-Gn; Tfu_R0041.
DR   EnsemblGenomes-Gn; Tfu_R0042.
DR   EnsemblGenomes-Gn; Tfu_R0043.
DR   EnsemblGenomes-Gn; Tfu_R0044.
DR   EnsemblGenomes-Gn; Tfu_R0045.
DR   EnsemblGenomes-Gn; Tfu_R0046.
DR   EnsemblGenomes-Gn; Tfu_R0047.
DR   EnsemblGenomes-Gn; Tfu_R0048.
DR   EnsemblGenomes-Gn; Tfu_R0049.
DR   EnsemblGenomes-Gn; Tfu_R0050.
DR   EnsemblGenomes-Gn; Tfu_R0051.
DR   EnsemblGenomes-Gn; Tfu_R0052.
DR   EnsemblGenomes-Gn; Tfu_R0053.
DR   EnsemblGenomes-Gn; Tfu_R0054.
DR   EnsemblGenomes-Gn; Tfu_R0055.
DR   EnsemblGenomes-Gn; Tfu_R0056.
DR   EnsemblGenomes-Gn; Tfu_R0057.
DR   EnsemblGenomes-Gn; Tfu_R0058.
DR   EnsemblGenomes-Gn; Tfu_R0059.
DR   EnsemblGenomes-Gn; Tfu_R0060.
DR   EnsemblGenomes-Gn; Tfu_R0061.
DR   EnsemblGenomes-Gn; Tfu_R0062.
DR   EnsemblGenomes-Gn; Tfu_R0063.
DR   EnsemblGenomes-Gn; Tfu_R0064.
DR   EnsemblGenomes-Gn; Tfu_R0065.
DR   EnsemblGenomes-Gn; Tfu_R0066.
DR   EnsemblGenomes-Gn; Tfu_R0067.
DR   EnsemblGenomes-Tr; Tfu_R0001.
DR   EnsemblGenomes-Tr; Tfu_R0002.
DR   EnsemblGenomes-Tr; Tfu_R0004.
DR   EnsemblGenomes-Tr; Tfu_R0005.
DR   EnsemblGenomes-Tr; Tfu_R0006.
DR   EnsemblGenomes-Tr; Tfu_R0007.
DR   EnsemblGenomes-Tr; Tfu_R0008.
DR   EnsemblGenomes-Tr; Tfu_R0009.
DR   EnsemblGenomes-Tr; Tfu_R0010.
DR   EnsemblGenomes-Tr; Tfu_R0011.
DR   EnsemblGenomes-Tr; Tfu_R0012.
DR   EnsemblGenomes-Tr; Tfu_R0013.
DR   EnsemblGenomes-Tr; Tfu_R0014.
DR   EnsemblGenomes-Tr; Tfu_R0015.
DR   EnsemblGenomes-Tr; Tfu_R0016.
DR   EnsemblGenomes-Tr; Tfu_R0017.
DR   EnsemblGenomes-Tr; Tfu_R0018.
DR   EnsemblGenomes-Tr; Tfu_R0019.
DR   EnsemblGenomes-Tr; Tfu_R0020.
DR   EnsemblGenomes-Tr; Tfu_R0022.
DR   EnsemblGenomes-Tr; Tfu_R0023.
DR   EnsemblGenomes-Tr; Tfu_R0024.
DR   EnsemblGenomes-Tr; Tfu_R0025.
DR   EnsemblGenomes-Tr; Tfu_R0026.
DR   EnsemblGenomes-Tr; Tfu_R0027.
DR   EnsemblGenomes-Tr; Tfu_R0028.
DR   EnsemblGenomes-Tr; Tfu_R0029.
DR   EnsemblGenomes-Tr; Tfu_R0030.
DR   EnsemblGenomes-Tr; Tfu_R0031.
DR   EnsemblGenomes-Tr; Tfu_R0032.
DR   EnsemblGenomes-Tr; Tfu_R0033.
DR   EnsemblGenomes-Tr; Tfu_R0034.
DR   EnsemblGenomes-Tr; Tfu_R0035.
DR   EnsemblGenomes-Tr; Tfu_R0036.
DR   EnsemblGenomes-Tr; Tfu_R0037.
DR   EnsemblGenomes-Tr; Tfu_R0038.
DR   EnsemblGenomes-Tr; Tfu_R0039.
DR   EnsemblGenomes-Tr; Tfu_R0040.
DR   EnsemblGenomes-Tr; Tfu_R0041.
DR   EnsemblGenomes-Tr; Tfu_R0042.
DR   EnsemblGenomes-Tr; Tfu_R0043.
DR   EnsemblGenomes-Tr; Tfu_R0044.
DR   EnsemblGenomes-Tr; Tfu_R0045.
DR   EnsemblGenomes-Tr; Tfu_R0046.
DR   EnsemblGenomes-Tr; Tfu_R0047.
DR   EnsemblGenomes-Tr; Tfu_R0048.
DR   EnsemblGenomes-Tr; Tfu_R0049.
DR   EnsemblGenomes-Tr; Tfu_R0050.
DR   EnsemblGenomes-Tr; Tfu_R0051.
DR   EnsemblGenomes-Tr; Tfu_R0052.
DR   EnsemblGenomes-Tr; Tfu_R0053.
DR   EnsemblGenomes-Tr; Tfu_R0054.
DR   EnsemblGenomes-Tr; Tfu_R0055.
DR   EnsemblGenomes-Tr; Tfu_R0056.
DR   EnsemblGenomes-Tr; Tfu_R0057.
DR   EnsemblGenomes-Tr; Tfu_R0058.
DR   EnsemblGenomes-Tr; Tfu_R0059.
DR   EnsemblGenomes-Tr; Tfu_R0060.
DR   EnsemblGenomes-Tr; Tfu_R0061.
DR   EnsemblGenomes-Tr; Tfu_R0062.
DR   EnsemblGenomes-Tr; Tfu_R0063.
DR   EnsemblGenomes-Tr; Tfu_R0064.
DR   EnsemblGenomes-Tr; Tfu_R0065.
DR   EnsemblGenomes-Tr; Tfu_R0066.
DR   EnsemblGenomes-Tr; Tfu_R0067.
DR   EuropePMC; PMC1590026; 16901339.
DR   EuropePMC; PMC1797311; 17071761.
DR   EuropePMC; PMC1899369; 17209016.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000088.
DR   SILVA-SSU; CP000088.
DR   StrainInfo; 501250; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA and bacteria available from David Wilson
CC   (dbw3@cornell.edu)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-PGF
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Contacts: Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3642249
FT                   /organism="Thermobifida fusca YX"
FT                   /strain="YX"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:269800"
FT   gene            195..2042
FT                   /locus_tag="Tfu_0001"
FT   CDS             195..2042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0001"
FT                   /product="bacterial chromosomal replication initiator
FT                   protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54041"
FT                   /db_xref="GOA:Q47U23"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47U23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54041.1"
FT                   /translation="MSEGQINLAMVWSRVLDNLDNNSLPPQHRAWLPQTRPLGLIEDTA
FT                   LLAAPNEFAKEILETRLRTVISQALSAELGREIRVAVTVDPSAVPPSAPTEEASSTSSP
FT                   DSSHPAPDQGSASYSGPRDTARQQAWSQQPVLPDPQPTAPQFTPSGRPGPLPGEPFSRG
FT                   PDLLSSGWNPSSADPGSPASPAPVAESDTGPRYQSWDTSAPHWDQPNRWETPRPWEGGP
FT                   HPGAGNRPHDVGGDSGVPSAEQPPVTPPLGVTERGDGSTNPTSGGPDQLNPKYTFDTFV
FT                   IGSSNRFAHAAAVAVAEAPAKAYNPLFVYGGSGLGKTHLLHAIGHYTQRLYEGARVRYV
FT                   SSEEFTNEFINSIRDGKADGFRRRYRDIDVLLVDDIQFLENKEQTQEEFFHTFNTLHNS
FT                   NKQIVISSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAAQEGLNAPP
FT                   EVLEFIASKISTNIRELEGALIRVTAFASLNRQSVDLHLTSIVLRDLIPNDEVPEITAA
FT                   EIMAQTASYFGLTPEDLCGTSRSRVLVTARQIAMYLCRELTDLSLPKIGQQFGRDHTTV
FT                   MHADRKIRSLMAERRSIYNQVTELTNRIKQQAHHNHHHL"
FT   gene            2824..3942
FT                   /locus_tag="Tfu_0002"
FT   CDS             2824..3942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54042"
FT                   /db_xref="GOA:Q47U22"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54042.1"
FT                   /translation="MLADAVAWTARTLPVRPSVPVLAGMLLDADDVDGHQRLTLSSFDY
FT                   EVSAQVSVDVDIDEPGRILVSGKLLAEIVRNLPPQTVEVSTDGAKVVVSCGSAKFTILT
FT                   LPVEDYPTLPAMPALTGSVLSDTFAAAVSQVAVAAGRDDTLPMLTGVRIEIEGSTVTLV
FT                   STDRYRLAVRELTWTPEDPNVSAVALVPAKTLADTAKSLTGGAQISIALSTAENGGEGM
FT                   IGFEGGGRRTTTRLLEGEFPKYRKLLPESFNSVAEVQKNEFIEAVKRVSLVAERNTPLR
FT                   LSFTSDRLVLEAGTGEEAQAVEELSATLEGDDIQIAFNSTFLLDGLNAIESDVAHLQFT
FT                   TSTKPAIITGKPADDGTASDYRYLIMPVRISN"
FT   gene            4002..4886
FT                   /locus_tag="Tfu_0003"
FT   CDS             4002..4886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54043"
FT                   /db_xref="GOA:Q47U21"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54043.1"
FT                   /translation="MQLGMIGLGKMGGNMAARLRDKGHEVIGYDVNPELRDVDSIAELV
FT                   ERLSAPRTVWLMVPAGEPTRNTIRELADLLDEGDLVIEGGNSHYRDDRVHADELARRGI
FT                   EYLDAGVSGGIWGRENGYGIMVGGSAENVARAKPIFDALTPEAGSGFVHAGEIGAGHFV
FT                   KMVHNGIEYGMMQAFAEGYELMAASGIVKDVPGTLASWRQGTVVRSWLLDLLVRALEED
FT                   PELEQLRGYAEDSGEGRWTVQAAVDHAVPAPVITAALYARFASRQEDSPAMKVIAALRN
FT                   QFGGHAVVKKNTD"
FT   gene            4988..6121
FT                   /locus_tag="Tfu_0004"
FT   CDS             4988..6121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54044"
FT                   /db_xref="GOA:Q47U20"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47U20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54044.1"
FT                   /translation="MHVSHLQLADYRSYEAAYLELEPGVSTFIGPNGQGKTNLVEAIGY
FT                   VATHSSHRVAHDAPLVRRGAQRAVIRAAVVRHGQTALIELEINPGRANRARLNRSPNTR
FT                   MRDVLGILHTVLFAPEDLALVKGDPGERRRFLDELLTARAPRYAGVRSDYERVLKQRNA
FT                   LLKSAAAQNLHHRGGRDLPTLDVWDEHLAQIGAELLAARLALVAELQPLAAKAYGELTA
FT                   TQDPISLRYRCSATDEELDTTNRPQLVEILRAALLRARPDELRRGVSLVGPHRDDLQLW
FT                   LNDLPAKGYASQGESWSYALALRLAGFELLRADGDDPVLLLDDVFAELDAERRRRLASY
FT                   VRTAEQVLVTAAVPDDVPQELSGARFRVTGGSVERER"
FT   gene            6111..6632
FT                   /locus_tag="Tfu_0005"
FT   CDS             6111..6632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54045"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54045.1"
FT                   /translation="MNGEHPAPERTDSPQTEENITPPTPLRGVELARQALAKARAEAKA
FT                   RGAAPQGQDRKPQRSLVRSRGEPQQFGDAIRAWLIEHGWQEQVAIGGIFGRWSRIVGER
FT                   LAEHVRPCSYADGELVVAVDSPAWATQIRAMAPQLVRKLNEELGHGAVRVIKVNGPGGY
FT                   RTSRGQWRVR"
FT   gene            6950..8935
FT                   /locus_tag="Tfu_0006"
FT   CDS             6950..8935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54046"
FT                   /db_xref="GOA:Q47U18"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54046.1"
FT                   /translation="MSCGWSASPGRRVFPTLAYDARSITVLEGLEAVRKRPGMYIGSTG
FT                   ERGLHHLVQEVVDNSVDEALAGYATAIEVTLLADGGVRVTDNGRGIPVDPHPVEKKPAV
FT                   ELVLTTLHAGGKFDSKSYAVSGGLHGVGVSVVNALSTRLEVEVRRDGYLWTQSYEMTKP
FT                   VTELIRREPTDETGTQITFWPDGSIFETTTFNFETLSRRLQEMAFLNKGLSITIRDERP
FT                   EFVGDSPVTQTYYYEGGLSDFVRHLNATKEPVHSSIIAFEEAGDGIAVEIAMQWNQSYT
FT                   SSVHTFANTINTAEGGTHEEGFRAALTSIVNRYARDQKLLRDKDENLTGDDIREGLTAI
FT                   VSVKLADPQFEGQTKTKLGNTEAKSFVQKVCHEYLRDWLDRNPGEAKDIVTKATQAARA
FT                   RIAARQARELTRRKTLLESTSLPGKLADCQSTDPERCEVYIVEGDSAGGSAKGGRDPYY
FT                   QAILPIRGKILNVEKARIDRILKNNEVQAIITALGTGIHDDFDITKLRYHKIILMADAD
FT                   VDGQHIRTLLLTLLFRFMKPLIEAGHVYLAQPPLYKIKWDPRGTDVDYAYSDRERDEKI
FT                   AAGIAAGKKDPRPRDLVQRFKGLGEMNPSELWETTMDPERRVLLQVTLDDAAQADEMFS
FT                   VLMGEDVESRRAFIQRNARDVRFLDI"
FT   gene            8992..11538
FT                   /locus_tag="Tfu_0007"
FT   CDS             8992..11538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54047"
FT                   /db_xref="GOA:Q47U17"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54047.1"
FT                   /translation="MTDVNTTPEAPDNTGGRIEPVDLQVEMQRSYLDYAMSVIIGRALP
FT                   DVRDGLKPVHQRVLYAMYDSGYRPDRGYFKCARVVGDVMGNYHPHGDSAIYETLVRLAQ
FT                   PWAMRMPLVDGNGNFGSPGNDPAAAMRYTECKLAPLAMEMLRDIDKETVDFRPNYDGRS
FT                   QEPVVLPARFPNLLVNGSSGIAVGMATNIPPHNLREVAEGVYWYLDHPDASDEELLDAL
FT                   IERIKGPDFPTRGRIVGRRGIEETYRTGRGSITMRAVVEIEEDKRGRQCLVVTELPYQV
FT                   NPDNLALKIAELVKEGKISGIADVKDESSGRTGQRLVIVLKRDAVAKVVLNNLYKHTQL
FT                   QETFGANMLALVDGVPRTLRLDQMIRHWVAHQIEVIVRRTRYLLRKAEERAHILRALLK
FT                   AIDRIDEVIALIRGSASADDAKNGLMELLAIDDVQARAILDMQLRKLAALERQQLTSEY
FT                   DELMAQIADYNEILESPERQRRIIRDELAEIVEKYGDDRRTEIVPYEGDMRMEDFIAEE
FT                   DIVVTITRGGYAKRTRLDNYRAQKRGGKGVRGAQLKQDDIVQHFFVTTTHHWILFFTNK
FT                   GRVYRTKAYELPELARDSRGHHVANLVPFLPDEEIAQVLALRDYDAAPYLVLATRSGLV
FT                   KKTKLAEFDSARSSGIIAINLREDDELIAARLVYPTDDLLLISSNAQAIRFPASDDSLR
FT                   PMGRATSGVIGMRFAEGDYLLSMDVIREGEGATDVLVATEGGYAKRTPADQYPVQKRGG
FT                   KGVLTARIVESRGKLVGALMVDPEDEILAITSNGGVIRTKCAEIKQSQRATMGVRLMHL
FT                   SKGNHVVAIARNTEGMGDDAENGAHGSEDAEDTEQD"
FT   gene            11738..12430
FT                   /locus_tag="Tfu_0008"
FT   CDS             11738..12430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0008"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54048"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54048.1"
FT                   /translation="MSDNAQRESAAVEPNPANTDKSGVDAARTTEVEGPETETLGTATD
FT                   SDEVTGAGGPETTGGAEGESPESADAAEASTSEAAQGGSDMAAEAVAASPSAESKTAKT
FT                   AARKAHLTLSRIEPWSVMKFSFIISLVCFIILFVAVAVLYTGLEVLGVFDAVTELITSL
FT                   TEGDEVSEEFIINPEVWFSPTRILGYTALFGALNVILITALATAGAMLYNLSADLVGGI
FT                   DVTLSETE"
FT   gene            12591..12664
FT                   /locus_tag="Tfu_R0001"
FT   tRNA            12591..12664
FT                   /locus_tag="Tfu_R0001"
FT                   /product="tRNA-Ile"
FT   gene            13759..14910
FT                   /locus_tag="Tfu_0009"
FT   CDS             13759..14910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0009"
FT                   /product="putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54049"
FT                   /db_xref="GOA:Q47U15"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54049.1"
FT                   /translation="MSVVAVIPARGGSKGVPLKNLARVGGRPLVARAVDACRRADLVDM
FT                   VVVSTDHDGIAAVARDAGATVVERPADLGADTASSESVLLHALDRLAEDGINPQILVFV
FT                   QCTSPFIDPADLDDAVRQVRDDLADSVFSAVETYEFLWHITPDGARGVNHDHTYRPRRQ
FT                   DRAPHYRETGAFYVLRVSGFREHQHRFFGRIAVQQVNPAHAVEVDSVEELDLACAVARA
FT                   LDREEPLDVDAVVTDFDGVHTDDRVYVDQDGRETVVVNRGDGMGVSLLLKAGIRVCILS
FT                   TEVNSVVRARARKLGVPVMHGLSDKRTALLQWMADEGLDPARVAYVGNDVNDLGCLAEV
FT                   GWPIAVPDSHPDVLAAARLVLTRPGGSGAVREICERVLAARKG"
FT   gene            14917..15828
FT                   /locus_tag="Tfu_0010"
FT   CDS             14917..15828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0010"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54050"
FT                   /db_xref="GOA:Q47U14"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54050.1"
FT                   /translation="MTQNATTDLSVSVPAPVAIGDILVGPGQPTYVIGEIGINHNGDVD
FT                   IARQLIEVAAEAGCHAVKFQKRTPEICVPKEQRDKIRQTPWGEMTYLEYKHRVEFGRDE
FT                   YTEIAKICEENGLQWFASPWDVPSVEFLESFDVVAHKVASASITDHELLRALAATGKPI
FT                   ILSTGMSTIEEIDAAVEIFDRSKLILMHSTSTYPMPPEEANLRTIITLRERYGVPVGYS
FT                   GHERGLQISLAAVTLGAVAVERHITLDRTMWGSDHAASLEPAGLQHLVRDIRVIEQALG
FT                   DGVKRVFPGEEEPRKRLRRTTA"
FT   gene            15907..16869
FT                   /locus_tag="Tfu_0011"
FT   CDS             15907..16869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0011"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54051"
FT                   /db_xref="GOA:Q47U13"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54051.1"
FT                   /translation="MTTLSVIIPVRDVAPLIADTLESLRRNARPDFEFIVVDDASSDAT
FT                   PEVVEDSGVPGLTLLRSERSLGPSAARNRGLAVAQGQYVAFLDGDDWLAPGYLADAVEA
FT                   IADLGVDFIKTDHVKVTGKARSRARVPEGRRGVALPARSGIPPEHATTMVDYPNVWSGV
FT                   YDRRLYEQGLLSFDEDLHTAEDRLWTWRLHLHADTFAAVPLVGVFYRREVPQSLTQAGD
FT                   ERQLQFFDAHDRIRAELESLPDGERYLPKLIRTYCALIAFHLDREDRLAPRVRRQLRSR
FT                   AAAALSAMPPRLLARVLPALGAEREQLLAELVDLETVVA"
FT   gene            16874..18202
FT                   /locus_tag="Tfu_0012"
FT   CDS             16874..18202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54052"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54052.1"
FT                   /translation="MAQLFVASTFFGAMSLAAALDAGQFGAADQRRILVVSNNALVPEV
FT                   VPPLDAAPGFDVLRSRFGEVVSWNELLWPFHPSTWQPRQQERPLLNRLLRHYWDLAEDE
FT                   PLHLVVESIQVPPARAFASVFDDAAITVYSDGLMSYGPTRESPPREVATRIDRVLYLDL
FT                   VPGVEPLLLSEYGVARRTISGEAFRAVVAEVAKAVDGVGERTAWAGAPLLLGQYLAALN
FT                   FLTAAEEDALHARMLRGVAAQGHRTVLFKPHPSTTARTFRTLHATAEQQGVQLVVLDEP
FT                   VPVEVWYEVLRPALVVGVFSTGLSTASRYYGLPVATVGTELLLDRITPYQNSNRIPVTL
FT                   ADATMPRLAEDGTVHPPRITADRVAEELLPLLVAVGYCMQNSVYSHLRDEAVAYLSRGL
FT                   DEVTRRYFKKRRLTALRLPGAAPAKPRSLPWLAARVRRLRGRS"
FT   sig_peptide     16874..17029
FT                   /locus_tag="Tfu_0012"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.841) with cleavage site probability 0.445 at
FT                   residue 52"
FT   gene            complement(18230..18988)
FT                   /locus_tag="Tfu_0013"
FT   CDS             complement(18230..18988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0013"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54053"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54053.1"
FT                   /translation="MMGFSHATTGVLVGVAVAAPLAAAAGTPPTPMGLLAWALLGAGSA
FT                   LVPDLDHPSSTATRSQGFVTGLLSRGMRALSLAVYRRTRTPADRSDGEHRHLGHTPVFA
FT                   AAVGAVIGLLCHLSWWATLVTAWFLAFLGLRALRKVAWRGLRTALGSWPGAALGALCVA
FT                   ALFLTAWDNYPPGWIVGAVVALGMIVHSLGDALTSSGVPLAWPFTVNGRRWAMLGVPRW
FT                   MRFRTGTWPEWVVGAVSLTGSLAVGYALVA"
FT   sig_peptide     complement(18914..18988)
FT                   /locus_tag="Tfu_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.583 at
FT                   residue 25"
FT   gene            complement(19163..20473)
FT                   /locus_tag="Tfu_0014"
FT   CDS             complement(19163..20473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54054"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54054.1"
FT                   /translation="MTNRGPVHVMAIADSDSYLKWAACLVDALPPDWSGELAVARTPIA
FT                   PSPTQMRGALESTRASAALPPVLSATALRRAVRRTRPDVVVTACTGPVVDVLINDVLAG
FT                   LTPRPVFVSGLPGVSVPATEKAWLYRAPVDLFIVHSHREAAEFRELGEQLGVTGEVGLA
FT                   TLPFLPHNPAPALPAPAAPREAPRNRVVFATQAKVPVEREEREAILRALADLAARRPDL
FT                   EVVVKLRARAHEQQTHRERHHYETLWQNLVAAGEVPADAVTFADGSMREQLAHAVGFVT
FT                   VSSTAALEAIAYDVPLLILSDFGVSAEMINLVFEDSGTLGTLEDLRAAEFRKPDPQWCA
FT                   ANYFHDAADNDWVPRLSALVARARTEGLPVRPPLLTSPKDVARRRRGRLRMEVPPGALR
FT                   TIGRFRKRLKRVRRLLTPAKKPAAQPVHHDRAEQSST"
FT   gene            complement(20470..21501)
FT                   /locus_tag="Tfu_0015"
FT   CDS             complement(20470..21501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54055"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54055.1"
FT                   /translation="MKNSSSPAFCPDRADSTTTAMAWVETPLQLLSVVEAHHTGAFAQH
FT                   TQVLPRAGSPSLADTVTALAETDLPDGLTVLPAVPSLAPHHSGSGVWFIGDAFSGQVQR
FT                   SLLGSRARHYVIVDDGLATLHLLRLLSRRTAVPLERARVRSTLPRRLLGLAAARKIRAA
FT                   ARTGRVTVFTMLPLPDRLVDEATAVGIRIITHDFPWLRSLPGGTLPEENRVVLGTAMVC
FT                   DGLIHAEPYLAWVTHQAEQAPLLYYPHRREDDRTLAVLRAHPRLRVADQGLPAELALRG
FT                   LAARHEVVSLPSTAVTSLRVLLERNGTTVSAVPIPETWWTDQATPSLRAHLSTFVTHPK
FT                   DPS"
FT   gene            complement(21573..22844)
FT                   /locus_tag="Tfu_0016"
FT   CDS             complement(21573..22844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0016"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54056"
FT                   /db_xref="GOA:Q47U08"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54056.1"
FT                   /translation="MWRLANHVRQYAWGSTTEIPRLLGIEPNGQPQAELWLGAHPSAPS
FT                   TIASGGTEPIGLDAMIASDPVTTLGTEVARSFNKRLPFLLKFLAVAQPLSLQAHPDKER
FT                   AQAGFAAEEAAGIPIDAPHRNYRDPNHKPELVMALGEFEALCGFRSPAASAADLAGLTT
FT                   PLAQALHADLTAADPSAALRSAMTRLLTLPADQRATLVTETAEELAERATAPSRHLRAV
FT                   LDLAERYPGDPGAIAALLLNHVVLSPGQALFLPAGNVHAYLHGVAVEVMATSDNVLRAG
FT                   LTTKHVDPEELLKVLDYSMLPIPYVEPVVRDGLIEYRPDIDDFALIVAEPREKAVWLPE
FT                   GPAIALVVEGAVELHAPSGGNLALARGESAFLSARTGPVLASGQGRIIIATVAQQPAAT
FT                   TADHHDHTTRWSSVHPTLDPVNPR"
FT   gene            complement(23403..24821)
FT                   /locus_tag="Tfu_0017"
FT   CDS             complement(23403..24821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0017"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54057"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54057.1"
FT                   /translation="MAYPAEGGRRPRFWATARAALWTSASALLPGLAHLRAGKRAAGAG
FT                   ILGGFLLLATAAGAAFYQLRSDLSWQAWLAAQPYWVEAVAIGAVALATLWSSIIIRSWQ
FT                   LTRPRPERWGSRAVGAVLVTVLCTALIVPFAFVVRTAVTLHSTLTSVLAPAEPASQAAA
FT                   DTPWPHRSHINVLLLGGDAGDNRYGLRTDTMIVANIDIDSGDTVLISVPRNLENVPFPE
FT                   GTALAERYPEPYGFDDLLNEVYQTVAEEPEELAINPDAPDPAADTLKHVIGHALGISID
FT                   YYALVDLRGFADLIDAIGGVVVPVEEPIRYGRRGEGLLEPGERRMSGKEALWYSRSRTD
FT                   SDDYARMGRQGCLLKYVAEQTNPVTVLRRFDELADATQRTLTSDIPPSHLPALVDLARR
FT                   VSQARMHTLQLSPPQVTTAHPDWTEIRTLVDRAIRSNGEDHGPADTAKQPSPSPDSPGR
FT                   QIGKKPVSLDRLCP"
FT   gene            complement(24941..25561)
FT                   /locus_tag="Tfu_0018"
FT   CDS             complement(24941..25561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54058.1"
FT                   /translation="MWITCARNLWITFPHPLITASELQKLCPRAVHEKNSADRYPQVIH
FT                   RLGRHLWMFLTPTSPRIHCGSRGPSTPLGRLREPRYGRRWRSPHPHTHRRDMGGAVLSE
FT                   APDPRQVRPRGNPVPPHTPPGNEGPCPAIADSFPTAAAAARTILFSQQLPLQHTAVFPT
FT                   TRKGPLRSGSSASALFTLLNQVGPRHTYPAPLAFPFSPRTPFS"
FT   gene            25692..27041
FT                   /locus_tag="Tfu_0019"
FT   CDS             25692..27041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0019"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54059"
FT                   /db_xref="GOA:Q47U05"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54059.1"
FT                   /translation="MSVDHSVEEVGYDRTPPHDIMAEQCVLGGMLLSKEAIIQVVEILS
FT                   SSDFYRPAHQTIYDTIVDLFARGEPVDAISVHAELTKRGEIARVGGAPYLHTLTDTVPT
FT                   AANAGYYARIVADRAVLRRLVEAGTRIAQLGYSGDGDVDDLVDQAQAEIFKVAERRTSE
FT                   DYLPLSDIMPGALDELEAIASHDDTLTGVPTGFTDFDALSNGLHPGQMIIIAARPAVGK
FT                   STLALDFARSAAIKHQLTTVFFSLEMGRNEIVMRLLSAEARVPLHTMRSGMMTDEDWAR
FT                   LARRMGEVAGAPLFIDDSPNLTMMEIRAKCRRLKQQHDLKLVIVDYLQLLSSHGRVESR
FT                   QQEVSEMSRSLKLLAKELEVPVVALSQLNRGPEQRTDKKPQISDLRESGSIEQDADMVI
FT                   LLYREDVHEKESPRAGEADLIVAKHRNGPTATVTVAFQGHYSRFVDMAPG"
FT   gene            complement(27533..28045)
FT                   /locus_tag="Tfu_0020"
FT   CDS             complement(27533..28045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54060"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54060.1"
FT                   /translation="MKLVTPGDSAPASVNRYLLPHEQQVITVRRHPAVLLGPTAIVLGS
FT                   LIAAGILSNTSFVTSGAMLAIIWWLWLLVLVWFVWKVAEWSVDYFVITSARLLGTNGLI
FT                   TRQVNMMPLGKVTDMRFERTLLGRLLGYGTFVMESAGQDQALSKIDFIPYPEQLYLEVV
FT                   GLIFPDK"
FT   gene            complement(28061..28228)
FT                   /locus_tag="Tfu_0021"
FT   CDS             complement(28061..28228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54061.1"
FT                   /translation="MPPKLKKWLGYALIAFAIFYLLTQPATVGTLVLNIFAGLGGAANS
FT                   LSTFVNTILL"
FT   sig_peptide     complement(28100..28228)
FT                   /locus_tag="Tfu_0021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.870) with cleavage site probability 0.295 at
FT                   residue 43"
FT   gene            complement(28370..28594)
FT                   /locus_tag="Tfu_0022"
FT   CDS             complement(28370..28594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54062"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54062.1"
FT                   /translation="MSQTHDALSRDLAPVVTRLSAEFKDVHPESIVSRCVTAARNGAED
FT                   VVGYATPELVERIARQHLKVLALALAEQR"
FT   gene            complement(28987..29259)
FT                   /pseudo
FT                   /locus_tag="Tfu_0023"
FT   gene            complement(29121..29639)
FT                   /pseudo
FT                   /locus_tag="Tfu_0024"
FT   gene            29947..30447
FT                   /locus_tag="Tfu_0025"
FT   CDS             29947..30447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54063"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54063.1"
FT                   /translation="MTELELDDGAGDFAAVAYREEDYWDVDLLPVALTRDLKGLLHALH
FT                   QQPSISGAIGLVSVADDFFILARVYGRDNVSVFLSDITASMDWKIARDVLEYLDIDIPD
FT                   DEDVDQVLPAGDMSILADLGLDEMELGALAGDLDLYPDEVLSSIAERLGFHAAFQRALD
FT                   ALG"
FT   gene            30506..31000
FT                   /locus_tag="Tfu_0026"
FT   CDS             30506..31000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54064"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54064.1"
FT                   /translation="MAVFAAVFSHAADGWTGTEVDLAEYEGIDDLADLMRDTAAAESTA
FT                   ETSVVVLAEADDEWFGVARLDDTGEPRAFLSDMRVVYGHPAARLFLETDGGIDDDQETE
FT                   GTGQNPYPEPVGDPDLLDDLGIPGTELMALTTREGILPADALTTIADRAGFAGELDELR
FT                   A"
FT   gene            31030..31482
FT                   /locus_tag="Tfu_0027"
FT   CDS             31030..31482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0027"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54065"
FT                   /db_xref="GOA:Q47TZ9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54065.1"
FT                   /translation="MRRALEEAEKTSSSGDVPVGAVVLDPDGVVIGAGHNEREATGDPT
FT                   AHAEVLALRAAARRLGSWRLSGCTLAVTLEPCTMCAGAIVLARIERLIYGARDERAGAV
FT                   GSLWDVVRDRRLNHRPEVIPPDLVDPELSAACSRLLTDFFARHRTR"
FT   gene            32306..32393
FT                   /locus_tag="Tfu_R0002"
FT   tRNA            32306..32393
FT                   /locus_tag="Tfu_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(32519..33625)
FT                   /locus_tag="Tfu_0028"
FT   CDS             complement(32519..33625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54066"
FT                   /db_xref="GOA:Q47TZ8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54066.1"
FT                   /translation="MDTAPLLPSSIRDQFTREVVYLNTATCGLPPRVAHEATLAVERDR
FT                   ARGRLTLDIAHQAVERSRAAFARLVGVPVSRVAVGSQASFFVGLVAASLPPGATVVVAE
FT                   EDFTSVTYPFLAATGRGVTVRPVPLDRIIDAVDTSVDLVSVSVVQSADGRIVDVPALLD
FT                   AAATHGARVLLDTTQSSGWLPIPADRVDYLVCSAYKWLLGPRGACFFAGTDDALAELTP
FT                   IAANWFAAEDITSAFYGTELRLASDARRFDLSPAWASCVGLAPALELLADLGEAALGAH
FT                   NVALANRFCAALGLPPTDSAIVSVAVDAKAQQVLADAGIVAAMRAGRMRCAFHLSTDAA
FT                   DVDRAVEEIGPYLRDANLEEAVRVPGDR"
FT   gene            33709..34626
FT                   /locus_tag="Tfu_0029"
FT   CDS             33709..34626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0029"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54067"
FT                   /db_xref="GOA:Q47TZ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54067.1"
FT                   /translation="MLDLTRLRVLCEVARLGSMSAAARALSYTQPAVSHHIARLEAEVG
FT                   TPLVVRHGRGVRLTEAGRVLVGHAEAVLARLDTAEEEVAAIAGLRAGRVSLAAFPTATA
FT                   GIVPQALATLRERAPDVAVTLVEAEPPESLDLLREGEVDVTLAFSYDETPPDASTGIRE
FT                   VTLCREQVRLLLPGDHPLAAEHTLELAALRKETWVAGCERCRSHLVHVCRRAGFEPRIA
FT                   YTTDDHLAVQRLVSLGMAVGVLPQLALLLHQGENVAVVDSPELGWRRLFVAVAGGTIPP
FT                   AAAALVDELTAAVGQLNSGNQAGS"
FT   gene            complement(34593..34904)
FT                   /locus_tag="Tfu_0030"
FT   CDS             complement(34593..34904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54068"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54068.1"
FT                   /translation="MVFKRVGNGRPYPDHGLSPSAWYKIAPRQVRLDELVTTKSVLDLK
FT                   YLLSKDSTFFGDLFPHVVRWKGELYLEDGLHRTLRAALQQRETVAARVYDPAWFPELS"
FT   gene            complement(35195..36463)
FT                   /locus_tag="Tfu_0031"
FT   CDS             complement(35195..36463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0031"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54069"
FT                   /db_xref="GOA:Q47TZ5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54069.1"
FT                   /translation="MIDLRALREDPDRLRASQRARGEDESVVDRLLDLDSRHRAALARF
FT                   ETLRAEQKSVGKSVSRASAEEREALLNRAKSLASEVKSAEAEAEALSDELTTLLRSVPN
FT                   VVESDAPVGGVDDFVVVEEVGTPRQFDFTPRDHLELGEMLGAIDTERGAKVSGARFYFL
FT                   TGVGALLELGLLNLAMQRAVANGFTPMIPPVLVKPETMDGTGFLGEHAAEVYHLPADDL
FT                   YLVGTSEVPLAGYHANEILPADALPTRYIGWSSCFRREAGSYGKDTRGIIRVHQFNKVE
FT                   MFVYAHPDEAHEEHLRLLAWEREMLDLIEVPYRVVDIAAGDLGTSAARKYDCEAWLPSQ
FT                   GRYRELTSTSNCTEFQSRRLNIRYRDTDGKPRFVATLNGTLATTRWIVAILENHQQEDG
FT                   SVVVPEALRPFVGQDVLHPIAKK"
FT   gene            complement(36945..37511)
FT                   /locus_tag="Tfu_0032"
FT   CDS             complement(36945..37511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54070"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54070.1"
FT                   /translation="MTQQPMSDSTAMLVGILAGLATIALLTLVIAALASVLSMRSLTRG
FT                   GKLLWTLLVLQLPILGAVAWFVIGRQGPLNSLLGLIKSGRHESPGTGEHVHDDLFETDV
FT                   DRLLAASNGAESRSSRRATALVTEPSRFADEYSPADHSWHTVNGHHDTATIRARTGATA
FT                   SRRGSDSTPRFRSERSRIPRSRMPR"
FT   sig_peptide     complement(37407..37511)
FT                   /locus_tag="Tfu_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.881 at
FT                   residue 35"
FT   gene            38112..38906
FT                   /locus_tag="Tfu_0033"
FT   CDS             38112..38906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0033"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54071"
FT                   /db_xref="GOA:Q47TZ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54071.1"
FT                   /translation="MTEKPGYLRVADSLREPILNGELPPGTRLPSRAQLARRHAVSEQV
FT                   ARCALQLLVAEGLIEGRAGSGYYVRAPSAEVLLSRTSHLPGLDPLRTEWLGARTETASI
FT                   AMARRLGTRVGEPLYRTECLGYAQGTPIALWVAWEPAILTLGTGLTPGERPDTSVAERL
FT                   AEVGVTVDRIEEEVSVRRLREVEARRLALEPGTAILLVQRTHFAGRRVVETSDLIVSAE
FT                   HCRLGYRLVSPSRPGRTAADKNGPSPPRSRETAASSQMGSAE"
FT   gene            complement(38934..39296)
FT                   /locus_tag="Tfu_0034"
FT   CDS             complement(38934..39296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54072"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54072.1"
FT                   /translation="MRQIIRGAAVSGAAACLLAVSSFPALAEEEADWSTDVSIDLPVLD
FT                   DEVSGLNEQPEGEGLEEDTVGAGTVINQCVVEQDALVLGLAPGDPGGLPLLSLGLNVLN
FT                   EYYCIGNTVEVHNHAN"
FT   sig_peptide     complement(39213..39296)
FT                   /locus_tag="Tfu_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.941 at
FT                   residue 28"
FT   gene            complement(39579..40034)
FT                   /locus_tag="Tfu_0035"
FT   CDS             complement(39579..40034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54073"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54073.1"
FT                   /translation="MVATHHPILSAWSSALLLSLSSRHRLPASRSLRDTDHTRIFDPSA
FT                   VTVSHTEIHTEGTPSMRRTVTAIAVGTLAAGLFSNTAPALAGEEPRPIVMELCTVTQRL
FT                   ITGNVTVPSPAPAPDEPPDLPAPAPEAQHHPLLAAACEGNSVTVTTP"
FT   gene            complement(40150..40398)
FT                   /locus_tag="Tfu_0036"
FT   CDS             complement(40150..40398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54074"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54074.1"
FT                   /translation="MRGIVKAAAVSAITAGLLSFSTATALAGGFEIDRESHTTVVDQCV
FT                   VDQRVTISSPLDLPAELLPLGEDTYNCISNEAVVINR"
FT   sig_peptide     complement(40315..40398)
FT                   /locus_tag="Tfu_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.586 at
FT                   residue 28"
FT   gene            complement(40654..41022)
FT                   /locus_tag="Tfu_0037"
FT   CDS             complement(40654..41022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54075"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54075.1"
FT                   /translation="MPTPCDIVSDSNREITLGAHLSIDGRLTANGHHLKGLSHMRQMTR
FT                   LATVGAMSLALVGASASAALAGYHEFSSEETFTNIDQCVVVQQLEAGGLTLPDIIPPDL
FT                   LGGSAYNCIGNEVVVVNE"
FT   gene            complement(41202..41438)
FT                   /locus_tag="Tfu_0038"
FT   CDS             complement(41202..41438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54076"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54076.1"
FT                   /translation="MRRIMKLAAVSTLAAGLLGAGASSALAGDYTEITATETAQCISAQ
FT                   EATGAGLLLGLGLNLNLLNSSACAGSVNVNDNN"
FT   sig_peptide     complement(41355..41438)
FT                   /locus_tag="Tfu_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.949 at
FT                   residue 28"
FT   gene            complement(41749..41982)
FT                   /locus_tag="Tfu_0039"
FT   CDS             complement(41749..41982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54077"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54077.1"
FT                   /translation="MRRIMKLAAVSTLAAGLLGAGASSALAGDYVEVTATETAQCISAQ
FT                   EAGGFSLLIGAGANVNALNAASCTGSVNINDN"
FT   sig_peptide     complement(41899..41982)
FT                   /locus_tag="Tfu_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.910 at
FT                   residue 28"
FT   gene            complement(42286..42519)
FT                   /locus_tag="Tfu_0040"
FT   CDS             complement(42286..42519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54078.1"
FT                   /translation="MRRIMKLAAVGALAAGLVGAGASTAFAHDYTEITATKTAQCVAEQ
FT                   PAVGLGLLAGLGLNVNALNSASCTGSVNVNDN"
FT   sig_peptide     complement(42436..42519)
FT                   /locus_tag="Tfu_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.799 at
FT                   residue 28"
FT   gene            42815..43180
FT                   /locus_tag="Tfu_0041"
FT   CDS             42815..43180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54079"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54079.1"
FT                   /translation="MLLGLALPTQDPELILWPLHPPRSRTRPSLAGPWRHASPQDAGQS
FT                   GRYSSVRTTAPAAGSHTASIPPQRTMADDTSRRPSPQTLNSTKQTMPVLPVNRNLAPDI
FT                   LATVLLSLQFGSPRFMG"
FT   gene            complement(43435..44493)
FT                   /locus_tag="Tfu_0042"
FT   CDS             complement(43435..44493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0042"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54080"
FT                   /db_xref="GOA:Q47TY4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54080.1"
FT                   /translation="MSNRLPTLAVVGATGAVGTVMLDILSTRKNVWGEIRLVASARSAG
FT                   KRLTVRGEEVEVQAISPEVFDGVDVAMFDVPDEVSKEWAPIAAERGAVVVDNSGAFRLD
FT                   DDVPLVVPEVNAEQVRNRPRNIISNPNCTTLSMIVAIGALHRAYGLTDLVVSSYQAASG
FT                   AGQQGVDTLYDQIAKVATDRTLGTRAGDVRAAVSDLGPFPAPLALNVVPWAGSLKDDGW
FT                   SSEELKVRNESRKILGLPDLRVSATCVRVPVVTTHSLAIHATFSTEVDADEARRLLASS
FT                   PGVVVQDDPAKGEFPTPIDVVGTDPTWVGRIRRSLDDPRSLDLFLCGDNLRKGAALNTA
FT                   QIAELLAEEFTS"
FT   gene            complement(44490..45761)
FT                   /locus_tag="Tfu_0043"
FT   CDS             complement(44490..45761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0043"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54081"
FT                   /db_xref="GOA:Q47TY3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54081.1"
FT                   /translation="MALIVQKYGGSSVADADAIKRVAERIVAQKKAGYDVVVVVSAMGD
FT                   TTDELLDLAKQVSPLPPGRELDMLLTAGERISMALVAMAIGNLGYEARSFTGSQAGVIT
FT                   TSLHGNAKIIDVTPGRIRDALAEGAICIVAGFQGVSQDSKDITTLGRGGSDTTAVALAA
FT                   ALNADLCEIYTDVDGVFTADPRIVPSARRIPQISYEEMLEMAASGAKILHLRCVEYARR
FT                   YNIPLHVRSSFSQKPGTWVVSEVEETEGMEQPIISGVAHDRSEAKITVVGVPDRVGEAA
FT                   AIFKALADAEINVDMIVQNVSAASTSRTDISFTLPADSGQNALAALKKIQDKVGFESLL
FT                   YNDRIGKVSLIGAGMRSYPGVTARFFDAVAREGINIEMISTSEIRISIVVAQDDVDAAV
FT                   AAAHREFQLDADQVEAVVYGGTGR"
FT   gene            complement(45983..46582)
FT                   /locus_tag="Tfu_0044"
FT   CDS             complement(45983..46582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0044"
FT                   /product="DNA replication and repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54082"
FT                   /db_xref="GOA:Q47TY2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54082.1"
FT                   /translation="MYEGAVQNLIDELGRLPGVGPKSAQRIAFHLLAAETADVHRLVNA
FT                   LVAVKERVRFCAVCGNIAEETQCRICRDPRRDDTVICVVEEPKDVVAIERTREFRGRYH
FT                   VLGGAISPIEGVGPDDLRVKELMARLSEGRVTEVILATDPNLEGEATATYLARLLKPMG
FT                   LKVTRLASGLPVGGDLEYADEVTLGRAFEGRRALDF"
FT   gene            complement(46682..47032)
FT                   /locus_tag="Tfu_0045"
FT   CDS             complement(46682..47032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0045"
FT                   /product="Conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54083"
FT                   /db_xref="GOA:Q47TY1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54083.1"
FT                   /translation="MNPGGGLDMQAILQQAQQMQQQLMAAQQELDETKVTGSSGGGLVS
FT                   VTMNGRGQVEDVSIDPKAVDPDDAAETAQTIADLVLAAIRDGERMVEEIQQQKMGPLAQ
FT                   GLGGGFPGLPGL"
FT   gene            47324..49162
FT                   /locus_tag="Tfu_0046"
FT   CDS             47324..49162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54084"
FT                   /db_xref="GOA:Q47TY0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54084.1"
FT                   /translation="MTTTTIPPISEYAMLSDCRTAALVAPDSTIEWLCAPRFDSPSVFA
FT                   RLLDRHHGGAWEWTVPEATTVHRDYLAETLVLRTRWHTPNGTAVGHDFLAVVPRHASGI
FT                   APAGILVRLLHCERGTVRLQSRITARPDYSTRDAHWTSRSHALIDEHSGLLLSGPAETI
FT                   PDRSGAVVTDMVLRAGESVALGLDYTGDMLRRVDATTAHHLLTQTTHTWQAWASRSDYQ
FT                   GVAADWVRHSAVVLKGLISDDSGALITAPTTSLSEWPGGARNWDYRYAWRRDTARTIRA
FT                   LLRLGHHNDAGQLLRFLLDYCAEKENRVPPVTRIDNTPLPNETTLTHLSGYHDSRPVRI
FT                   HSDAYRQHQLDVYGHILEAAFAYHEATGHTSLTDLNELRKVVEIAGRLWRHPDAGVWGI
FT                   NTSPRHWTESKLYAWVCFDRAIRLFQQTGTVPADTLDQWQAERDAIRTDVIAKGCHAGL
FT                   GRFVQTYGAANVDGSLLHIPLVDFLPGTDPRVVATIDRIDAELGEAGFLVHRYDASTTR
FT                   DDVPDTGEGAFLPCSFDMVSALVLANRVDEAHHRFTTLCAHAGALRLFAEEMTADGTML
FT                   GNYPHAFTHLALIEAALHLDEAQRERAHRVEARRPA"
FT   gene            complement(49207..52773)
FT                   /locus_tag="Tfu_0047"
FT   CDS             complement(49207..52773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0047"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54085"
FT                   /db_xref="GOA:Q47TX9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54085.1"
FT                   /translation="MTNDPFVHLHVHTEYSMLDGAAKLKPLFEEAARLGMPAVAMTDHG
FT                   NMFGSYEFWQTSKESGVKPIIGIEAYVAPESRFHKQRVFWGTGKTGDEAAEGGKDVSGG
FT                   GRYLHLTMWARNAKGLRNLFRLSSLASFEGYYTKPRMDLELMAQYSEGIMVTTGCPSGG
FT                   VQTRLRLGQEREAIEYAGKLRDIFGRDSVFVELMDHGLDIEREVRSGLLTVAKKLGLRP
FT                   VVTNDSHYVTEDQAAAHDALLAVGVGKNLDDPTRFRFNGTGYYLKSAEEMRSLNTFDEW
FT                   LEGCRNTLWIAEQVEDGAYDDVFRPRDLMPKFPVPEGETQASWLRKEIERCIPNRYPNG
FT                   PSREVRERIEHELSIIERMGFPAYFLVVADICQYARRSGIALGPGRGSATGSMVAYVLG
FT                   ITDLDPLEHSLLFERFLNPERVSMPDIDLDFDERKRGDMIRYVTERYGEDRVAQILTFG
FT                   TIKAKAAIKDATRILGYPYALGDKITKAFPPAVGGKEIPLSAVFDESHPRYNEAAELRQ
FT                   LIESNPDVRKVYETASGLEGLTRGTGVHAAGVILSAEPLLDVIPLHKRETDGAIITGFP
FT                   YPQCEEMGLLKMDFLGLRNLTVIDDAIQNIKANEGKEINLSALPLDNKKTYELLSRGDT
FT                   LGVFQLDGGPMRALLKRMEPKKFGDIAAVLALYRPGPMAANAHNDYADRSNGRQEITPI
FT                   HPELKEALDPILAESFHLIVYQEQVMAIAQQLAGYTLGGADLLRRAMGKKKKEALEKEY
FT                   TKFSEGMLSRGFSKEAMQALWDVMLPFSGYAFNKSHTAGYGMISYWTAYLKANHPASYM
FT                   AALLTSVADDKDKMAVYLAECRKMGIRVLPPDVNESGLQFTPVGNDIRFGLGAVRNVGA
FT                   NVVESILKTREEKGKFTSFVDFLSKIELTVCNKRVIESLIKAGAFDSLGHSRLDLYRHH
FT                   EAAVDAVLSSKKQEAHGQFDLFGGGDEEDGGESAPLGFSINWTGEEWDRKTKLAFEREM
FT                   LGLYVSSHPLAGAERILARASDAPLLDVVNGERRNNDEVRIAGLISKVEKRINKAGNQW
FT                   AIATVEDLDASIEALFFPKVYPLYVDALVEDTAVSIKGRLNDRDGTFSLFVSEMSILDI
FT                   SHVSEGEPPVLLTIPEKRVTRELISELKQTLRSHRGDTPVRIRVDNPRRSRIFAIDDYP
FT                   VRVSPEFSGEVKSLLGPESITY"
FT   gene            complement(53074..53409)
FT                   /locus_tag="Tfu_0048"
FT   CDS             complement(53074..53409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54086"
FT                   /db_xref="InterPro:IPR025591"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54086.1"
FT                   /translation="MEQALALGRREEVKVVVSNPCFELWLLYHFQELTSGVHRTVLLKE
FT                   KLPKYLSGYNKRLPVNFPYAAHPKAKARALRAAPKHTETCHKGPNPSTTVWLLIDAIRN
FT                   AGDAKRR"
FT   gene            complement(53440..53640)
FT                   /locus_tag="Tfu_0049"
FT   CDS             complement(53440..53640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54087"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54087.1"
FT                   /translation="MCEGERTEVDYLKGITSFFGALPVEVEAVGLGRDPLQVVQEAIDR
FT                   FHEARVNARRTKDANLAFDEV"
FT   gene            complement(53663..55018)
FT                   /locus_tag="Tfu_0050"
FT   CDS             complement(53663..55018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0050"
FT                   /product="conserved hypothetical protein with similarity to
FT                   AbiLI: abortive phage resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54088"
FT                   /db_xref="GOA:Q47TX6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54088.1"
FT                   /translation="MLLRFRVANHRSIREEQELSLVAVPKRGEAKPKAHEIPPTVHVAG
FT                   IYGANASGKSNVLDALRWMSAAVKYSHIHWQPDAGVPRKPFRLDDTSHEEPSFYEIDFV
FT                   FEGVRHSYGFEVTDREVVGEWLFVFPHGRPKRLFEREGPQDYKFGKSLKGELRRIEKLT
FT                   RPNSLYLSCAASNNHPYLSSIHHWIGTHIRFATQNSFDEGVRFRFTQSLIEDPGSKGAE
FT                   YVSRLVRVADLGITDIVLSKREIDGFEKEFISFIRERLPDIPEEEFRKRIEQRPLFIHD
FT                   YSGKPRPLPIDEESDGTRSWFGLVGFVLRVLEEGDVFLVDEIDSSLHPVLSSTLIRMFK
FT                   DPVINPKGAQMVFASHDTTLLGTMLENKLLERDEVWFTEKDAHGATSLYSLVEFHPRGD
FT                   ENPERGYLQGRYGAVPHVNFQEIRSLFAELHGAAGEPSASAETGPPPESQYA"
FT   gene            complement(55183..57261)
FT                   /locus_tag="Tfu_0051"
FT   CDS             complement(55183..57261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0051"
FT                   /product="ATPase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54089"
FT                   /db_xref="GOA:Q47TX5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54089.1"
FT                   /translation="MSIALYRKYRPATFAEVRGQEHVTEPLRQALRNGRVNHAYLFSGP
FT                   RGCGKTSSARILARSLNCAKGPTPDPCGECDSCVALAPDGGGSIDVIEIDAASHGGVDD
FT                   ARDLRERAFFAPVNSRYKVYIIDEAHMVTREGFNALLKLVEEPPPHLKFVFATTEPEKV
FT                   IGTIRSRTHHYPFRLIPPNTLRELIEEILNEEKVPYDPAALPLVIRAGGGSARDTLSIL
FT                   DQLLAGSDERGITREAAVQLLGYTDSSLLGEMVDALGAGDGAAVFELIDRVVEGGHDPR
FT                   RFAADLLERVRDLVVLNAVPDALDKGLINVPPDAVEQMREQASRLGAAQLTRAAEILNK
FT                   GLTEMRGTTSPRLLLELMCSRILLPGVDPGDELALAARLERLERNGIAAAPAAPAVSPP
FT                   AAGTPATAPPSTPAAAPRPSTAEPRPPQPPAPSARPHPAPAAADDWGAPRRPSQPAPAA
FT                   PQPAAPGPAGEGSFDDRWPHIVEYLASNRKRAAHAIVRDGVHATLLQGRTLTLFFETEG
FT                   LMRSFVTGGRARDIAEAVHRVFGLEVAVEAKAGHPGNVRQAPPQAPMSRPPQPVAQSTP
FT                   PQPVQPSTAQPPGEPRDARAAAETGWDAPAAVPPSTPVSTQEPAPVPEPEPEPPSAAEP
FT                   APAPPASPVDASPAGEAEETNPEDTADNDLDESSLTGAALIEKELGGKLIKEIDHTD"
FT   gene            complement(57392..57483)
FT                   /locus_tag="Tfu_R0003"
FT   misc_RNA        complement(57392..57483)
FT                   /locus_tag="Tfu_R0003"
FT                   /product="SRP RNA; RNA component of signal
FT                   recognitionparticle"
FT   gene            57613..57697
FT                   /locus_tag="Tfu_R0004"
FT   tRNA            57613..57697
FT                   /locus_tag="Tfu_R0004"
FT                   /product="tRNA-Ser"
FT   gene            58893..59519
FT                   /locus_tag="Tfu_0052"
FT   CDS             58893..59519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54090"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54090.1"
FT                   /translation="MNPRKNLVVIGLTGVQRSITEVHSTADPANVSRIMAQSAARVARQ
FT                   FNPEELLPAAADPEGMPNRIAALPAAGRGQGRVRSAVQAVRETWKSWMACVSGRVIKVP
FT                   GIPGVSRSMAGLEVSDYAQQWEATHVALPEPTLQRAFAWVTSTIALGHLTCKTMPSAAH
FT                   PCPPSPAYPLMRSRSTPRGTTPLSLSPRTCSPPHQALRRDRRPPG"
FT   gene            59730..60761
FT                   /locus_tag="Tfu_0053"
FT   CDS             59730..60761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54091"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54091.1"
FT                   /translation="MTVHIAPVGLSIIGNLAKIEKLKFVEEPAGPNPIEQDFPWTELIK
FT                   QVQASGYLESIYPGKKPKDVMEAMFETGSAADSPERDELQEIADRINVGEWIRYRGVSA
FT                   ELDTLRQAAIEISSAKKKEEFLPSRKDTVFLLATDTDKGIAAAWWNAIALANGDIRRIR
FT                   YLSDLDENARLDKTAIGCIHILRIPGLDAFSSDQAFREPMKIMGRLGRLLVAPPESMLE
FT                   KVKRIIQPREEIRFYLSGGYKATIPYLVALAEWVRSLGEDVSAWIMHETSRKPFQLPLR
FT                   RLEVRQVRHELKPFYKDGKTKNLETNFFEGYAYEIRGKEYRLTAFGQGMCELFGIPTES
FT                   VPQ"
FT   gene            60758..62374
FT                   /locus_tag="Tfu_0054"
FT   CDS             60758..62374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54092"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54092.1"
FT                   /translation="MIANSTWQDRVHGAFFERERSALGDVFQRARINGNRDRDARLLQQ
FT                   AKELIREYELVSHLRIHNTSSDRSPDTIEDRLRTITGLLAENRALLLAALYSPLALVAA
FT                   ANEQYGEWGAHKQWIAWCWTVEAVWRCIARLDEIKPKGFIDTELDILLPVAARQRCIAF
FT                   LEVYRSRDDSEEQIATAAPYVFGATPGSDTEHLFTTRSIEARRIWVECLDHYESHTVLS
FT                   HADSSELEQEITALLFDSGRCGPLLGVSTDRLNALGNDHKHKKKERKCRTLKQDDKRIM
FT                   SNLAERHLLPRFRLWDTLRVAMAITQERRCRVGIAFCTSVSALATLLLVIVALFRPKLI
FT                   GCPTLTWAAVVAGGCCLLGIAGIIVHGRVWALPLLLRMPAAAAIGLFMLTAMHPSWWHA
FT                   AFGDALPDISSGSQPVSPPLGPLWATVLLSAAAYAYLLTTARNNGIDWRSALGRSFMVL
FT                   LVGALHALIVSLLGLAWVVPVFSENGAELAQGWAAHSRAGVITLVQATAWCLAAGVFSQ
FT                   ILWDDRPITAPLTHTRWRKDM"
FT   gene            62826..63449
FT                   /locus_tag="Tfu_0055"
FT   CDS             62826..63449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54093"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54093.1"
FT                   /translation="MDAHEWDQRYREQELVWGVEPNRFVVEVVADLPPGRALDVAAGEG
FT                   RNAVWLAEQGWQVTASDFSAVAVERGKKLARERGVEVEWLCADARNPAPRREGYDLVLL
FT                   SYLQLPPGDWRRALTEAVRAVAPRGRLVSVGHALENLTRGVGGPQDPKVLHIPEDIAMA
FT                   VAEIAAGEGFAVQVERAGYVTREVATEEGPRTAVDSLVVVHRSA"
FT   gene            complement(63613..65841)
FT                   /locus_tag="Tfu_0056"
FT   CDS             complement(63613..65841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0056"
FT                   /product="Tyrosine protein kinase:WD-40
FT                   repeat:Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54094"
FT                   /db_xref="GOA:Q47TX0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54094.1"
FT                   /translation="MIEPLQPGDPGRIGPYRLVSRLGAGGMGQVFLARSPGGRPVVVKV
FT                   ILPEYANDDEYRIRFAREVEAARRVGGFHTAQVIDADPTADPPWMATAYIPGPSLRKAV
FT                   TERGPLYGNNLRTLAAGLVEGLAAIHACGLVHRDFKPSNIVLAADGPRVIDFGVARPLD
FT                   SSVMTQSGAVIGTLAYMSPEQTDGSQVGPASDVFSLGTVLAFAATGRSPFMADSIGEII
FT                   ARISGPPPELPELPDDLRELVYACWEQNPDLRPTTAELLAQLSTDHTGDDWPPPHLSDL
FT                   IGSMLPLGATTSPNPSLAIEPPPPSHGPPRPSEPLPDPGDDADEPSAEKPSRTLPEPEP
FT                   PELEEKPIQVIHEPERPAPTPPRPREPARGAIKPKNPRPAAPQPPWSPPRVQPPRWKQL
FT                   ITKKPVAGILTAVATAGLVVSFLVWQWTLPETPLRPDSSTAPSESADPHELNEPRILTT
FT                   DREAVAVAFSPGGSLLAGGSGDKLIHVWDVASGDELHTLEGHTDWVRAVAFSPDGALLA
FT                   SGSDDATVRLWDVAAAEERAVFEGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGT
FT                   EHAVLKGHTDYVYAVAFSPDGSMVASGSRDGTIRLWDVATGKERDVLQAPAENVVSLAF
FT                   SPDGSMLVHGSDSTVHLWDVASGEALHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRL
FT                   WDVAAQEEHTTLEGHTEPVHSVAFHPEGTTLASASEDGTIRIWPIATE"
FT   gene            complement(65942..67549)
FT                   /locus_tag="Tfu_0057"
FT   CDS             complement(65942..67549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0057"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54095"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54095.1"
FT                   /translation="MDAPHTSCAAPGRSSHLSPAPFRDGVSDAQTVPLRTILARRDLAL
FT                   EPLVPAAPDAHVRWATVSELLDPAPYLKGGELLLTAGTNLPTDPEALDRYVTALVSAQV
FT                   TALGFGVTPVHDAVPDTLVARCRAHGLPLLLVPRETPFVAVSQAVGEELERLRLAGQRR
FT                   FTAAGRSLTKAAIGATPVQELLTTLSAALGCWTQLLGTRPLGQVGRVPPLPDEAHELIR
FT                   KVRTPGGPLSAKLWIPPDEVVLHAIGDQARDRTVLLLGRPKPLDSTDRAILGIAVALLG
FT                   LLSRAQPAVVDDASRLATRLLLTGATPDTTVLRLLPALLTGDEPAPTAYRVLHARWTRP
FT                   SSQPTPSPTLFRTRLVDDTSTPVRAILADQGTHHAHLELLDNLHAAGWLAALSRPVPGS
FT                   ALADADQEAAMLLIRAHATGRPLLPETQPDPLETLLETDEARAAARTLLGPLAGNDSTS
FT                   RTLRTTLRAWLAHHGSWDRTAADLGAHRNSVRYRISRIERDLGIDLSDPEQRMRMWFAL
FT                   SRFPDDTPTHPTQRDISR"
FT   gene            67652..68626
FT                   /locus_tag="Tfu_0058"
FT   CDS             67652..68626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0058"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54096"
FT                   /db_xref="GOA:Q47TW8"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54096.1"
FT                   /translation="MREGGNPVSTPIGPTDSSLVPRFAGPATFARLPRTDEVAKTDIAV
FT                   VGIPFDSGVSYRPGARFGPAAIREASRLLRPYNPGLDVSPFAEVQVADGGDIAVNPFAI
FT                   KEAIATVEASASELLSQGTRLVTLGGDHTIALPLLRAVHRVHGPVALLHFDAHLDTWDT
FT                   YFGEPYTHGTPFRRAVEEGILDTEALTHVGIRGPLYGKKDLEDDRRFGFGIVTAADVMR
FT                   RGVDEIADMVRQRIGNRPLYVSVDIDVLDPAHAPGTGTPEAGGLTSRELLELLRGLASC
FT                   NLVGADVVEVSPAYDHAQITATAAAHVAYDLVSLLALTAKKDR"
FT   gene            68727..70235
FT                   /locus_tag="Tfu_0059"
FT   CDS             68727..70235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0059"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54097"
FT                   /db_xref="GOA:Q47TW7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54097.1"
FT                   /translation="MSASRLAPEPVTKIESYGIAPIPVEAQTSRPLDLFRLTFGGANTF
FT                   ATIILGTLPVAFGLSFWASVAAIVTGVVVGALILAPMALFAPRTRTNNAISSGAHFGVV
FT                   GRALGSFLSLLTAVTFFSLSVWGSGDAIVGLALRLGFDGGDALQAASYGVIAVAVFTVC
FT                   IYGYQFMLLVNKVAVVACTVIMLLGVVAYGGVFDPSYAGTGSYILGSFWPTWILAVLTV
FT                   MANPISFGGFLGDWARYIPASHSTRSLLAAPFFAQVATLVPFLFGASTATLVADPNNYV
FT                   TGLAVVSPLWYALPLIAVALIGGLSTGTTALYGTGLDFSSLVPRLNRVQGTAVVGTLAL
FT                   VLIFVGSFVVNMVDALSAFSILIVLLTSPWMVVLMIGYVVRRGYYLVDDLQVFNRGEKG
FT                   GAYWFTRGVNWRAAAAWLVAAVAGLLFANTSIIVGPFANAAGGIDISLPVTLLAAAVVY
FT                   PVMLLLFPEPRGVFGPEGPRFVPARDTVIEEIRQRRSVEPTTSV"
FT   gene            70512..71909
FT                   /locus_tag="Tfu_0060"
FT   CDS             70512..71909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0060"
FT                   /product="putative oxidoreductase, oxygen dependent,
FT                   FAD-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54098"
FT                   /db_xref="GOA:Q47TW6"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54098.1"
FT                   /translation="MAQLNSTTVTGTAVAEFRSEFAGQVLEPGDSGYDQARTVVNPLVD
FT                   LRPRVIAQCETVDDVVRAVRFGREHDLEIAVRGGGHGVGGEALTDGGIVIDLRRMSEVT
FT                   VNPEEANARVSGGATMGHLDRAAQPYGLATTGGRVSTIGVCGLVLNGGSGWLDRRFGLA
FT                   CDNLLAAELVTADGDVVRASPEENPELFWALHGGGGNFGVVTSMTLRLHELPSVNVSLL
FT                   LWDAEAGPDVVRAYREFMGASTDDVCGGLMYMTAPSEDFVPLWLVGRLVCAVLLIHTGR
FT                   DPDEVARDLQPMREAGHVAEISAEMAYADVQCLLDGPPGYHTYWSAEHVTTLPDEAVDR
FT                   YCAGAQRMPAPSPSQYLLAPQGGTVSRALTDYPIPWRYAAWGVYPFGVWRDAADEERVV
FT                   QWAQSVRAEMSPWATGAVYLSVAGDEEEHRMVSGFGGWDNYHRLARVKAQYDPENVFHR
FT                   NPNIKPA"
FT   gene            complement(71944..74154)
FT                   /locus_tag="Tfu_0061"
FT   CDS             complement(71944..74154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0061"
FT                   /product="helicase, C-terminal:DEAD/DEAH box helicase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54099"
FT                   /db_xref="GOA:Q47TW5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54099.1"
FT                   /translation="MTRPSPPSGSNPTAPDAFSLLHRDVQRWVWEQRWTSLRPIQEQAI
FT                   QPIISGNVDVLLAAATAGGKTEAVFLPVCSVLARDADHGEATGIQAVCLSPLKALINDQ
FT                   HARLTALCARIKVPVTAWHGDIGVTQKDRLRGDPAGILLITPESLEAMFVRRGSTVSQL
FT                   FRDLRYIVVDELHSFLGTARGAQLRSLMNRLEHAAGRRVSRIGMSATLADLRAAAEFLR
FT                   PGHGEQVVVVEDQHGGKELLLQLRGYVADMRSDPGTSMSPDALAHLYQVVRTGHNMVFV
FT                   NSRGAVESCVSALSALARQERLPNPFFPHHGSLSAELRAHAEQRLKNRSAPATVVCTST
FT                   LELGIDVGWVDTVVQLGVPPSVAGLRQRLGRSGRGGAAAKLYLYITEQAHPDMPVDRLR
FT                   LDLVQTVAMVELLLSRWYEPPNLDTPHLSTLVQQILSVLAQHGGAHALRLYRELCATGA
FT                   FPGVDEHTFASLLRSLGEHQLISQERSGLLLPGKIGEALLNHYAFYSAFDVAEEYAIAT
FT                   VDGDMGTMPLSPSVDAGALLAFAGRTWQVVEVKPDERRILVTPARGSAVPPGFMGSAAP
FT                   VHDRIRQRMREVYLDTEVPRYLDEAAAILLDEGRSAFRAMGLADTDVYEYNGDTLLFPW
FT                   RGDRTAETLRHLFQWAGMKAVHVGAFLAVPGTPADSVRATAAHLVAADLPDPVELARRV
FT                   ADQRRHKYDRYLGEELLSRSYAAHALDLDGALEFLSRVAADH"
FT   gene            complement(74123..75454)
FT                   /locus_tag="Tfu_0062"
FT   CDS             complement(74123..75454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54100"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54100.1"
FT                   /translation="MTETPVPSLTIRSKDRGPLLDALRNGVVPYRGAHLIQVGRGRELE
FT                   ALHTSIKQIKNGAGAVRFVIGDYGAGKTFFLHLVRSIAHKEDLVTVHADLTPDRRLQGS
FT                   QGRARRLYSTLMANMATRGKPGGRALTTVVEKFVTQVRRDAEANGTTVEHQLSERLWGL
FT                   REFPGGPSFAKVIEAYWRSHVHQDEELRAHALRWLSAEYAKKTEASRDLGVSEIIDDRS
FT                   LFDHLKLMAAFTTMAGYRGLLVCFDELVNLYKLSHKGSRHANYEQILNIINDTQQGRAE
FT                   YIGFLFGGTPEFLEDPLRGLYSYEALRSRLEENPYATGGLVDFHGPVMRLSHFTKEHFY
FT                   ELLRKVRHVYASGDPAKHPLPDEAIEAFMRHCEERVGDAYFRTPRSTIKQFIGLMDVLV
FT                   QNENADWRTLLTQMEVVKETNPDLQPLDPKDDVENDSPLASFRL"
FT   gene            complement(75451..79521)
FT                   /locus_tag="Tfu_0063"
FT   CDS             complement(75451..79521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54101"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54101.1"
FT                   /translation="MTKRTSPTGSKRSGLQPEQHWQQEGDNLWWIPAGTPVVVNFITIP
FT                   DGMVYVGQTPSTKEPPPELSQLDPSLPVGWAPDFHPSLPRGASMLPYRLLLPSARTAYL
FT                   RWLASGRKRRGLSISFVYLFFTGLESRILRNLKEHKRASDLSAIREETERLLAVYGADA
FT                   RLEKQAAHFLKLLTYLEDTPEQDWQLSWTQDPSPGEETYRPSISQRQPVHYRKPHKPQT
FT                   VPSKPALFEQQVQPEKPAETTTAPTPTAPNTDTGKPIPTPAAQPAEKPQSEAVQPRSAP
FT                   QQSDFLDRKRLAAVQDEVRHTDAFLADLYENEEDEEHTEETAPVLAPPAASTRTETDTD
FT                   TAVLSRLEHRLHAFLATLITKQEWARVEVSSLARHHGLMIDGALAEINEYALDLVDMEL
FT                   VDEQEDTIEVDPEVVEVLRKQGALPASVETPPTKAEQQPAASSSAPPPAVLPEPPAARG
FT                   QEGFWVRIGETVSVQGRKITTGLVYVGTPVDDRQAALINPGLPAESAPGTPASNHHGKG
FT                   YHQLPPDARGRYLDWLAAGRIGVVSEDTPLFLFLYGLEQRVLCDILPGSAPTSELATIH
FT                   AELDRLIDTYRIMRRFRQRAYTLRALVRYLAQGNLHSPGKPPSPKDPYDTLPDELRYGL
FT                   GVLKAHNKQIPADWALSWAVHHEQVRPPMALRTDEAFHEAFRRRFTEEFPGGMPVPFNE
FT                   GKEFTWVYTPANPDLDTIRVPVPEIYDISNLALPLSHLGRIVRAAQADVEKTKKEEARP
FT                   AQPFATPLPHPEAELSQTTQKIRWSSWKAPGTTVRISKYTIPDGMVYTGYAPREADDDI
FT                   QRSSAIDLSLEIDSSVVSPHGRAPRRPVAGYPDLTPQERARYLSWLANRDSGASVPIVF
FT                   GRLFRNGLERRIIEMIRSTKEKIRIPPRLREELKRLIEEFAASPEFTEQTRRLLILADI
FT                   ASGEKLAAPSSPPRYSPATQQIPQEFRLGLGLLARDNLSLPPEWALEWVLYHLRPENPE
FT                   EYRKNFSSLNLPLPYKGLILPYQGDQIVPATAPQFEYVYRASCPGLGEVRLPVPGVRDV
FT                   ADIAPPQDLVNRVQKIYAQAVERNRLAGNTATPSSTLAAGNLATGNTTLHSSPANRATA
FT                   APAAPKPPAVTPPPVPAPAAASQQTIRDFAELALHLASLAGPLTVEHRLLITRAAETIA
FT                   DLFEKDWRELRLHERETAATEPPLNLCSRLAQLPLREREKLGDLLLDVAEVGGKTTENQ
FT                   TVFLLSVHRILGLEAILRLRLSYRGIAPPPDNPHSGNPLTPASPDTPLTPKKLPKITPL
FT                   SQRHIALLTDLATRDHWNLADTTRLAHWYGIDVYEAIDAINEVALHRTGTVVLSENDDH
FT                   ITVHKVIFEEMTQ"
FT   gene            80214..82304
FT                   /locus_tag="Tfu_0064"
FT   CDS             80214..82304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0064"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54102"
FT                   /db_xref="GOA:Q47TW2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54102.1"
FT                   /translation="MARLAIDRDFLLDFAKLEKSVQDRVTEVFTKFEHARHTGIHLEKI
FT                   ANARDDRFRTIRIDQFWRGVVLAPEAGDIYTLLKVLPHDDAYAWAQRRTATVNGATGRI
FT                   EIRDVEAIDASLPHLEQVAQDAPRRLFDHVSDSDLRRLGIDGQTLAFARVLTDEAQLEA
FT                   AEGLLPSVQWKVLTALAAGYTPEEAWDELCVDITSEQIDPDDLDAAVERSRDRVVFVDG
FT                   PDELLSVLAYPFALWRVYLHPVQRSVVEASYRGPARITGGPGTGKTVVALHRARHLART
FT                   GEGKVLVTTFTSTLAESLRAGLMLLDDYDEFVDRIDVAHVDQLAHRIVREEHGALRMLT
FT                   GAQERELWSTIIRDLGLSFTPAFLAEEWRQVVIAQQVRSAQDYLAAKRTGRGRPLGSQQ
FT                   RAHVWQAIWEFEAALREQGLWTHETVCVEAARLLAERDRKPYRHIVVDEAQDLSPEKWR
FT                   LLRAAVSEGPNDLFFAADTHQRIYQHQVTLRDVGITIAGRSTRLRINYRTTAEILAWSL
FT                   GLLHGERIDDMDGGVESITGCRSELHGPPPTVQGFASKEDELCAVAAAVREWMDSGVAP
FT                   EEIGVAVRSNRLVKEVAETLNAESIPVRELAGGLPEDGAVSVGTMHRMKGLEFRCLVVA
FT                   GVSEGQLPALKAVVPESEDKAAHRAGLQRERCLLFVACTRAREQLLVTWSCEPSPFLTA
FT                   LS"
FT   gene            82337..84619
FT                   /locus_tag="Tfu_0065"
FT   CDS             82337..84619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0065"
FT                   /product="similar to Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54103"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54103.1"
FT                   /translation="MAKLSTLLDQIDSGTILLPEFQRGYVWNRDQVRGLMRSLYRGYPV
FT                   GSLLLWETAATDVAARGGTVGDGRTHLMLLDGQQRITSLYGVIRGRPPAFFEGDAKAFT
FT                   GLYFHVEDEVFEFYSRSKMASDPRWVNVTELFQQGPVPYLARFTDAPSELATIYLQRLN
FT                   RLHQVTEREFPQEKITGADKEIDEVVDIFNRVNSSGTKLSKGDLALAKLCAQWMEARSK
FT                   MREALRRWERAGYRFDLDWLLRTVTAVATGRSQFEALERLKASEFKAALEKTVAHVDTF
FT                   LNTVSGRLGLDHDRVLPGRYSIMVVVRLLELNNGSFTDGVHRDKTLYWYIHSALWGRYY
FT                   GSAESNLQQDLETLAREGIDGLISSLERVRGGSLTIRPHDFEGATKGSRFYPVLYMLSR
FT                   VKGARDFGTGLELKAETLGKFSSLEIHHVFPKPLLYNGYDRKHVNAIANFCFLTPQSKL
FT                   EIGNRSPEEYLPEVEARHPGVLASQWIPTDPALWKLERYRDFLFARRELLAEAAQSFLE
FT                   ELRSGTASANETVLRPISVVTEKSDDARAVQVRELIEELQRMGYSEPLVDTEVPDPETG
FT                   RAIAVAEAFWPEGLQAGQGAPVVLELDPGEADLPRLKELGYEVFTSVDALLGYVKRRNA
FT                   DAAGERLIEPETVAAEPREENEPLLRELGLALRSLYDRARDEAGYTPSQLLSMIADLGP
FT                   LGAARRLLHAPTVSDGFSALWERGRLDLTVEAVVCEPRFAPLFTEEELETARRRLNQFG
FT                   YSVDSAA"
FT   gene            complement(85040..85276)
FT                   /locus_tag="Tfu_0066"
FT   CDS             complement(85040..85276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54104"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54104.1"
FT                   /translation="MVELSRFQEGEAGGNFPSITRWVERVRRGVRAGKRFHRVHMMVTE
FT                   PLSDYVRFECAWAYRHTVAAGEDVRIIAVPEGQ"
FT   gene            85575..86345
FT                   /locus_tag="Tfu_0067"
FT   CDS             85575..86345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0067"
FT                   /product="short chain enoyl-CoA hydratase / Enoyl-CoA
FT                   hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54105"
FT                   /db_xref="GOA:Q47TV9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54105.1"
FT                   /translation="MGEFIRFESDGPVRHIVLNAPQRLNALDRPMLAELAEAVRAVAAD
FT                   EEARALVVSGAGRAFCAGADVTSLFGDPTRPPAVIRDELKQVYASFLSIADLTIPTIAA
FT                   VGGIAVGAGVNIAMACDMVVAGPKAKFAITFAEMGLHPGGGCSWFLTRRMGGHRALATL
FT                   LDAERIDAEEAFRAGLVTRLVEDPVAEALAMAHSYAERDPGLVRDMKRAVRMAETADLA
FT                   TVLEFESWAQASSVNSPRFQEFLAEFAARKNKKE"
FT   gene            complement(86404..87579)
FT                   /locus_tag="Tfu_0068"
FT   CDS             complement(86404..87579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0068"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54106"
FT                   /db_xref="GOA:Q47TV8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54106.1"
FT                   /translation="MSVTRLMPSQETADLVELVREVASRELAPHVAEAEETERFPREAF
FT                   RTLGKLGVLGLPYPEEYGGGGQPYEAYLNILEEIGAVWASVGVGVSVHVLSCYALAVYG
FT                   TEAQRQRWLPDLLSGDLLGAYCLSEPHAGSDPAAMTTRARRDGDHYILDGVKAWITHGG
FT                   QADFYTVMARTSDDRSRGISCFLVPADTPGLSADRPERKMGLTASHTTMLRFDGVRIPA
FT                   DQRIGAEGQGLSIALSSLDAGRLGIAAVATGLAQAALDTAVDYARQREAFGKPIIEHQG
FT                   LAFLLADMAAAVETARAATLRAARLKDSGLPYSKEASIAKLIATDNAMRVTTDAVQVLG
FT                   GYGYTRDFPVERYMREAKVMQIFEGTNQIQRLVIGRHLARDATAHTVTVVR"
FT   gene            87664..88272
FT                   /locus_tag="Tfu_0069"
FT   CDS             87664..88272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0069"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54107"
FT                   /db_xref="GOA:Q47TV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54107.1"
FT                   /translation="MPALQRLSEKTRARREELLDGLRRLFLAEGFARFSVSDMAERLRC
FT                   SKSTLYLVAPSKEQIVVAAVRSYFKRAAERIEARVAEAPPEKRLVVYLEAVAAELEPVS
FT                   EQFYADLAAFAPANEVYQENTLVAARRVQELVAEGVAAGVLRPVNAAFVGAAVARVMTG
FT                   IQDGTIKEATGLDDAEAYRHLADLVMASLTREATESPLA"
FT   gene            complement(88458..88919)
FT                   /locus_tag="Tfu_0070"
FT   CDS             complement(88458..88919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54108"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54108.1"
FT                   /translation="MEAAWPHATSGLPAQMTKETEPVDDLTAHPDGASPASIPPPTSPD
FT                   TAPRHTPTSTALIRYLPVVRKGALLGFLWATETDDAVGFLALDTAEEPAARFWADRIAH
FT                   SEREGLRPLQILRRWGGTAEDPVGGTVPAAARERIAVSLDVLRALPSLQ"
FT   gene            complement(90403..90963)
FT                   /locus_tag="Tfu_0071"
FT   CDS             complement(90403..90963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54109"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54109.1"
FT                   /translation="MNNGPSQEEQPQVLILGPSGPAAVPPAPSNEEEKEESEGRPVTEM
FT                   VEQPAKVMRIGSMIRQLLEEVKAAPLDEASRVRLKEIHASSIKELEDGLAPELVEELER
FT                   LSLPFTDEETPSEAELRIAQAQLVGWLEGLFHGIQTTLFAQQMAARAQLENMRRALPSA
FT                   LQQQGEGEHAQQGRVQGSSGPYL"
FT   gene            complement(91027..92013)
FT                   /locus_tag="Tfu_0072"
FT   CDS             complement(91027..92013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0072"
FT                   /product="putative quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54110"
FT                   /db_xref="GOA:Q47TV4"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54110.1"
FT                   /translation="MRAIVVSAPGGPENLVWQEVPDPQPGPGEVLVEVAATAVNRGDIS
FT                   QREGNYPPPPGAPEYLGLECSGRIIAFGPGTEDSGYRVGDEVCALLSGGGYAERVAVPV
FT                   GQLLPVPKGVGLVEAAALPEVACTVWANVFMTAQLREGEALLVHGGASGIGTFAIQAAR
FT                   AFGARVLTTAGSEAKLARCRELGADVAINYRSEDFAARVREETGGRGVDVVLDIMGGSY
FT                   LEANLRSLAVGGRLVVIGLMGGRRAELDLGRMLIKRLSVHAATLRSRPLEEKAAIVAQV
FT                   TERVWPLVERGEIRPVVDRVLPLSQAAEAHRVLEASEHVGKILLVTN"
FT   gene            92245..94104
FT                   /locus_tag="Tfu_0073"
FT   CDS             92245..94104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0073"
FT                   /product="similar to ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54111"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54111.1"
FT                   /translation="MSYEEHDGSEHFGARSPRSRYEDPAVDTELGEDRYEGADEWFGDD
FT                   DFDLDLAPPPPYAQKLSPEPAPTTSSPPEPAPFADQSSGDSHGPGRLAPPGPLAQPQPS
FT                   PPRQFDGPAPAAPSPDLPPDPLPTVSSPDLFRADATRGGPETGPPSPAVPDASGPGSEA
FT                   HSPESSAPKADDSPAESVRSRFGRNRPQLRQLLEEAQQRSAPPPPPPEDVPEPEPLPPL
FT                   DFSGALTTPPPGPAPTTPPPAAPAWRDPHPPRREDTPPPPVHDPRTTDPETPRSTAASP
FT                   TPSRPAPAKTPPWLSSPSQGNSATGPATFAPPVVTPGREWSGGYRPGAVTGWRRAVRSI
FT                   TFGLINPGNSRAERRRQEMIARACTHVVGGHHRVAVLSLKGGVGKTTTTAALGSMLASL
FT                   RGDRVLAIDANPDRGTLSDKLHLETPTTIRDLLNEKDTISRYADIRAFTSQAPSRLEVL
FT                   ASDQDPAVSEALSEYDYREVARIVEHFYSITLTDCGTGLLHSAMRGVLGLADQIIVVST
FT                   PSVDGARSASATLDWLDAHDYGSLVRGAVVVMSMVRRNSKSNVDLQRLEEHFASRCRAV
FT                   VRVPWDPHLDEGAEIYLDRLQPSTHDAYLELAATVGEAFAWPR"
FT   gene            94397..95581
FT                   /locus_tag="Tfu_0074"
FT   CDS             94397..95581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0074"
FT                   /product="ABC branched-chain amino acid transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54112"
FT                   /db_xref="GOA:Q47TV2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54112.1"
FT                   /translation="MRYPPYAPFAAALCAGALVLTACGSPESAATGDADGPIKIGLVYS
FT                   MSGPLATYGEQYYQGFEAGLEYATGGTMEVDGRPIEVTTRDDAGDPTKAVSAARELIGE
FT                   GYDIIAGSTASGVAVQVAPLAEQNKVLFISGPAATDAITGINDYTFRSGRQTYQDILAA
FT                   GSFMDDPEGKNVIVFAQQNAFGQDNVDAVTTVLEAQGATVDSVLAPPDTTDLTPFAEQV
FT                   RQADPDLLFVAWAGETASAMWKALNQQGVLDATEVVTGLDIKASYPVFGEAEGKISFLS
FT                   HYFDGAAQTEAEQMMREFVEDNGGEVDLFTPDGFTAAQMIVHAISEGDTTEERIKALEG
FT                   WTFEGVKGTLTIRAEDHALLQPMYQVRLVGSGADAVPELIAEIPAADVEPPVAE"
FT   sig_peptide     94397..94486
FT                   /locus_tag="Tfu_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.787 at
FT                   residue 30"
FT   gene            95583..96356
FT                   /locus_tag="Tfu_0075"
FT   CDS             95583..96356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0075"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54113"
FT                   /db_xref="GOA:Q47TV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54113.1"
FT                   /translation="MMTSPTPSPPAPVLVLNDLSWSVGGAVIVDGVSMTVSDGEFLAVI
FT                   GPNGAGKTSLFNLVSGLTRPTRGTVELLGTDITRLPPHRRARLGLGRTFQTSSVFADLS
FT                   VGANVGLAVQARLGESRRFWQRATPVTGPEISRVLDLVRLSHRADALAGDLSHGDKRKL
FT                   ELALLLAREPRVILLDEPMAGVSAGEIGELVDVIRTVHREQGCTVLMVEHHMEVLLDMA
FT                   DRLAVMHHGALLALADPDTAMADSRVQAAYLGDAL"
FT   gene            96353..97099
FT                   /locus_tag="Tfu_0076"
FT   CDS             96353..97099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0076"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54114"
FT                   /db_xref="GOA:Q47TV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54114.1"
FT                   /translation="MTAAEPLVDVADVHVWIEGSHILQGVSFTVADHGVTSLLGRNGVG
FT                   KTTTVKAILGLVPRTGRIVFAGRDITADPTHAIAAMGIGYVPEDRGVFAGLTVAENLRL
FT                   AERRGHTPRYDLVHDLFPELARRANQPAGTLSGGQQQMLAIGRVLLNDNRLLIVDEPTK
FT                   GLAPRVVAEVADAVARIAEEVPVLLVEQNLALVRRVAGQAVVVDAGRVVHTGNVLDLLD
FT                   DAERTRELLGVSKTSVPAHGQPGGAA"
FT   gene            97096..97992
FT                   /locus_tag="Tfu_0077"
FT   CDS             97096..97992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0077"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54115"
FT                   /db_xref="GOA:Q47TU9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54115.1"
FT                   /translation="MSTVVLLVVTGLGLGALYFLIASGLSLIFGLMDVLNFAHGAFLTI
FT                   GAYATWWASVYLPGAGGDGVGFLVAVAFGVAAGTLAATLVELGVIRPLYGRHREQILVT
FT                   VGLSLAVPALVQAIWGADPLPFPRPELVSGTVTLLGAAIPTDRFLLIAVAALVLAGLLL
FT                   FGTRTRYGLIVRAGVEDRAMVTALGIDVRKSFTLVFAIGGAAAALAGALGGLYFGVITP
FT                   FQGTSLLVFAFIVVVIGGTTSTVGCAVASVAVGMVQQFANYYTVAGLGDIAVVIVLAAV
FT                   LLTRQGGLAKATAGRVA"
FT   gene            97989..99113
FT                   /locus_tag="Tfu_0078"
FT   CDS             97989..99113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0078"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54116"
FT                   /db_xref="GOA:Q47TU8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54116.1"
FT                   /translation="MNVDTDTKHTTEAPAAPAAPVAEAVRRPRRVPAWVAPAVVAVVLL
FT                   SLPFSTLRIPGLFEGTLNSPSTLHVLATCLVLGGLATSYDLLYGRVGLLSFGHALYFAA
FT                   GAYLAVLLMGILELPLLWSALIAVASGTLLALVLGAISLRVSGIALAMVTLAFAQAGSI
FT                   LVVRDPGRMTGGEEGLSLNPDLVPDAFIGVVNTVNLYWLAVGYVVVALGVVWWLSATPV
FT                   GRVWQGIRANEQRVSVLGVNPYPYKLAAFTVAGALASLGGVVYLVVSGGVTPAITTAEF
FT                   TLTLLVMVSLGGAGTRWGPLVGAVVYTYVDHRLLQLAASDVFDGLPAVVRAPLSQPLFI
FT                   LGTLFVLLVFFFPGGLAALPSRIHAALRRRAAAA"
FT   gene            99258..100133
FT                   /locus_tag="Tfu_0079"
FT   CDS             99258..100133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0079"
FT                   /product="similar to hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54117"
FT                   /db_xref="GOA:Q47TU7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54117.1"
FT                   /translation="MTGTEFTVDVAGGALTVTRWGSAEALPVVALHGITANGHSFARVA
FT                   AELPDTLALLAPDLRGRARSAHLPGPYGLGAHVADTMALLDAVGVDRTVLVGHSMGAFV
FT                   ACLAAVRHPDRVAGVVLVDGGFGLPAPPGTDIQQVIGPAMARLSMTFADRDTYRSFWQK
FT                   HPAFAGRWNTWADTYVQRDLVGDPPEMRSSCVADAVRIDGAQVLEDPEVLGAIRALPCP
FT                   AWLMWAARGLLDETPGLYTAERLAALDGSGVQLVELPDDNHYTPLFSSTAATVAAQIHT
FT                   AVQQTMEAER"
FT   gene            complement(100065..102011)
FT                   /locus_tag="Tfu_0080"
FT   CDS             complement(100065..102011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0080"
FT                   /product="GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54118"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54118.1"
FT                   /translation="MERELNNTPVPPEDDPWAVDAQSAFLELLLRDAPAVEYERPLLEA
FT                   RARGDTPETLARLERAKLLALRVRSVLRDLQRRESELTALFETANDLTGMRSLDQMLRA
FT                   IVDRARHLLNTDVAYLTLSDPERGDTYMRVTSGSVSARFQQLRLGHGEGLGGLVAQTAL
FT                   PYVTANYFADTRFQHTEHIDAGVREEGLVAILGVPLQLNGRVIGVLFAANRRERPFSHA
FT                   EVALLSSLATHAAIAIDNANLIDDTRRALAELNTVNQRLQEHTESVERAAAAHDRLTDL
FT                   VLRGGGIEEVAAAVGDVLGGQVCIHDLNTAATPPPCCEDPAVAEAVQTALHSGRTARAG
FT                   DAWVAAAAAGSELLGMLVLRGIEPDITGQRILERAAVVTALLLLIRRSATEAEHRVRGD
FT                   LLDELLDTPDRDPESLRQRAARLGADLTVPHVVAVAESPGADVGRLRLAAMHIAETTGG
FT                   LAGIRGGRVVLVLPGTDPTTVGRRIGADLGVAVNGPVTVGVAGPVEALPGFRSSFTEAL
FT                   RCLQTLQALGRTGEVAAPTDLGFLGLLLGDDRDVDGFVTATLGPLLDYDARRKTALVDT
FT                   LRAYFAAGGNLSRAKDALHVHVNTVSQRLERISQLIGDDWQEPSRALEIQLALRLHGLL
FT                   DRGVDLGGNRGRG"
FT   gene            complement(101996..102811)
FT                   /locus_tag="Tfu_0081"
FT   CDS             complement(101996..102811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0081"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54119"
FT                   /db_xref="GOA:Q47TU5"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54119.1"
FT                   /translation="MTPHDTRPDTAAPPTSAAAGTSVDVDLTGRTALVTGAASGIGRAC
FT                   ATRLAAAGATVRLVDLNREALDELAQRGIGEPHHVDLTDLDAVDTVARGVDIVVNNAGV
FT                   QTVCPVHEFPPERFSMMVKLMLEAPFRIVRAALPHMYARNWGRIINISSVHGLRASAYK
FT                   SAYVAAKHGLEGFSKVVALEGAPHGVTSNCINPGYVRTPLVEQQIADQARAHGIPASDV
FT                   VETVLLARSPIKRLIEPAEVAEMVAYLCCPEASFINGASLTIDGAWSAS"
FT   gene            103048..104292
FT                   /locus_tag="Tfu_0082"
FT   CDS             103048..104292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0082"
FT                   /product="esterase, PHB depolymerase"
FT                   /EC_number="3.1.1.73"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54120"
FT                   /db_xref="GOA:Q47TU4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54120.1"
FT                   /translation="MLHLTRRIPARVWVALTAVLGLGAALLGTTALAPRAEAATLTQVS
FT                   AFGSNPGNLNMYVYRPATLPDNAPLVVLLHGCSQDAATYHAHSGWAKYADSLGFALVYA
FT                   EQKSANNSSSCFNWFQKSDTARGSGEAQSIRSMVDYAVRTYSLDEERVYISGLSAGGAM
FT                   ASEMLAAYPDVFAGGSIVAGIPTGCASSLLDATTCMFSGRNLTPKQWGDLVRAKNPGWQ
FT                   GPWPRVAIWHGTADAVVTPKNAQSSRDQWTNVWGIGQTPARTANLGANTTVEYYQDSSG
FT                   RDVVARYLVSGMGHGTPVDPGSGTDQCGTAGAYFLDTICSTYHTIQFWELDGDPQPSPS
FT                   PSPSPSPSPSPTTPPAGECVTANNYQHVAEGRAYVSYGYAYSVGGNDLLGLWNIYVITS
FT                   VQETSPGYWERVSGC"
FT   sig_peptide     103048..103164
FT                   /locus_tag="Tfu_0082"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 39"
FT   gene            104784..106598
FT                   /locus_tag="Tfu_0083"
FT   CDS             104784..106598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0083"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54121"
FT                   /db_xref="GOA:Q47TU3"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54121.1"
FT                   /translation="MTTAVHGNNVAPTSHQELVDWVREIAELTQPDEVVWCDGSDAEWE
FT                   RLTSQLVEQGTLIRLNEELRPNSFYCRSDPSDVARVEDRTFICSERQEDAGPTNNWVDP
FT                   AEMRATLKEIFTGCMRGRTMYVVPFCMGPLGGKISQLGVEITDSPYVVVSMRIMTRMGA
FT                   PALRLIEERGTFVKAVHSVGAPLEPGQKDVPWPCNSTKYITHFPETREIWSYGSGYGGN
FT                   ALLGKKCYALRIASVMARDEGWLAEHMLIIKVTPPSGEPRYIAAAFPSACGKTNLAMLQ
FT                   PTIPGWKVETIGDDIAWMRFGEDGRLYAINPEYGFFGVAPGTGESTNANAVKALWGNSI
FT                   FTNVALTDDGDVWWEGLTDEPPAHLTDWRGRDWTPDSGEPAAHPNARFTTPASQAPTIA
FT                   PEWEDPNGVPISVILFGGRRATAVPLVVEAFNWQHGVYLGANVASERTAAAEGKVGELR
FT                   RDPFAMLPFCGYNMGDYFGHWLKIGRQTDPDKLPRIYYVNWFRKNDEGKFIWPGFGENS
FT                   RVIKWIIERLEGKAAAQDTPIGRVPTPEALDTEGLDISQEDLELLLSVDREVWRQEADL
FT                   VPDFFNSFGDRLPKELWDEYEALRQRLG"
FT   gene            complement(106706..106795)
FT                   /locus_tag="Tfu_R0005"
FT   tRNA            complement(106706..106795)
FT                   /locus_tag="Tfu_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(106919..107650)
FT                   /locus_tag="Tfu_0084"
FT   CDS             complement(106919..107650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54122"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54122.1"
FT                   /translation="MTEQLSPMPEDWQRALAVVAHPDDLEYGAAAAIAAWTDAGKEVSY
FT                   LLATRGEAGIDGIHPSKAAPLREREQIASAAVVGVTTVEFLDYRDGVIEYGLPLRRNIA
FT                   AAIRRHRPELVITLNHRDTFHGGFWNTPDHKAVGRATLDAATDAGNRWIFPELVDQGLE
FT                   PWNGVRWVAVAASPQPTHAVDATPGYERAVRSLLEHRAYIEGLTDEDPETYVRSFLDET
FT                   LSANAPRFGGRLAVTFELFPR"
FT   gene            107759..108214
FT                   /locus_tag="Tfu_0085"
FT   CDS             107759..108214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54123"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54123.1"
FT                   /translation="MVISEADFAKSSIMAAMPLARILGVEFVELAEERAVMRLPDNPDH
FT                   YDHTQNQHAGALIVLAETTSGAAVFNALGDRLKLALPVSLDARVDHRQPFSGPVVAEAV
FT                   LGEEWRTALTELEAGGQPEFPVDVALRAENGSTTGTATITWMLRPHP"
FT   gene            108704..109843
FT                   /locus_tag="Tfu_0086"
FT   CDS             108704..109843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0086"
FT                   /product="DNA polymerase III beta subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54124"
FT                   /db_xref="GOA:Q47TU0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54124.1"
FT                   /translation="MKFRVDRDAFADAVTWTARALPARPAVPVLAGMRLEVADTASDTL
FT                   RLSGFDYEVSAQASVDVHAEEAGSVLVPGRLLAEIVRTLPPHPVEFHVEGSRALLTCGN
FT                   ARFTLLTLPLEDYPTLPAMPRTIGSAPADVFATAVRQVLPSTSRDDTLPMLTGVHLTFR
FT                   GDTILLAATDRYRIAVREMWWKPEEVDIDTSALVPARTLGDFSRSLTGGNVDIALSTSD
FT                   SRGAGEGMIGFEHDGKRTTTRLIDSDFVSYESRFPTEFAAQADVPVAPLAEAVKRVALV
FT                   ADRSTPVRLSFTSSEVVLEAGSGDDAQALEALEVNFEGEPMRIAFNPQYFLDGLTNVET
FT                   ERAFLRFVAPTRPAVITGTPAKEGGKPDFRYLVMPLRLA"
FT   gene            complement(110008..110298)
FT                   /locus_tag="Tfu_0087"
FT   CDS             complement(110008..110298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54125"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54125.1"
FT                   /translation="MVELTPEEAQILRGLAEDLFSASQQRTYWLDRTRRTSLDLLARIT
FT                   SWLDDACPGRHPVHQSTCLRPQGHDGDCTDAYDRTWTAPVVPAPRREREDE"
FT   gene            complement(110298..110726)
FT                   /locus_tag="Tfu_0088"
FT   CDS             complement(110298..110726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54126"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54126.1"
FT                   /translation="MRLVRVLLPLVTALPLFVARSWPFANRRETSAASSPAAEESPEVR
FT                   EPRPQPAVPLPAATLTYEQATDFVRVARRHAPLWALGYDPTQVVMFTARHRLLPDLVVG
FT                   ASDLEALDFTLIEFSPPDYARAYLSRVEKACASAEEDT"
FT   sig_peptide     complement(110610..110726)
FT                   /locus_tag="Tfu_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.369 at
FT                   residue 39"
FT   gene            110867..111697
FT                   /locus_tag="Tfu_0089"
FT   CDS             110867..111697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54127"
FT                   /db_xref="GOA:Q47TT7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54127.1"
FT                   /translation="MSGSLRGVLGSDQQIRCDTRSTPDVAISPTLRRRHLSSLLREARE
FT                   KRGLTAKWVAEKAKERSGRERGWSESKLNRLESGVWKRVRAEDITVLLDIYGITAPDER
FT                   ATYLTLVREAMQKGWWASYSDVLGTGEFVGLEAEASRIRTFESAAIPGLLQTEDYARAL
FT                   MRDSEQIGSSASLDRRVQARMLRQQILNQSSPPDFHTVIDESVLLRITPELAGQLDHLW
FT                   EASHRPHTDIRILPLSRGPHAAMTGQFVILDFPLPNQPVVYLEALAEEILPGQT"
FT   gene            112611..113462
FT                   /locus_tag="Tfu_0090"
FT   CDS             112611..113462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0090"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54128"
FT                   /db_xref="GOA:Q47TT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54128.1"
FT                   /translation="MREPSGDYSPTIRRRRLSEELRRLRLARGLTLEQVAEKLEWSRAK
FT                   IANIETGKRLRPYVTDVELLLNVYGVDDPDQRAALLDLTRQSRTKGWWASYGGLLGDYV
FT                   GMEAEASSIATYQLGAIPGLLQTFDYAVALAQAMRYPPEDVERIAASRVRRQQLFARKN
FT                   PPRFHAVIDEAALIRPAAPDRPDVMRAQIHHLINRANDANVTLQLLPFTAGLHAGVSGP
FT                   FVLLEFPDPADRPVVYLETRAGGHYLEDTAEITEYQDLFTHLHTTALSHEATVARLAQL
FT                   AE"
FT   gene            113470..113661
FT                   /locus_tag="Tfu_0091"
FT   CDS             113470..113661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54129"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54129.1"
FT                   /translation="MHTPDPAPLAFRKSSYSVTAQECVEVAVTSEFVAVRDSAHRELGY
FT                   LTFPLAEWRAFLTELTDR"
FT   gene            113933..114925
FT                   /locus_tag="Tfu_0092"
FT   CDS             113933..114925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0092"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54130"
FT                   /db_xref="GOA:Q47TT4"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54130.1"
FT                   /translation="MAKAPVNVTVTGAAGQIGYALLFRIASGQLLGVDTPVRLRLLEIP
FT                   QAIKAAEGTAMELDDCAFPLLAGVDIYDDPRKAFDGVNVALLVGARPRTKGMERRDLLE
FT                   ANGGIFGPQGAAINDGAADDVRVLVVGNPANTNALIAQAHAPDIPADRFTAMTRLDHNR
FT                   ALSQLAAKLNVSVSDIKKLTIWGNHSATQYPDIFHAEVNGRSAVEAVNDEEWLRDTFIP
FT                   TVAKRGAAIIEARGASSAASAANAAIDHVYDWVNGTPEGDWTSVALPSDGSYGVPEGLV
FT                   SSFPVVSRNGSWEIVQGLEINEFSRERIDASVRELEEEREAVRALGLIK"
FT   gene            complement(115018..115446)
FT                   /locus_tag="Tfu_0093"
FT   CDS             complement(115018..115446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54131"
FT                   /db_xref="GOA:Q47TT3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54131.1"
FT                   /translation="MPGTALLHQFRHQRIALLTTYLNNGKTPVHTPVSIALDGDRLLFR
FT                   VGKDSSTAARMTENPLVDLRTCTFRGEPTGAPVRGRVRPLSGEEAHRAARLLARGHLIT
FT                   RRWMLPLSYRMLRYEPVHYELLPVGDDAGDNPVEKVAG"
FT   gene            complement(115646..116503)
FT                   /locus_tag="Tfu_0094"
FT   CDS             complement(115646..116503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54132"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54132.1"
FT                   /translation="MASDARGRAGGDARKKMIERVRGLLRMAEDPSVTDAESQAFTAKA
FT                   AELMTRHAIAEAEARAQRGEGVEEISRLDFPVSGVGGHGKARVKALAAIAAAYGCQSAV
FT                   RGNTSANTDRTLIIIGTVSALDSLRVLLPSITMQMESSARFAAREHVANLRELRNYDRS
FT                   TLATERNRFYRSFIRAYGTAVAERIREFRARLAEDAQVGSGAGAAEDTPSTGAELVLRT
FT                   DVDRVREEFARRFPKLRPTRPERTYHRAGYRAGYLRGRNAQLGLETAVGKGGTHSLPGQ
FT                   AAAN"
FT   gene            complement(116630..117139)
FT                   /locus_tag="Tfu_0095"
FT   CDS             complement(116630..117139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54133"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54133.1"
FT                   /translation="MELGPVVGHGGNENSRAVPSGTFTNGLGADMTLERGNAFTPVASA
FT                   TLIWPWRSSVVAGGVAGVLALLTSLNEGVLSALGSGIGSAAFFFALVGGAVGALGSKGD
FT                   RRARRYAAQYPWRFAMVPALIGGAGAAVGTLLSSGLILGILGGAATAAVLWVILGIITM
FT                   VAGNKK"
FT   gene            117311..118114
FT                   /locus_tag="Tfu_0096"
FT   CDS             117311..118114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0096"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54134"
FT                   /db_xref="GOA:Q47TT0"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54134.1"
FT                   /translation="MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSE
FT                   TAFVRPLAGADADYELRWFTPTTEVDLCGHATLAAAHVLAAGGAEGPFRFASRSGVLTV
FT                   TARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWAGFSDVNDYFVVYPDEATVRALAP
FT                   DLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSAHTALGPYWAQRL
FT                   GRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRY"
FT   gene            complement(118103..119002)
FT                   /locus_tag="Tfu_0097"
FT   CDS             complement(118103..119002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54135"
FT                   /db_xref="GOA:Q47TS9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54135.1"
FT                   /translation="MVTAGDGDGWVILADGSRRWGLYGASGLLLYSVDESGTGHVLLQH
FT                   RAPWTHQGGTWGLPGGARNSGESSVSAAIREFVEEVDGDLGTLSLLGIHRQDHQVWVFD
FT                   TVLASVPERRPFTPGNPESESIRWIPVPDVPSMPLLPAFGKVWPEVAAALSEQLLLIVD
FT                   TTVVPQSITPGALCHRLTELAQVGVTDDMLPPDVPLTPLHRRFPSVLLLVDAHSRAALP
FT                   APVHGVDVVQVSDGSAAAIAQLVSERLPQTRIVVATDHPDTRAQAAALGVHTAPVSWAY
FT                   ELAQREESSPVERGSSVT"
FT   gene            119935..120546
FT                   /locus_tag="Tfu_0098"
FT   CDS             119935..120546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54136"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54136.1"
FT                   /translation="MTNGPFPSESPSPQPSDGQGSTSGNIPEPVTQLAAQRGFGALIDM
FT                   RSDGTRAEKALGGCAIAVGSLLLMVLVAYLAPEDDPFSFSLLRSVLRFFALFFLFVAVW
FT                   AAAAGLRGLIVAPRSHYLYEGGIIYAAGKRLQPAAWEEISHLTTIYGNRATGTKGKILG
FT                   YKVWLGDTTSFDVPLILTDGRDSFMDRIIHEVRSRNRPIR"
FT   gene            120568..120924
FT                   /locus_tag="Tfu_0099"
FT   CDS             120568..120924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54137"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54137.1"
FT                   /translation="MAEQHTPEPHSSNRPQPEPVPNAEHTDAALSPSAEPPPYVPRPEA
FT                   LRHDLKVRGERAVIFGALWLLAGVLITLITYVNALQSFSGGIYVVAWGPAVYGLYRIIS
FT                   GLIMIKKSRTQSVN"
FT   gene            121094..123427
FT                   /locus_tag="Tfu_0100"
FT   CDS             121094..123427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0100"
FT                   /product="RNA binding S1:Resolvase, RNase H-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54138"
FT                   /db_xref="GOA:Q47TS6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54138.1"
FT                   /translation="MTTSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTE
FT                   MLDDAQLRAIEERLRYLRELEERRTVILESIKAQGKLTPELEAAIMAADSKARLEDIYL
FT                   PYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQAAAYVDADKGVADTAAALEGARA
FT                   ILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDFAEAFTTLPSHRV
FT                   LALFRGEKEEVLDLTLEPEEPAEDPRARSSYEVRIAQHFGIADQGRPGDRWLLDTVRWA
FT                   WRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVK
FT                   VAVVDGTGKVVDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLA
FT                   ADLIKRHPELKLTKVMVSEAGASVYSASAYASQELPDLDVSLRGAVSIARRLQDPLAEL
FT                   VKIDPKSIGVGQYQHDVSEVKLSRSLDAVVEDCVNAVGVDVNTASVPLLSRVSGITASL
FT                   AQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDGDDPLDSSSVHPEAYPV
FT                   VRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDPRPEFQ
FT                   TAAFRDGVEDITDLEPGMVLEGVVTNVAAFGAFVDVGVHHDGLVHVSAMSKSFVKDPRD
FT                   VVKPGDIVRVKVLDVDVRRKRISLTLRLDDEVDQRSGENNRSGGERRERGAPRRGDQRR
FT                   QRGGRGEQQPMGAMAEALRRAGLV"
FT   gene            complement(123472..124254)
FT                   /locus_tag="Tfu_0101"
FT   CDS             complement(123472..124254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54139"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54139.1"
FT                   /translation="MTLSSATAPPRSPRRLPGVRWNRTSLVVAITAFACVLVAAIFVPP
FT                   YLSLDPGSSRVALRPDSALHFPAVAIHAATGGIALLTGPLQFSRRLRRRGVWHRWIGRV
FT                   YLFAGVLPSALSGIVAALLTSSGPVAMAAFLSLDILWIITGLAAYRTARAGRYAAHREW
FT                   MLRNFSLTFAAVTLRIWLSALVAIQLPWLDSLYGGDFDQLFATAYAVSHWTSWLPNLLL
FT                   VEVYLARQAARQAREALATALQTTAAAADNTETSPTPA"
FT   sig_peptide     complement(124132..124254)
FT                   /locus_tag="Tfu_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.943) with cleavage site probability 0.750 at
FT                   residue 41"
FT   gene            124388..125020
FT                   /locus_tag="Tfu_0102"
FT   CDS             124388..125020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0102"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54140"
FT                   /db_xref="GOA:Q47TS4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54140.1"
FT                   /translation="MRIGELSRRSGVSVPTIKYYLREKMLPEGERIAANQVRYSEEHLR
FT                   RLRLIRSLIDVGGLPVPTVREVLAEIDASQPSVHHAVALAHRGLPVLTGERSDEPREEA
FT                   RRYVESVFAARGWTVPEDHPGFTALVEALARMSLLNQRGFFECVGRYAELAEAIAEVDI
FT                   DLISGHTDVADVVEKAVLGTVLGDVVITALRRIAQEQVFNRRMAQGG"
FT   gene            125036..125299
FT                   /locus_tag="Tfu_0103"
FT   CDS             125036..125299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54141"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54141.1"
FT                   /translation="MGRQCRLPRVFRHTWGSRGWDRSAESRKGTTVTTPEENRPKTRGT
FT                   EQTLPEPDVQAPKLPQPRPTLGAELEDAMRRSGLSREDFGKE"
FT   gene            126888..127331
FT                   /locus_tag="Tfu_0104"
FT   CDS             126888..127331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0104"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54142"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54142.1"
FT                   /translation="MNLDRYHGPVLALFRIVVGLMFLCHGVASLFGVLGGNQGTGQAVE
FT                   FASWPGWWAALIQLVCGALVLLGLFTRPSAALASGSMAYAYFVVHQPHALLPLNNGGEL
FT                   AAMYCWAFFLIAILGPGAWALDHFILRRSSGTQQRLTAGTSAG"
FT   gene            complement(127605..127868)
FT                   /locus_tag="Tfu_0105"
FT   CDS             complement(127605..127868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54143"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54143.1"
FT                   /translation="MGRSPTHVLPAHAGMIRDHRSALAGGSGAPRACGDDPHLSALLVD
FT                   ELTEALRRTPAAVVVATHDRMMLADCASWPSVDLTGSRVSGR"
FT   gene            complement(128270..128346)
FT                   /locus_tag="Tfu_R0006"
FT   tRNA            complement(128270..128346)
FT                   /locus_tag="Tfu_R0006"
FT                   /product="tRNA-Pro"
FT   gene            complement(128454..130466)
FT                   /locus_tag="Tfu_0106"
FT   CDS             complement(128454..130466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0106"
FT                   /product="PAS protein phosphatase 2C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54144"
FT                   /db_xref="GOA:Q47TS0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54144.1"
FT                   /translation="MFDLAPIGVSITRGPDHRLVYVNEAQRAIFGPRPLGKPLLQAFND
FT                   LAEAGYILVLDQVMTTGKPEFLPQVPVTVNYPNAGRQERYFNLSFTPVFLDDGEPAVLN
FT                   LIADVTETIDAAQRKRALQRYTSIVRSGSLVEWSASPIDGSLQWIRGWEEITGQPHEES
FT                   RGHGWLNMVAPEDRAALLASWLRAIDEVPDSVEYIFRVRTRDGTYRHFRAHAVPVRENG
FT                   VVVEWTGTCADVEQQWREQRRHALFNRASGAISNTALIEDMLKALPEVIVPEVADVCTV
FT                   HLLSPTSSPETSANPFIVERLATKAREGITVPPPRFQSRFTIRSTYLELIRQKRSIHRV
FT                   FPVGKPPLDPLSPNSSRWLRQVKANSVVMLPITVEGELVASLVAVVCGEREPLTQDDAD
FT                   LLADLIDHLQPTIDTFASFQRTQRVARALQHSLLSDPPTIPGLPIVGRYQTSPTSAEVG
FT                   GDWYDAFIVDDTIMLVIGDVAGHDLTAATAMSQMRNMLRAFAADHPHNPHEVLRRLDGA
FT                   VQRSGEYKGTATCILARVTPDSDGIWQVDYSVAGHLPPLLVLPNGETRFLEKAHDLLLG
FT                   VDPTMPRHRALEVLPSGATLLLYTDGLVEHPHESLDIGLERLAHHCAAMARIPLNTFCD
FT                   RLLTELPIAGNDDITLIALRLESPTLATASLARHG"
FT   gene            complement(130736..131656)
FT                   /locus_tag="Tfu_0107"
FT   CDS             complement(130736..131656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54145"
FT                   /db_xref="GOA:Q47TR9"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54145.1"
FT                   /translation="MVNTTGRVLRRIGTAAAVTGALGVAGLVYASVVERNWFRLRHYEI
FT                   PILAPGSDRLRILHLSDAHLTPGRRLLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFL
FT                   DALGPLLDRPGLFVYGSNDLFSPQPKNPARYLWRSSKADYRKRKIPDLPWRELGAAMRE
FT                   AGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTADVRIGVMHSPEPR
FT                   NLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGGL
FT                   GTSPYAPVRFCCRPEAALLDLIPRA"
FT   sig_peptide     complement(131564..131656)
FT                   /locus_tag="Tfu_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            131789..132292
FT                   /locus_tag="Tfu_0108"
FT   CDS             131789..132292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54146"
FT                   /db_xref="GOA:Q47TR8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54146.1"
FT                   /translation="MGKIAWSSPEGASSIPGMSELKTRLQADLTAAMKARDAVRTRALR
FT                   MLLTAISNEEVSGKSARELSDDEIIKVITKEVKKRREAAEAFEQGGRADRAADERAEGE
FT                   VLSEYLPEQLSDEELADLVRAAIAEAGVSDVKGMGAVMKLLTPRVAGRAEGRRVADEVR
FT                   RQLS"
FT   gene            complement(132370..134775)
FT                   /locus_tag="Tfu_0109"
FT   CDS             complement(132370..134775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0109"
FT                   /product="PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54147"
FT                   /db_xref="GOA:Q47TR7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54147.1"
FT                   /translation="MLQKLGQLFGVSVAAGVLVAALAAPALGGIGIAARNVATGFLNMP
FT                   SELETPPPPQRSIIYDAEGGVIAEVYDRNRELVELDQIAPIMQQAIIAIEDSRFYEHGG
FT                   LDIVGTFRAALRTIAGRTQGGSSITQQYVKNVLIESATSQAEQEEARETTLGRKIRELR
FT                   YAIALEQRMTKDEILEGYLNIAYFGDGAYGAESAAQHFFSVSASELNLNQAATLAGLVR
FT                   YPELYNPRLNPDQAQERRDVVLDRMVATGVITEEEAEKTKAQDLELDISTPSNGCMPSK
FT                   QPFFCDYVIQEIEKNEAFGETETERARWLRTAGLEIYTTLDPDMQEAGQKAVDKWVPRK
FT                   NEARKVAAEVLIEPGTGEIRAMVQSRNYGPDESKLGETSINFTANADRGGSTGFQAGST
FT                   FKAITLAAALEKGLPYSTSFTSGSTITVTGQKNCDGNTLAPWTVSNSSESGGAATHNMV
FT                   SGTKGSVNTYFAQLQKRVGLCNVIKMAEKLGLTRADGQSYDNPRTQGNNSFTLGSEEVS
FT                   PLNVAAAYATFASRGIYCKPMAITKIVDRQAGRTIEMEPECERRISKDVADGVNYLLQQ
FT                   TFKGGTATGLGIGRPAAGKTGTTDNSASAWFAGYTPNLAGAVFVGDPRGPNQYPLRNVT
FT                   LGGRYYSVVYGATIPGPIWQETMREAVKKLDEKSFARSPARFGSTSEPAPPRREDPTDA
FT                   NPASSPGSVPNVVGMSRDQAVAAIESAGYRANVADRRLPSSHPEGTVALVEPSAGSRLA
FT                   EGSVVNIFLSRGPADNGNSNGGNGNGGWEFPGGGGWELPALDDQWGAF"
FT   sig_peptide     complement(134671..134775)
FT                   /locus_tag="Tfu_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.386 at
FT                   residue 35"
FT   gene            135242..135550
FT                   /locus_tag="Tfu_0110"
FT   CDS             135242..135550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0110"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54148"
FT                   /db_xref="GOA:Q47TR6"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54148.1"
FT                   /translation="MWSTDWAARAACREIDPDSLFVQGAAQNRAKLICRGCPVRTECLA
FT                   DALDNRIEFGVWGGMTERERRALLRRRPEVTSWRALLEDARQHYQQSGAAKDQFVKG"
FT   gene            complement(135822..136961)
FT                   /locus_tag="Tfu_0111"
FT   CDS             complement(135822..136961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0111"
FT                   /product="putative ion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54149"
FT                   /db_xref="GOA:Q47TR5"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54149.1"
FT                   /translation="MNPTPPRTLDVDDLLDNPGTRIVVCCGSGGVGKTTTAAALALRAA
FT                   ERGRHTVVITVDPARRLAQSLGLTELDNTPRPVPGVADSNGGSLHAMMLDMKRTFDETV
FT                   EAHADPQRAEQILNNPFYQSLSSSFAGTQEYMAMEKLGQLRRSDEWDLIVVDTPPSRSA
FT                   LDFLDAPKRLGRFLDGRLVRFLGTPARGGAFRLLGAGFGLVTGVITKILGTQLLKDVQS
FT                   FIGAFDAVFGGFQERAEQTYRILQTEGTAFLVVAAPELDALREASYFVARLSAEQMPLA
FT                   GLVLNRVQQVHADLSAEQGSAAAELLEATGEHPLAAAALRLHAGRVRQRNREQRLRNRF
FT                   AADHPDVAIAEVPAYPEDVHDLDALRAIGRALAGVSTVP"
FT   gene            complement(136958..138046)
FT                   /locus_tag="Tfu_0112"
FT   CDS             complement(136958..138046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0112"
FT                   /product="putative ion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54150"
FT                   /db_xref="GOA:Q47TR4"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54150.1"
FT                   /translation="MTLTSTITPGGGRARPQPAVHRLRGVSSRDRDWDGVRLHVVTGKG
FT                   GTGKTTVAAALALALAAEGGKVLLVEVEERHGIAPLFGLDSLSYAEREIAAADNGGTVY
FT                   ALAVDAEAALLEYLEMFYGLRRVGGALRRFGVIDFATTIAPGARDILLTGKVTEAVRRR
FT                   TPQSARHDGPGPYVYDAVVLDAPPTGRITRFLNVTAEVSGLARVGPVRDHAARVIDVIR
FT                   SPETVVHFVTLLEEMPVQECVEGIAEARDAGLHVGGILVNMVRPALLEDSVLAAASQGV
FT                   VDVAALTRGLQAASLPDPSRLAQELSKEIVEHARHMRVAAEARSRLAAAGRPCYDVPFL
FT                   DDGVDLDGLRRLARELRDQGAV"
FT   gene            138090..138263
FT                   /locus_tag="Tfu_0113"
FT   CDS             138090..138263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54151"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54151.1"
FT                   /translation="MTKWEYATVPLLSHATKQILDNWGEDGWELVTVIPGPTIGDDPRN
FT                   QQLVAYLKREKK"
FT   gene            138260..138727
FT                   /locus_tag="Tfu_0114"
FT   CDS             138260..138727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54152"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54152.1"
FT                   /translation="MTTKTPETRLAELGHTLPEVVPPVAAYLPTVRSGSHVYVSGQLPV
FT                   VGGELRATGKVGADVDPEQAKELAAVCALNAIAAIKAEVGELSRVKRVVKVVGFVASDP
FT                   SFTGQPQVINGASELFTEVFGEAGKHARSAVGVAVLPLNAPVEVEVIVEVD"
FT   gene            138774..139706
FT                   /locus_tag="Tfu_0115"
FT   CDS             138774..139706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54153"
FT                   /db_xref="GOA:Q47TR1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54153.1"
FT                   /translation="MSANHSECRREEEEKPSSAPVSPSEEATLSEGEVIRHLGSGEITP
FT                   RMWDVLAGRVTPVRPRDAATVLLVRQADRGLEVYLLRRVASMRFAPGMYAFPGGSVDPR
FT                   DSDHTIRWSGPPPREWARAFGADEALARALVCAAVRETFEESGVLLAGPSENEVVADTR
FT                   GDDWEEDRQALLNRSLSLAELLDRRGLVLRSDLLCPWARWITPAMEPRRYDTRFFVAVL
FT                   PEGQQPRDVGGEADHVTWMSPEEAVRQWRAGQLAMLPPTVANLKSLIGYATPEEVLAAE
FT                   REIVPVQPEFRKSAGGITLIVPDGVDYPF"
FT   gene            139706..140560
FT                   /locus_tag="Tfu_0116"
FT   CDS             139706..140560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0116"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54154"
FT                   /db_xref="GOA:Q47TR0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54154.1"
FT                   /translation="MDPLVGHAAKRGAMRIDGSGTLRASCVLCPNPGPMTLDGTNTWIL
FT                   REPGARNVLVVDPGPHHERHLERVARMVQEQGSQVTQALLTHGHADHAAGARYFSELTG
FT                   CRVRAVDPAHRISGDGLDDGEVVEADGLRVRVLRTPGHTADSVSFHLPADDVVLTGDTV
FT                   LGRGTTVIVGEDGGDLGDYLNSLIRLRDLVDSANIRALLPAHGPVCTDPLRKLNSYIQH
FT                   REERLGQIRDAVAAGADTLAEIVDRVYADVDPALRAATEASVRAQVRYLVDRGDVPVEV
FT                   LAD"
FT   gene            complement(140729..141415)
FT                   /locus_tag="Tfu_0117"
FT   CDS             complement(140729..141415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0117"
FT                   /product="Cyclic nucleotide-binding:Bacterial regulatory
FT                   protein, Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54155"
FT                   /db_xref="GOA:Q47TQ9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54155.1"
FT                   /translation="MVDETNEVLSKAPLFEALDEEGAAALRSSITEVRLGRGQTLFSEG
FT                   DEGDRLYVMLSGKVKLTRKSADGRENLLAVLGPGEMLGELSLFDPGPRTASAVAVTDAV
FT                   LAGLGHDDLRPFIMRQPEVAVHLLKALATRLRRTNDVVADLVFTDVPGRVAKALLDLAE
FT                   RFGKQSEDGLHVHHDLTQEELAQFVGASRETVNKALAEFALRGWLRIEAKAVVLLDVER
FT                   LRRRAR"
FT   gene            141677..142453
FT                   /locus_tag="Tfu_0118"
FT   CDS             141677..142453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0118"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54156"
FT                   /db_xref="GOA:Q47TQ8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54156.1"
FT                   /translation="MSRNVYTASSSPGASGDASAAERDTPTGETRLALMRRSRQINREL
FT                   ARMYPDAHCELDFTTPLELLVATILSAQCTDRRVNKVTPVLFARYRSAADYASANQEEL
FT                   ENIIRSTGFYRTKARNIIALGQRLCDEHGGEVPDRLEDLVKLPGVGRKTANVVLGNAFG
FT                   VPGLTVDTHFGRLVRRFGMTRQTDPVKVEQEIAALFPPEEWTMLSHRLIWHGRRVCHAR
FT                   RPACGACELQHLCPSYGEGPVDEETARRLVRTGPFS"
FT   sig_peptide     141677..141739
FT                   /locus_tag="Tfu_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.614) with cleavage site probability 0.603 at
FT                   residue 21"
FT   gene            142450..143115
FT                   /locus_tag="Tfu_0119"
FT   CDS             142450..143115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54157"
FT                   /db_xref="GOA:Q47TQ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54157.1"
FT                   /translation="MRPQITTPEWLLSLTEAAKRMPVPVEMRPPASGGRSSAVLLLFGE
FT                   GEAGPDVLLIQRNTGLRRHSGQPAFPGGALEPQDAGPVDCALREAEEETGVVRDGVHVL
FT                   GTLPEFYIPPTGFRVTPVLAWWHTPSEVRAVDTDEVASVTRVPIAELADPANRVRTVLS
FT                   NGRTGPAFRVRGMLVWGFTAGILDRLLVLGGWERPWRDQNVEVIDVFRPVARDGGGTP"
FT   gene            143148..144326
FT                   /locus_tag="Tfu_0120"
FT   CDS             143148..144326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0120"
FT                   /product="putative serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54158"
FT                   /db_xref="GOA:Q47TQ6"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR015724"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54158.1"
FT                   /translation="MLDAILVVLIIVFAISGYRQGFIVGVLSFVGFIGGGVLAALGAPP
FT                   VIQAFVPNPTQQALIAIAMVFLFAALGQFFTSYLGALIRNRVTWNSARILDAMGGALVS
FT                   TLSVLLVSWLVGSAVANSMIPLVTEQVQNSRILRTVDRVMPDPAQTWFSTFHRIVDQSA
FT                   FPQVFSGLGTSEPAEVAEPDPSVLNTEELRRASQSVVKVLGNAPSCQRRVEGTGFVYAH
FT                   ERVMTNAHVVAGVEEELRIVTRDGTQYEAIVVLYDPQQDLAVLAVPGLDLEPLEFEMQA
FT                   KKGDDAVVAGFPRDSGFTVVPARIRAEQTARGPDFYHSQQVSREIYQVRAVIQPGNSGG
FT                   PLLSPRGTVYGVVFAAATNDEETGYVLTAEEVAANAEAGIRATTPVSTQECD"
FT   gene            complement(144426..144971)
FT                   /locus_tag="Tfu_0121"
FT   CDS             complement(144426..144971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54159"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54159.1"
FT                   /translation="MAVVQLTISALPAHVRTARLMATAVARRAGVSESTLDEIRLAVGE
FT                   ACSRAVEAHRTHCPDQPIKLELIDSSGPTGPGGPSGPDRINGSRSGRFEVVVSDHAPAK
FT                   ENGAPAFNGFEGGPHASLGESLTSGGFGGLSPDVGLAVIRGLADEVSIEPSENGTVIRM
FT                   SWPLASNEADISEAHGLD"
FT   gene            complement(144979..145332)
FT                   /locus_tag="Tfu_0122"
FT   CDS             complement(144979..145332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0122"
FT                   /product="anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54160"
FT                   /db_xref="GOA:Q47TQ4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54160.1"
FT                   /translation="MDLKLDHHTQDDTEVVVVEGEIDVYTAPRLRELLIDLVNKGHHHL
FT                   IVNMEKVEFLDSTGLGVLVGGLKRVRAHDGTLDLVCTQERILKIFRITGLTKVFGIYES
FT                   VQEAIDKRKSKQS"
FT   gene            145555..147840
FT                   /locus_tag="Tfu_0123"
FT   CDS             145555..147840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0123"
FT                   /product="helicase, C-terminal:DEAD/DEAH box helicase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54161"
FT                   /db_xref="GOA:Q47TQ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54161.1"
FT                   /translation="MNRWEPVLQRLRRDHTRTAQVTHVESLTNSPGVRENWPGWASPAV
FT                   VERMVKSGVAKPWSHQVRAANLAHSGSNVIIATGISSGKSLGFLLPCTAAIAEGGSVLY
FT                   LAPTKALAADQERKLAELALPGVRAAVYDGDTPMEERSWARAHANYVLTNPDMLHRSIV
FT                   ARHPVWAGFLRRLSYVVVDEAHHYRGVFGSHVAQILRRLRRVCGCYGAEPRFILASATT
FT                   ATPAETAQQLTGLPVVAVTGDGSARASLRFALVEPELTEKTGEQGAPLRRTATAVAAEL
FT                   LADLVSHEVSTLVFVRSRQAAELVALAAQRALADAGRPELARRVAAYRGGYLAEDRRRL
FT                   EQRLRSGELLGLATTNALELGVDVSGLDAVVLAGWPGTRASLWQQAGRAGRSGRDALAV
FT                   FVARDDPLDTYLVHHPDAIFGQDVEATVLDPDNPYVLAPHLCAAAEELPLAPEELPIFG
FT                   PNASDVVAELVGRGLLRRRPRGWFWTRRERASTLADIRGSGGAPVQIVDEDSGVLLGSV
FT                   DEATASSAVHPGAVYLHQGFSYVVSALDLESGIALVRGEDPGYSTWAREVTHIDILTTA
FT                   REERWGEATVCFGKVRVARQVVSYLRRDLRTGAVLDERPLELPERVLESQAVWWTVGPD
FT                   AEERLRDEGVELRGAAHAAEHASIGLLPLFATCDRWDIGGVSTALHPDTGLLTVFVYDG
FT                   HEGGAGFAERGYAAARDWLRATRDAIAACECATGCPSCIQSPKCGNGNEPLSKPGAVRL
FT                   LDALLEAA"
FT   gene            complement(148193..148636)
FT                   /locus_tag="Tfu_0124"
FT   CDS             complement(148193..148636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54162"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54162.1"
FT                   /translation="MRRPPTARPTAPARQGTSALFRDRGAVTAETAVVLPGLALLLGVA
FT                   LCCVHAAAAHVACVDAARVGARALARGDDEAVVRSLVAQAGPPEATAELSMAEGFARVE
FT                   VTAPVRIIPGLPPTVRVSGTAAIPAEPEVDALAVRSADAPSSP"
FT   sig_peptide     complement(148481..148636)
FT                   /locus_tag="Tfu_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.678) with cleavage site probability 0.455 at
FT                   residue 52"
FT   gene            complement(148641..148847)
FT                   /locus_tag="Tfu_0125"
FT   CDS             complement(148641..148847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54163"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54163.1"
FT                   /translation="MSAAPVLLLRCLLRSAGRGRDTGMATSEYALVTVAACAFAAVLYA
FT                   ILTSAELRTALTRMVIDALGMGG"
FT   gene            complement(148982..149722)
FT                   /locus_tag="Tfu_0126"
FT   CDS             complement(148982..149722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0126"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54164"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54164.1"
FT                   /translation="MTGLDVAVIALAAGTGALAVGDGRSPAERRLAALSAPALRRPPRL
FT                   LPRLPRMLAAAAVLAACWALGGAGLGLFGSALLAGFVVWRRKRAAASPPSAGRDTEITA
FT                   VLPLALDLLAAGLRAGAHPTDMVAAVAQALGGPLGTALDGVARQLRLGADPARAWQSLH
FT                   APAELAAVGRALARASHTGAPLADVVESHAADCRRTARATALELAHRTGVAVVIPLGVC
FT                   FLPAFVLLGVVPLAAGLVSGLVLP"
FT   gene            complement(149735..150487)
FT                   /locus_tag="Tfu_0127"
FT   CDS             complement(149735..150487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0127"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54165"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54165.1"
FT                   /translation="MLADGIARYGMVVWTAGWLGCAVVWVLPSAAELRLRALTTARAPR
FT                   PSLRALAAVVRRRLTHRPGLLARRRLRGCADVCRAIAAELRCGSSPGKALAAALRGADP
FT                   LIAAELAEAAVLAEAGHDPVPALRAASRRPGGTAWASLAVCWQVAASSGTGVAAVVERL
FT                   ADALAHQDALHRELDIHLAGPRTTAVLLAGLPIAGLLMASALGGAPLLFLFTTPLGWGC
FT                   LCAGIALNAAGVWWTRRLVHRVLRTAGM"
FT   gene            complement(150490..151686)
FT                   /locus_tag="Tfu_0128"
FT   CDS             complement(150490..151686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0128"
FT                   /product="pilus assembly protein CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54166"
FT                   /db_xref="GOA:Q47TP8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54166.1"
FT                   /translation="MSSQLSLSGTAVARLLEAVRTRLMRESVEPTPAAVAAAVRAEDTT
FT                   LGDAEVLALSRLLRADLTGAGPLEPLLAAPDITDILVNGPHEIWVDDGTGLRRVNDIGF
FT                   PDDDAVRRLAQRLAAQAGRRLDAAEPWVDAQLPSGARLHAVLPPVSPEGPRLSLRLPRH
FT                   RVFSLPELVSLGTLPPAGAALLHSLVASRCAFLISGGTGTGKTTLLSTLLSLAAPTERL
FT                   VLVEDAAELRPDHPHVVRLQSRPPNIEGRGGVELHELVRQALRMRPDRLIVGEVRGPEV
FT                   VSLLHALNTGQEGSAGTLHANTAADVPARIEALGCAAGLSREAVHSQLAATRALVVHLV
FT                   RPPSGPRRVAQVCVLRRGCDGLVAAVPAVTFTAHGDLVHDTAFPELCDRIAVPPGRGQ"
FT   gene            complement(151683..152777)
FT                   /locus_tag="Tfu_0129"
FT   CDS             complement(151683..152777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0129"
FT                   /product="putative septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54167"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54167.1"
FT                   /translation="MPSTSSARPLFLTDDPALLDDLLRLAAAANVDVTVVSSAARSSRY
FT                   WAQAPLVVVGTDLVGVLARAEPPRHAHAVVVSRTPLSPALDFSVYPDAMRIGARDVLVL
FT                   PDAEQQLVALLTESTDHAGEEALVVSVIGGRGGAGASLLAAALALAGHRAGLRTALVDA
FT                   DPLGGGLDILLGAEHVPGSRWEEFSNRQGRMLWPALRDSLPHIHGLPVVTWTRHGPYAP
FT                   IPPQAMRTVLHAATRGCQMLVVDLPRALDAAAEEVLRRTTVALMILPAEVSAVVAAERL
FT                   LPALRDSVADLRLVVRGATPDILSAESVASSLKLPLAGDLPDDTELPRLLDQGELPTRR
FT                   TRSPLVAFSEAFVAHLCPERVRSA"
FT   gene            complement(153502..154314)
FT                   /locus_tag="Tfu_0130"
FT   CDS             complement(153502..154314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54168"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54168.1"
FT                   /translation="MNAVPTDPLMRIAEIPEVARAVDETRSLVDMLIGQRVLRRRGSDV
FT                   SMEAALRGARASAVLEGADVSLEQVRFGESDDPRVRGSVRVSGELGLLVETWSKAPRQV
FT                   LARLHVLAASDVVAPEALGRPRRDGDDVTDPLELGSPPPASEVIARLEALTSLLTARTE
FT                   APAVVVGAIVHGELLALRPFGWGDGIVARAAERLTLMARGLDPNSLVPTQLGHEQRREH
FT                   YAAALRGYMTGTPEGVAGWVVHCAQAVMEGARDSLATCEAIRRATTRR"
FT   gene            154466..154927
FT                   /locus_tag="Tfu_0131"
FT   CDS             154466..154927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54169"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54169.1"
FT                   /translation="MCPMEGAAAVSKTNTGGRKPVDVDAPRRSLGELTSEVTGHLSHLV
FT                   SLQLELARTELAADVRRVVQGTALVITAALVAHLILILASMTIAFALIAFGLPGWLAFL
FT                   IVTLVYTLVAVILGIVGVRSYKKIRGMPRSKETFDKTKAVLRREHTAQQ"
FT   gene            154924..155859
FT                   /locus_tag="Tfu_0132"
FT   CDS             154924..155859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0132"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54170"
FT                   /db_xref="GOA:Q47TP4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54170.1"
FT                   /translation="MIHRISNVPDESAVLIEGPWTHRLVSAGGIRFHVVEAGTGPLVVL
FT                   LHGFPQFWWAWEQQITALSAAGYCAVAVDLRGYGASDKPPRGYDLFTAASDIAGLIRVL
FT                   GEADAAVVGHGLGGLIGWTMSVCHPRAVRRLVALSAPHPVQLATATVAHWHRARGLWEL
FT                   LGLQVPMLPERRLVARNAQAVAEALRAWSCSGWPDAQTEQRFREAFQIPLVAHCSVEYH
FT                   RWLFRSRFRPDGYRYLQRMREPSPVPTLYVHGVADPLILPAAAHGLERHVRAPYRLRLV
FT                   EGAGHFPHQERPDQVNALLVEWLSDDAAQT"
FT   gene            155840..156337
FT                   /locus_tag="Tfu_0133"
FT   CDS             155840..156337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0133"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54171"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54171.1"
FT                   /translation="MTQHRRDRDRRADGRAQNQRPRDRYGRPLPYGAPGVPRVPDDAEF
FT                   SPTEGLREAQRLLDEGYAFHAHEVLEAVWKSVDGPQRELWRGLAQVAVGVTHAQRGNTV
FT                   GAARLLRRGADRVAEYGAEAPHGVDALGVAACARAMADRIEAGRAAEVDPAELRLVRAA
FT                   GG"
FT   gene            156826..159264
FT                   /locus_tag="Tfu_0134"
FT   CDS             156826..159264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0134"
FT                   /product="inorganic H+ pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54172"
FT                   /db_xref="GOA:Q47TP2"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54172.1"
FT                   /translation="MLEGDPSGKPWTAERAPGRGPARLEEDGLTGLNLAADSGAELALL
FT                   GMDLTLVIVVLAVALLALAVAGTLVREVLAASQGTERMQNIARAVQEGAAAYLKRQFRT
FT                   LAVFVIIIPLLLLLLPADTEAVRWGRSIFFAIGALFSAMTGFLGMWLAVRGNLRVAAAA
FT                   RAGEARAAMRIAFRTGGVAGMFTVGLGLLGAALVVLIYRADAPIVLEGFGFGAALLAMF
FT                   MRVGGGIFTKAADVGADLVGKVEHHIPEDDPRNAATIADNVGDNVGDCAGMAADLFESY
FT                   AVVLVASLVLGRVAFGTEGLVFPLLVPMIGVITAIIGIFVVSPRARDANAMAAINRGFF
FT                   ISAVISAVLVVGAALLYLPDTFAELEGVPADIAALDGNPQLIAIGAVLIGLLLAAAIQL
FT                   LTGYFTETNRPPVREIGESSRSGPATVVLAGVSVGLESAVYSALLIAGAVYAAFLLGGG
FT                   NITVSLFAVALAGTGLLTTVGVIVAMDTFGPVADNAQGIAEMSGDVEGSGAEVLNSLDA
FT                   VGNTTKAITKGIAIATAVLAATALFGAFRTAVEAELGATEFSLSVDQPDVLVGVIIGAA
FT                   VVFLFSGLAIMAVGRAAGRVVHEVREQFRTRPGIMDGTEKPEYGRVVDICTRDSLRELI
FT                   TPGLLAVLTPIALGFALGYAPLGAFLGGGIAAGALMAVFLANSGGAWDNAKKLVEDGHY
FT                   GGKGSEAHEATVIGDTIGDPFKDTAGPAINPLLKVMNLVALLIAPSVVIYADNLALRLG
FT                   ITVASVALLVGVIVWSKRRSTDGSFAAEATKTQPEAPAADQGAAKEEPVSQGGGASSQE
FT                   "
FT   gene            159489..159962
FT                   /locus_tag="Tfu_0135"
FT   CDS             159489..159962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54173"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54173.1"
FT                   /translation="MSRRLVVLRHAQAEHSASLADVDRPLTQEGRQQARMVGERLAREG
FT                   LLPDHVLCSTARRTRQTWDLVAEQLPCEPEVDFDAELYTADVDTALQLVSYVDPQVRTL
FT                   LVVGHNPTMAQLAAAFDSESGYLSFPPASVAVVDLDVDWLYIAPGTGRLRLVM"
FT   gene            complement(159987..161285)
FT                   /locus_tag="Tfu_0136"
FT   CDS             complement(159987..161285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0136"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54174"
FT                   /db_xref="GOA:Q47TP0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54174.1"
FT                   /translation="MPARDWGALVYATVVQQSTFRAVMTLANSVPETLLVTVTGKDRPG
FT                   ISARLLSTLSVFPVTITDLEQVVIGGRLLLGALLSADERVAPGVRKERLFEEIRSAVSK
FT                   VAVDMDMDVDFMVDGERVRPCTGTRLDVTIMGDPLRPGAVGAIASCVARAGANIDRIER
FT                   LASYPVTALSLSLTGGNLEQLRTDLALEAATQSVDVAVQTSGLHRRSKHLVVMDVDSTL
FT                   IQCEVIELLAQYAGCGDEVARITEEAMRGELDFEESLRRRVALLKGLDASILEEVREKM
FT                   TLTPGARTLIRTLKFLGYECAIVSGGFTQLTDYLVEELGIDYSAANVLEIVDGKLTGSL
FT                   VGPIIDRKGKAAALERFAAEAGVPLSQTVAIGDGANDLDMLRVAGLGVAFNAKPVVRAQ
FT                   ADTSVNVPYLDTVLFLLGISREEVEAAERGSYA"
FT   gene            complement(161378..161992)
FT                   /locus_tag="Tfu_0137"
FT   CDS             complement(161378..161992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54175"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54175.1"
FT                   /translation="MDLERLRASDADRERSAEVLRNALAEGRINHEELDERLDRVYRAT
FT                   TVGELAEITRDLPSSLGASPASGTDPSLSSAEAQQLAAQSRGKEAISAVFGGVERAGRW
FT                   LVEPHTTVSILCGGVDLDLREAVLAQREVVFQCAVIFGGLRIIVPPGVRVVNQANVFLG
FT                   GVDLSKVDSVTDPSAPTIRITGTCLMGGIQVLEQRPGQKCR"
FT   gene            complement(162022..162642)
FT                   /locus_tag="Tfu_0138"
FT   CDS             complement(162022..162642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54176"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54176.1"
FT                   /translation="MGNAANHSHALPPERRRASDADRDRVAQLLGEAFVDGRLTAEEHA
FT                   ERLDALSTATTLGDLQPLIADLGPAPTLSEAEELRASSTGAENIVAVFGSAKRSGRWLV
FT                   EPRTNTSTLFGEIALDLREAVLSQREVVIQCGLVFGSLKLTVPPGVRIVNETTPIFGDV
FT                   DLKKTDSAVTVNAPTIRLRGSVMFSSVKVRTRTLGKRKLPWMR"
FT   gene            163057..163842
FT                   /locus_tag="Tfu_0139"
FT   CDS             163057..163842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54177"
FT                   /db_xref="GOA:Q47TN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54177.1"
FT                   /translation="MNGHVLHMSGVGVRRGQTVLLDAVDWTVAEGERWVVVGPNGAGKT
FT                   TLLRIAATQLHPTRGTVEVLGERLGRGDVFELRPMIGFASSAVAAQLEDDMRVRDVVVS
FT                   AAYGYLGTGKEEYSAPDYARARALLGRWGVLRFEDRAFGTLSEGERKRVLIARALMSNP
FT                   ELLLLDEPAAGLDLGAREDLVRRLGTLAKDESAPALVLVTHHVEEIPPGFTHGLLLRGG
FT                   KVVAAGPLEQVMTADHLSTTFGIGLKVEFDGERWSARAS"
FT   gene            163958..164710
FT                   /locus_tag="Tfu_0140"
FT   CDS             163958..164710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0140"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54178"
FT                   /db_xref="GOA:Q47TN6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54178.1"
FT                   /translation="MNAWEACVVFAAGAGAGAINTLVGSGTLFTFPALLACGISPVTAM
FT                   ISNSIGLTPGSIAGVIGYRRELAGQRARVLRFGGMSFLGALTGGTLLLTLPERVFTSIA
FT                   PVLILFACALIIFQPQISARLQERRAARPHGGPLLPLGVYGAGVYGGYFVAAQGVILIS
FT                   LLSSSLNDEMQRLNALKNVLALIVNASVALFYLVLAEPHWGAVALISTGSVIGGYFAAK
FT                   FGRRLRPGALRALIVVIGLTAAVQLVLR"
FT   gene            complement(164721..165347)
FT                   /locus_tag="Tfu_0141"
FT   CDS             complement(164721..165347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0141"
FT                   /product="metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54179"
FT                   /db_xref="GOA:Q47TN5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54179.1"
FT                   /translation="MTEPAPVFTSGIDHERLTSQLRFVLEVDKLKRVLRRSLLIDGARR
FT                   ENSAEHSWHVAVLARVFAEYAPAGTDIDHVVNMLLVHDIVEIDAGDTYIYDQAAVSTQA
FT                   ERERAAADRIFALLPEDQAVWARNLWDEFEERKTPEARFARAIDRLSPLLANWHTEGAM
FT                   WRQFKISKDDVLKNVKLISEGSEPLGAYALALVDDAERRGYLSRN"
FT   gene            complement(165620..166504)
FT                   /locus_tag="Tfu_0142"
FT   CDS             complement(165620..166504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54180"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54180.1"
FT                   /translation="MREELAVVADSTLSRTLTGIAAGVPYLAIPPSDPAPTVPIVVALH
FT                   AFEPPRSEAALAGTLPLLGLPAWRFYLGLPLFGHRLPKGGVSEVNRLGREDYLLQLYSP
FT                   VVRQAAAELPLAVAELRRSFSLADAPLGLMGVGAGGAAVFLALIESDLPVGAVGVVNPV
FT                   IDPTHVLSARERHLGVDYTWDDQSRDAAAGLDFTERANELASRGPDTPVLIVNGEHDEI
FT                   IRPSHGRLLHDALSPHHQPHTLRHVVIPDLAHTLGPEPGLDPGPPTPGTVLTDRALTEW
FT                   FHTHLIARPQAAP"
FT   gene            complement(166709..167503)
FT                   /locus_tag="Tfu_0143"
FT   CDS             complement(166709..167503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0143"
FT                   /product="similar to Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54181"
FT                   /db_xref="GOA:Q47TN3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54181.1"
FT                   /translation="MTTNSRSSTTRLPAPSSCPTTFTGEEVFPALRNGSAVISPPSLIN
FT                   APLRRIPSQQRSMARVQRMLDACAELLDEAGYAELTTTKIAERAGVAIGSVYQFFPDKK
FT                   AITQALGLRYLDIFSARIVRRITEQNFDHWTETVDAIIDEYVTMHREEPGFRFLRFGDA
FT                   IDPKLLDSTRENNQVIATRLRDLLISLAGAVQSEKLDLAVLVSVEAADAVLKMAFRDDA
FT                   DGDPRLITAAKQLVRSYLEHVFGDEPDTAQELHESTDDRSPA"
FT   gene            complement(168164..169300)
FT                   /locus_tag="Tfu_0144"
FT   CDS             complement(168164..169300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54182"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54182.1"
FT                   /translation="MTPFSSLTLPNGRPLRFGALLATALLATACGTASDELSNDSSDRP
FT                   AQPTPSASAEPVKEPYTVAIGGDVMFEGMLRQRLDADPATAMGPVAEVFQEADVSVVNL
FT                   ETAVTDGGTPAPAKQFVFRAPATAFTALKEAGIDVATVANNHGMDYGTEGLLDTLENAE
FT                   AADFPIIGAGRDIAEAYEPEFFEVKGNTLAIIGATDVLDDHLIPEWTAGEGKPGLASTK
FT                   GEMITHAIDAVEKASAEADAVIVFLHWGLEGDHCPLPHAPDLAKQLIDAGATAVVGGHA
FT                   HVVSPGGYMGSSYVHYGLGNFVFYNFNGPTAETGVLRLTLQGGEILEDEWLPGRIEGGV
FT                   PILFEDEQAIAEGVARFEGYREQCSGINLTAEPGEPAV"
FT   sig_peptide     complement(169136..169300)
FT                   /locus_tag="Tfu_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.710 at
FT                   residue 55"
FT   gene            169570..169992
FT                   /locus_tag="Tfu_0145"
FT   CDS             169570..169992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0145"
FT                   /product="fur family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54183"
FT                   /db_xref="GOA:Q47TN1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54183.1"
FT                   /translation="MDDAASLRAAGLRVTAARLAILDAVRQGNHLDADRVARAVRERVG
FT                   HVSTQAVYDSLHALTAAGLLRRIEPAGSPARYETRVGDNHHHLVCRACGEVTDIDCVVG
FT                   EAPCLAPSQAHGYTVDEAEVVFWGVCPSCKAKESEH"
FT   gene            170878..171678
FT                   /locus_tag="Tfu_0146"
FT   CDS             170878..171678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0146"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54184"
FT                   /db_xref="InterPro:IPR005528"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54184.1"
FT                   /translation="MRKTTFASAAVLAAGLAVGFASPASADQAVSGNQIIIPVDVALDV
FT                   CGNTVAVLGDAQGACQSFVDALKSASGGAVTLQSNQGGGLANGNQIVIPVNVALNVCGN
FT                   TITALGEAKGTCDTIVEALEDAADDVVNSSDVPSDGSGGGLLNDNKIAVPIDADVDVCG
FT                   NAVSVLGSAESDCPEEDTAAPNKPAEPEQPGGGSEQPKPDEGGEKPAADDKPAEDAKPA
FT                   PAAEDTLPVTGAALGGLVAAAVAALGGGGAAMYFTRRKRNASEN"
FT   sig_peptide     170878..170958
FT                   /locus_tag="Tfu_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            171869..173890
FT                   /locus_tag="Tfu_0147"
FT   CDS             171869..173890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0147"
FT                   /product="similar to Metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54185"
FT                   /db_xref="GOA:Q47TM9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54185.1"
FT                   /translation="MGTPKSLTDRGFVPIATIGAGVWILLDILRVWLSSLVIVFGQEGT
FT                   TPLQNVGLFVLVWFLAPLPILLLRFLVTQKTVERSAQLPVDVWFAVLLVGARLGLQGLS
FT                   GEQLQLYVSSLGLAVGLTWLATIVVRMRRSLLRGFAAGIALATLTHTALGTYAVVWRSE
FT                   VLGWVLTAVQLLLFAWVLARTSRVSRDDFVKQAADSVLCFLLPPALLVAVTVTAAPARA
FT                   EAATGWPDGWAAALVMMAVALAAVVAGASSTPGSTPLLSGAVLVIAVGAAIFPTTTDEG
FT                   VPGLLPFYAPIAQAVGAIALIAALSWADWPGARGRPPRANNASLAVFFGSLVFYAVLLG
FT                   IYAGYTLGYPTDALVVGVALLIAVAAVVHGRAKDRDSGSRVRRSVFYRWPGATLAASAG
FT                   IVAAILPQVVPLYATTDPFSDTTRTPAGNELRVVAYNIRMGYGLTGTYDIEGIAETIQR
FT                   AQPDVVLLNEVDRGWFLTGGQDTLGTLARMLDMQAVFAPSNGQLWGDAVLTRLPIVETV
FT                   GYPLRGYGSTTGAQALAVVVKYETTEIEVIATHLQSPGTEEGEEPKEPTLQAADLADII
FT                   IKRRSAHGRPVIVGGDFNFERNGAAWREMERAGLYDALFRVRPSPTFPADDPDKELDHI
FT                   FATAGLVREQGAVLPASYSDHVAVMAVLRLESPLVYGT"
FT   gene            173973..174743
FT                   /locus_tag="Tfu_0148"
FT   CDS             173973..174743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0148"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54186"
FT                   /db_xref="GOA:Q47TM8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54186.1"
FT                   /translation="MMAFHVLLLVVVPSFIALGLWQYERAETKAAVVELQEANLAADPV
FT                   PIEELTSVGGEVAPEDRWRRVTVTGTYDPDRELLVRNRSGSGGVGMHVLTPLVTEDGTA
FT                   VLVNRGWVAQPPTATESPEVPPAAQGEVTVTGRLQVSETPESTGIHSRDGLPEGQIMLI
FT                   DVPAIAADLPYEVYGGYVELVEETPAPAAAPEPVEVTKVNTGMNFSYAVQWWTFTVIAV
FT                   GGWVFLVRREVQDAAQKSEPAEPDTVSSTTPNKV"
FT   gene            175058..175630
FT                   /locus_tag="Tfu_0149"
FT   CDS             175058..175630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0149"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54187"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54187.1"
FT                   /translation="MLEEKTTVRTVSPHAESDRSSTDPRPIVAHPWARGVLAAIRLSIG
FT                   WIFLWAFLDKLIGLGFATPAERAWINGGSPTHGFLTNAVSGPFADAYRAIAGAAWADFL
FT                   FMLGLLGIGVALLLGIGMRIAAATGALLLFLMWTAVLPPETNPFMDDHIVMGLTVIALA
FT                   LTNAGDTFGLGGWWSNLGIVRRFPVLR"
FT   gene            175809..176639
FT                   /locus_tag="Tfu_0150"
FT   CDS             175809..176639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54188"
FT                   /db_xref="GOA:Q47TM6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54188.1"
FT                   /translation="MIDDVEQATVHRVARRPLGPQESARASRLWWERAADEYQAEHGSF
FT                   LGDAEFVWGPEGLTEREAQLLGNPADLVGRRVLEIGCGAGQCGRWLRAQGVAEVVGIDM
FT                   SARQLQHSHRLDKATGHRLPVVQADAQWLPFADASFDVVCSSFGAFPFIPDIRTALAEA
FT                   ARVLRPGGRLAFSVSHPIRWCFPDSPGEDGLQARDSYFDRRPYVEEDEYGRALYVEAHH
FT                   TIGDWVRALADAGLVIRDIVEPEWPEDNDQVWGGWSPLRGRIIPGTAIFVADRP"
FT   gene            176721..176981
FT                   /locus_tag="Tfu_0151"
FT   CDS             176721..176981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54189"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54189.1"
FT                   /translation="MNGMEFGLLLMALLAVIIPVGVIITVVVVLWHAQRSAERQVRSPE
FT                   FWERRRLESDSLLRDLDRQLAEGEIDRAEYEQRREKYRAAR"
FT   gene            176982..177260
FT                   /locus_tag="Tfu_0152"
FT   CDS             176982..177260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54190"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54190.1"
FT                   /translation="MHRGARPKQTGGGMGVIRAEHVAELLRSTDAGTVLVVRGGAAEVV
FT                   PPDRRDSQGYRGALEVVSRGELDEQAARQDPAALARGFDTAVAAMGG"
FT   gene            177500..178849
FT                   /locus_tag="Tfu_0153"
FT   CDS             177500..178849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0153"
FT                   /product="pectate lyase/Amb allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54191"
FT                   /db_xref="GOA:Q47TM3"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54191.1"
FT                   /translation="MRRAATLGVALALPLTLAAPSSALAQPHHHAGVSPKAEQVAREVL
FT                   APNDGWAAYDGGTTGGAAADPEHVYVVTTYAELREALAGGRTNDTPKIVFLKGRIDANT
FT                   DEHGNQLTCDDYADPEYDFDAYLATYDPEVWGWDQEPSGPLEEARERSYRNQRDQVVIE
FT                   VGSNTTLIGLGDDATLVGAQVMVDSVDNVIIRNIIFETAQDCFPQWDPTDGPEGNWNSE
FT                   FDGVSVRRSTHVWIDHNEFSDGAVLDRDLPEYFGREFQVHDGLLDITHGADLVTVSYNV
FT                   LRDHDKTMLIGSTDSPTYDVGKLRVTLHHNRWENVLQRAPRVRYGQVHVYNNHYVIPAT
FT                   PEGEKTYEYSWGVGVESALYAENNYFDIDPSVDFSQVVAHWKGTQMYEKGSYANGRSRH
FT                   HQVSFLDEYNAVHSPTIENKQTWSPPLHGRIDPTQSVPAKVQKAGVGHIL"
FT   sig_peptide     177500..177577
FT                   /locus_tag="Tfu_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            complement(178975..179661)
FT                   /locus_tag="Tfu_0154"
FT   CDS             complement(178975..179661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0154"
FT                   /product="similar to Phospholipid N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54192"
FT                   /db_xref="GOA:Q47TM2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54192.1"
FT                   /translation="MAATHDPRPFRWPRLIRDGGLFFRQAVQTFRTTGAIIPSGAALAS
FT                   ELARYVAQRNDPASSLSILEAGPGTGPVSRAIAARMRPGDAADLVEANPVFVEHLTRLV
FT                   KSDPVFQPIADRVTIHPTLVTELGTDRQFDVIISGLPFANFTADEVRTIMEYYFSVLRP
FT                   GGYVSFFSYLYLKQVTAVVSPLDDYLRRVRSGWEVREWVNRYAVDQVHVYRNIPPACVF
FT                   HLRKPL"
FT   gene            complement(179703..180659)
FT                   /locus_tag="Tfu_0155"
FT   CDS             complement(179703..180659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0155"
FT                   /product="esterase / lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54193"
FT                   /db_xref="GOA:Q47TM1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54193.1"
FT                   /translation="MPLDPETRALIDELVSGSPPGEAVGVPDASLHSSLRERRIVGPGV
FT                   ALVRDLTIPSPAGGIPARLYHPAPDNPATGCAVFFHGGGYVFGNLDTHDHIARLLAAES
FT                   RAAVVAVDYRLAPQHRFPAAVEDAFTATRWVAEHATRLGVDAARLAVVGDSAGGGLAAA
FT                   VALLVRDGGPPLAAQVLIYPVIDLTGYPVTADTPYPSRIAHGEGCFLTTAAMQHVVEQY
FT                   LADPADAADFRASPIRAADLSGAAPALVVSAEFDPLRDEAEAYARALAAVGVPATTVRI
FT                   NGGVHGMFGLGPVLPLSRHAELPVIALLRDTLQPPQR"
FT   gene            180859..181566
FT                   /locus_tag="Tfu_0156"
FT   CDS             180859..181566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0156"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54194"
FT                   /db_xref="GOA:Q47TM0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54194.1"
FT                   /translation="MAAPRVGVVTFPGSLDDRDAARAVRIAGAEPVSLWHGDADLKGVD
FT                   AVVLPGGFSYGDYLRCGAIARFAPIMTEIVPAARSGNLPVLGICNGFQILCESQLLPGA
FT                   LTRNASRHFICRDQLIRVEAADTVWTNGYSPGQELLIPLKSGEGNYVADPETIAELKRD
FT                   NRVVVRYVDSAPNGSMDNIAGVTNEHRNVVGLMPHPEHAVEALTGPSTDGLGFFTSLLA
FT                   HLTGSTPVPETAG"
FT   gene            181600..182082
FT                   /locus_tag="Tfu_0157"
FT   CDS             181600..182082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54195"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54195.1"
FT                   /translation="MMALLRSRRVQVGLAVAGILALLTTTAVTLLYRPWTSDTAPVVPA
FT                   AAPPLEVLGAAPDGISYTDLGQQCTPQECYRPVGVTAEGLDAEEAIETIYTHLSDQGWE
FT                   RLLPEGETDPDEVPYSQSALSNGTVLVQGSLEPYVEGTTAGLLLAHRVPPPPSPQR"
FT   sig_peptide     181600..181737
FT                   /locus_tag="Tfu_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.536 at
FT                   residue 46"
FT   gene            182115..184412
FT                   /locus_tag="Tfu_0158"
FT   CDS             182115..184412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0158"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54196"
FT                   /db_xref="GOA:Q47TL8"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54196.1"
FT                   /translation="MSEEPRFDTVAKAAATPDLPQPYTELGMKDEEYARVREILGRRPT
FT                   SAELAIYSVMWSEHCSYKSSKVHLRQFGEKAPDTDVLLVGIGENAGVVDVGDGYAVTFK
FT                   IESHNHPSYVEPHQGAATGVGGIVRDILSMGARPVAVMDSLRFGPADAPDTQRVLPGVV
FT                   SGISSYGNCLGLPNIGGEVGFDAGYASNPLVNALCVGVLKHENIKLAQASGPGNHVVLF
FT                   GAATGPDGIGGASVLASASFDEESQAKRPSVQVGDPFLEKLLIECCMELYAKDLVVGIQ
FT                   DLGAAGVSCATTELAAGGTGGMRIELDRVPLRDPRLTPEEILMSESQERMMAIVEPDKL
FT                   DEFLAVCAKWDILASVIGEVTDVTPEEEARGGRLVMTWRGETIVDLPPRTAADQGPVYH
FT                   RPIERPADQDALLADDPAALPRPSSDEELRDQVLRVLAAPGICDSSWITDQYDRYVMGN
FT                   TVLAMPHDSGMIRIAEDTDRGVALATDGNGRYTRLDPYVGTQLAYAEAYRNVAATGARP
FT                   LAVTNCLNFGSPEDPGVMWQFAEATRGLADACQALGTPVTGGNVSFYNQTGSTAINPTP
FT                   VIGVLGVIDDVHKRVTSAFSAEGESVVFLLGETRLELGGSAWADVIHGHLGGRPPQIDL
FT                   DAEAALGRVLIDGAAAELLVSAHDLSDGGLAVALAESCLRGGVGCEVDLGDDAFTALFS
FT                   ESAARAVVSVRPEHETALVDLCAKHGVPVRRLGTVGGSALTMVHRTGRISIEVAELRDA
FT                   YESTLPALFGNK"
FT   gene            184472..184714
FT                   /locus_tag="Tfu_0159"
FT   CDS             184472..184714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54197"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54197.1"
FT                   /translation="MRGCRPGSGLFAPLPALDCLTVGGRDSLVINQRLRFAVFVGPGRA
FT                   AAFECPLDLVFEALVESGTVFIAAALHEGCLPSTS"
FT   gene            184954..186039
FT                   /locus_tag="Tfu_0160"
FT   CDS             184954..186039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54198"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54198.1"
FT                   /translation="MYETTAPVASVYLDTTRTTESAFKEIELRWRAARERLAEQGADEA
FT                   TLQALDEVAEGEPGVPGPQGEALFAAEGRVLGAFTLSRPPLRDSAVWWPVAYPLGVVID
FT                   RNHQIPYVTVAADREGADVSAYTAAQHKPEFQRSFSGSTLHIQKVRVGGWTHKHYQRRS
FT                   ENLWDANAQEVAKDVEDTAAHVGAEVVFVGGDERAIGKLRDHLSERVRDILVEHPGGGR
FT                   HDPAALASLREAADGVVDCVVAETRKRERAEFTTALSRGEGATQGIAAAAEALRRAQVK
FT                   TLLLAADLGKEPWIWGSRTDPLEVSVDRESLSDPENAIQAPASALLLRAAAYTDAEFVE
FT                   LTDNSAAEGVGAILRYTTAVR"
FT   gene            186124..186354
FT                   /locus_tag="Tfu_0161"
FT   CDS             186124..186354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54199"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54199.1"
FT                   /translation="MRRGSLKGPLGSHDRPASALTFRLVLAVFGAVVLLVGAVLAAVWA
FT                   DSVPLAVVLGAGFLAACLNVYWVSRRRRYER"
FT   sig_peptide     186124..186261
FT                   /locus_tag="Tfu_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 46"
FT   gene            complement(186809..187594)
FT                   /locus_tag="Tfu_0162"
FT   CDS             complement(186809..187594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0162"
FT                   /product="3-oxoadipate enol-lactonase"
FT                   /EC_number="3.1.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54200"
FT                   /db_xref="GOA:Q47TL4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54200.1"
FT                   /translation="MAVVPLQHRFDGPRTAPVVVLVPTLGTKWSMWEPQMPELTRRLRV
FT                   LRVNHRGHGSSPAPPGPYSMQELGGDLLTLLDECDLEQVSFIGIGLGAMVALWVAATNP
FT                   SRVSRLALVSTTAWAPPLPRWRDIGDRVRHFGISSVIDEVTRSWFTPGFCERRPDIVTR
FT                   FTEEFEKISPEGYAGCCDAIAALDHRPLARLVHAPTVVIAGAHDPQTPPGHGRRLAALL
FT                   PHARFEVVSGAAHLVNVERSDVVNELLLQHLDPLSVHWP"
FT   gene            complement(187692..189401)
FT                   /locus_tag="Tfu_0163"
FT   CDS             complement(187692..189401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0163"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54201"
FT                   /db_xref="GOA:Q47TL3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54201.1"
FT                   /translation="MTSPLRPEDPTRVGDYDLVARIGKGGQGVVYLGKAPDGTRVAVKV
FT                   METSWASNSRARSRFAKEIEAASKVAPFCTAALLDSDINADPPYIVSEYIEGPSLRDAV
FT                   LRDGPRTGAALDRLAISTATALVAIHQAGVIHRDFKPANVLLGPDGPRVIDFGIARHSE
FT                   ATVTATDSIVGTPAYMAPEQVEGRELTPAVDIFAWAGVMVFAATGQSPFHDETLPAIIN
FT                   RVLHQPPRLDGVDERLRPLLEACLAKEPERRPTAVQVLGVLVGHDPATLPQVPVEEVLE
FT                   NGYTAALNEQTQIAATAALPIPIGDQAPEPAPTAVMPAAEDTPAPESRTPVSGLAALAA
FT                   NRPADEAPASSPPSGPLRTTSGLAALVNTGENKQPTASSPGEGPPRRSAGPGHQPLPPR
FT                   STRERKTVLSWLVAAGILIIVLAGGWFLIDTFLLSPNGQSPEATPVDGTRRDTPAQDGI
FT                   DDSVPSPSAIDPDTPTSSDTGYPGGELYPSLPYDDMSQTDPMEEPHLNPTIPGEGPWHS
FT                   PPAGEEAPGQPHGGGAEEGGSEGGEQPGTGGPGGSGEGGAGVGRVAVSPAAP"
FT   gene            190024..190854
FT                   /locus_tag="Tfu_0164"
FT   CDS             190024..190854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54202"
FT                   /db_xref="GOA:Q47TL2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54202.1"
FT                   /translation="MRVPLLLRPRWLGIHLLALLAVLTCTLFGYWQYERAQRPDRETVT
FT                   NPVADLAAAVDISTLLRPGEYMPQDLANEAVVVTGTYDAEHQLLSPALSPDGAEGYSVV
FT                   IPLVTEDGVAVAVNRGWIPLDAADEVPPPPDGEVTVRGWLQLPQDEASRGYSAILPEGQ
FT                   IARISSALLVNEWPYQLYEGYVTLGEQSPPTPAGAGSALEEFPPPDPPQGIVWNFRNLS
FT                   YAAQWWVFGLAAIVFWVSLMRRELDDHRKARQDGGAAAEGPAEPAQPSAEMVAD"
FT   gene            complement(190824..191249)
FT                   /locus_tag="Tfu_0165"
FT   CDS             complement(190824..191249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54203"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54203.1"
FT                   /translation="MENKRLPLTVYRVLAYVTSTWLLLLTFVAMPAKYLVGETAQFSVV
FT                   PAPAGLEQWFGAETPLMMYIAIPHGYIYMVFVLSVLWLALKRRWNALRTVGVMLSGTIP
FT                   VVGFFVERKIAAEEQAAIDAEEQTSGAAQSATISADG"
FT   gene            complement(191410..192951)
FT                   /locus_tag="Tfu_0166"
FT   CDS             complement(191410..192951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0166"
FT                   /product="similar to Glycosyltransferases probably involved
FT                   in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54204"
FT                   /db_xref="GOA:Q47TL0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54204.1"
FT                   /translation="MRTARFIGSWLAGLLSLATAALLFMLWLRFVLGSGNDTPVAFLLI
FT                   IGVGLNLMVWSLIGLIRLIDEWIHKLLGRDPFGSRRELPRRAKARIRDEDKRVTFAARS
FT                   RSGARRARRTPTPVLNPDTGEFEIPKVNTDPETISLAVIIPAHNEEPVIDGAIRSALRL
FT                   FDRWDIYVVSDSSSDATAEIAAQTGVNVLELLTNRGKAGAIEAVIQEFDLIDNYDGVVI
FT                   LDADTELDENYVKGVRDQLRDPTVAAVAGFVVAEWKPQQRTVIGRLIAAYRDRLYWLMQ
FT                   YMLRFGQTWRFTSVTFIVPGFASTYRTSVLKHLDINPEGLVIEDFNMTFEVHHKKLGRI
FT                   SMRPDTKAYSQDPFTLSDYKSQVRRWSLGFWQTVRRHGIWPSLFWFSLFFYILEIVLVA
FT                   ALLLLTALIFVFVLPPALFGEEVLVVEWYAAGYAAVTSVLPLSTVAVGLFVPDYILTCV
FT                   VAMIRRRPSYLFYGLFYLPLRLLDSYLMLITIPQAWTTKSDGRWKSPTRMPVKTP"
FT   sig_peptide     complement(192850..192951)
FT                   /locus_tag="Tfu_0166"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.778 at
FT                   residue 34"
FT   gene            193241..194029
FT                   /locus_tag="Tfu_0167"
FT   CDS             193241..194029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54205"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54205.1"
FT                   /translation="MRTAGGGISYPQPGTTALDRLREGELTVRVAMHQPHYLPWLGLLD
FT                   KIDRCDLFVVLDHVQFERKGWQHRNYVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSP
FT                   WWEKHSRTLAQHCYRKAPFWDEFGAEITAIYERRWEQLVDLSLATTEFVLNAFGITTPM
FT                   VRSSELGEFTVQKSELLAQISAKVGATTMLSGDGARAYLDKDVFDRYGIAVEWQNFQHP
FT                   EYPQHNRKGQEFLPRMAAIDLLLNVGPEGMDLVRQARIAD"
FT   gene            194123..194836
FT                   /locus_tag="Tfu_0168"
FT   CDS             194123..194836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0168"
FT                   /product="conserved hypothetical protein, possibly
FT                   membrane-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54206"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54206.1"
FT                   /translation="MMIDWSRERILILAPHPDDETLGCGGLMRKAKDAGAEVYIQFMTV
FT                   GDTADNSPKGLSTAEERYQEVKEVAEFYGWDDWHFAFPGDAYHLKLDAVPRFELTNAIE
FT                   RGSPLSIAKLKPTTVIAPHRTSYNQDHQITAEALHTALRPSNTQRRHHPRLVLAYEQAA
FT                   DQWRYDAAPSPNFFVELTKEQVDAKIHAMHLYGTQSHDHPHTRSDETLRSLATLRGMHA
FT                   GVPYAEAYHMMRWLA"
FT   gene            194919..195878
FT                   /locus_tag="Tfu_0169"
FT   CDS             194919..195878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0169"
FT                   /product="nucleoside-diphosphate-sugar epimerase
FT                   (UDP-glucose 4-epimerase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54207"
FT                   /db_xref="GOA:Q47TK7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54207.1"
FT                   /translation="MKALVTGGAGFIGSHLCDYLTSQGHQVTVLDDLSTGSKENLAQLA
FT                   AAPNFEFVEGSILDTALVDKLVGSCDTVFHLAAAVGVHTIVDKPLESLRVNLHGTENVV
FT                   EAAARHGARIMVASTSEVYGKNDADGLTEDADRILGSPLKSRWSYAAAKGLDELVAYVY
FT                   GKETGIPTVIVRFFNIVGPRQTGRYGMVVPRFVSQALANEPITVYGDGTQRRCFGSVFD
FT                   VVPAVVKLMDTPAAYNQAVNLGGMEEISIRGLAERVIELTGSSSTIEYIPYEKAYGEGY
FT                   EDMRRRMPDTSLAKKLIGYEPTRRLDDIINSIIEAKQA"
FT   gene            complement(195927..196280)
FT                   /locus_tag="Tfu_0170"
FT   CDS             complement(195927..196280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54208"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR020264"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54208.1"
FT                   /translation="MSGPRERDPGLQPERTLLSWQRTLFLLAVVTLLYLRVPPEDTLAG
FT                   TVGQLIAVGILFGTSTVLAVHLQKRWRQTDHGRRADGSLRPPAPLARPWALVAVSLAVL
FT                   GISVIAIVSAFPA"
FT   gene            complement(196277..196651)
FT                   /locus_tag="Tfu_0171"
FT   CDS             complement(196277..196651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0171"
FT                   /product="probable conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54209"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54209.1"
FT                   /translation="MGALSRAKRRANDGGDGKEPDYRFTLANERTFLAWIRTALALVAG
FT                   AVAVLHLVPLRWHGGTQLSVGLALAALAVVITCYAPIRWMRVQRAMRHDQPLPTTPLPL
FT                   ITALGIGLICLAVVVGNYLP"
FT   gene            196770..197234
FT                   /locus_tag="Tfu_0172"
FT   CDS             196770..197234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0172"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54210"
FT                   /db_xref="GOA:Q47TK4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54210.1"
FT                   /translation="MPRMRNKAAASTAVQGRRPLLTPRSGEPVATIELTKDNFNQTLEE
FT                   NDFVLIDFWASWCGPCKMFAPIFERASERHKDLVFAKVDTEAQQELAASFNIQSIPTLM
FT                   IVRDRTVLYAQPGALPEAALEDLIQQARDLDMDEVRRQIAEQQGNGQASE"
FT   gene            complement(197344..198060)
FT                   /locus_tag="Tfu_0173"
FT   CDS             complement(197344..198060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54211"
FT                   /db_xref="GOA:Q47TK3"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54211.1"
FT                   /translation="MDRSAQGVPGFSDTAAPVVVDRTQGVSGGDLVLRRVGTDYEIISN
FT                   GVFLMDTRDGRSERELVRACLRVLPADQTGLRVLVGGLGVGFSAAEALASPRVAHVRVI
FT                   EVEPAVIAWHSGPLGEAAGRPTDDPRCQVVCADLVEWLAETAETFDAVCLDIDNGPDWT
FT                   VVDSNRRLYSPDGLDRLAQLTAPGGALAVWSAMPAPDFALLLDRRFGAVEEIRVPVRRG
FT                   APDVVYLARPHGPHRQ"
FT   gene            complement(198067..198921)
FT                   /locus_tag="Tfu_0174"
FT   CDS             complement(198067..198921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0174"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54212"
FT                   /db_xref="GOA:Q47TK2"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54212.1"
FT                   /translation="MTDLLRIAVPNKGQLSEPAIAMLREAGYRQRKDSRDLVLLDPDNG
FT                   AEFFFLRPKDIAVYVGEGILHVGITGRDMLIDSGAPVEEVLALGFGNSTFRFAARNGSS
FT                   MTVEDLAGKRIATSYEGLLTSYLKKRGIEARVIHLDGAVESSIQLGVADAVADVVSTGT
FT                   TLRQAGLEPFGEPILESEAVVIRRKGEPDDPKVEQLLRRLRGVLVARDYVMMDYDVHAE
FT                   HLEEAIALTPGMEGPTVSPLHREGWVAVRAMVPRRDAQRIMDDLWEIGARAILVTDIYA
FT                   CRL"
FT   gene            complement(199004..199267)
FT                   /locus_tag="Tfu_0175"
FT   CDS             complement(199004..199267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0175"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54213"
FT                   /db_xref="GOA:Q47TK1"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54213.1"
FT                   /translation="MKTFEELFTELSEKARTRPAGSRTVAQLDAGVHAIGKKVVEEAAE
FT                   VWMAAEYQSDEETAEEISQLLYHVQVLMLARGLRLEDVYRHL"
FT   gene            complement(199389..200111)
FT                   /locus_tag="Tfu_0176"
FT   CDS             complement(199389..200111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0176"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54214"
FT                   /db_xref="GOA:Q47TK0"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54214.1"
FT                   /translation="MLVARSADRLAALAAELTDRYGVPAQCLPADLTDDKDLATVEERL
FT                   RVTGDTADAPIDLLVNNAGQAHGGDFATIPVSAIEDTLALNIRALTRLAHAVLPVQIER
FT                   ARQLREAGSSRPLGMINVASMAGLLPAAPGGAVYSASKAYVLSLTDTLAVEAARHGVRV
FT                   TAVLPGYVRTDMTRSLQEKGAPDIAFVPRERVVTDSLRGWASGRTRVVPGAQYKAVNAL
FT                   LHALPPGLFHAVAKRTSA"
FT   gene            complement(200301..200744)
FT                   /locus_tag="Tfu_0177"
FT   CDS             complement(200301..200744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54215"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54215.1"
FT                   /translation="MERRFQVALPRAAYTVPVLRSFLGCALHVHGVCPECQRDILVAAS
FT                   EACANVIDHGAPASDYQVSVSIEQACCVIRITHNGRHFTPTIAPPRPAPDSESGRGIFL
FT                   MHALMDEVVFDVEPDGRTTVLLVKRLCLLPAAKRPLTPAVASG"
FT   gene            complement(200854..201096)
FT                   /locus_tag="Tfu_0178"
FT   CDS             complement(200854..201096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0178"
FT                   /product="phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54216"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54216.1"
FT                   /translation="MARVIVDVMLKPEILDPQGQAILGACERLGFSGVTQVRQGKRFEI
FT                   DLEGEADEARLAEIRKLAETLLANPVIEDFSLRVE"
FT   gene            201549..202148
FT                   /locus_tag="Tfu_0179"
FT   CDS             201549..202148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0179"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54217"
FT                   /db_xref="GOA:Q47TJ7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54217.1"
FT                   /translation="MATIELDRPAETTVTAEGLDFAEAVRPYADQLYPAALRMTRNSAD
FT                   AEDLVQETFTKAFANFHQFRAGTNLRAWLYRILTNTFINGYRKKQREPRQEVTDEIKDW
FT                   QLAAADAHSSTGSRSAEAEVLDRLPDSAIRTALAQLPEEFRMVIYLIDVEGFSYKEVAE
FT                   QMDTPLGTVMSRLHRARRQLRVLLADYAKERGLYAD"
FT   gene            202416..203633
FT                   /locus_tag="Tfu_0180"
FT   CDS             202416..203633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0180"
FT                   /product="pyruvate dehydrogenase (lipoamide)"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54218"
FT                   /db_xref="GOA:Q47TJ6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54218.1"
FT                   /translation="MVGLFDPTRYPGTGRAGNRPTSGTPSVGPETEERQVSDSTVREEP
FT                   ELIQLLTPDGEYVPHPDYPFEPATAQVRDLYRDLVLVRRLDAEAVALQRQGELGLWASL
FT                   LGQEAAQIGSARALEPQDMAFPSYREHGVAWCRGVRPRDLLAMFRGVTNGGWDPYEHNF
FT                   HLYTIVIGSQTLHATGYAMGVQRDGALGEDGTAVITYFGDGATSQGDTNEAFNYAAVNN
FT                   APVVFFCQNNQWAISEPNDRQSKAPIYQRAAGFGFPGIRVDGNDVFACLAVTRKALQHA
FT                   REGQGPTLIEAFTYRMGAHTTSDDPTRYRTSAEIEEWRRKDPIARLRAYLVREGKADDG
FT                   FFDAVEAEAEKLGEQVRAECRALPDPAPLDIFREVYAEPHRELDRQRAEFADYLASFEG
FT                   AEGAAR"
FT   gene            203630..204613
FT                   /locus_tag="Tfu_0181"
FT   CDS             203630..204613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0181"
FT                   /product="putative branched-chain alpha keto acid
FT                   dehydrogenase E1 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54219"
FT                   /db_xref="GOA:Q47TJ5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54219.1"
FT                   /translation="MSGTELTLGKAINAGLRRAMENDPKVLVMGEDVGRLGGVFRVTDG
FT                   LYKDFGADRVIDTPLAESGIIGTAIGLALRGYRPVCEIQFDGFFFPAADQTFTQLAKLR
FT                   ARSEGRLSLPVVIRIPYGGGIGAVEHHSESPEAYFTHTAGLRVVTVATPEDAYWMIQQA
FT                   IACPDPVVFLEPKRRYWDKAPVRTDGSVDTATPMGEARIVRPGTDVTLVAYGPMVKVAL
FT                   HAAEADTERSIEVIDLRSLSPVDYDTVYESVRRTGRLVVTHEAPVTSGLGAEIAARVTE
FT                   ACFYHLEAPVIRVGGFDTPYPPSRLEEYYLPDLDRVLDGVDRTFAY"
FT   gene            204624..205964
FT                   /locus_tag="Tfu_0182"
FT   CDS             204624..205964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0182"
FT                   /product="putative dihydrolipoamide acyltransferase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54220"
FT                   /db_xref="GOA:Q47TJ4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54220.1"
FT                   /translation="MTHQGIQQFVLPDVGEGLTEAEILTWHVQPGDQVDVNQVICEIET
FT                   AKAVVELPSPFAGRVEALLVEAGETVPVGTPIIAVDTGGAAGEPRPEPAPAAAPAEPPA
FT                   EEKREPVLVGYGVKSGATKRRARRRTPSAVPAQTVGQRTVVLAKPPVRKLAKDLGVDLR
FT                   TVVPSGPNGVITRDDVRRHAEQNQPQPSAPRVPEPAAPAPAASPAPERDVREERIPVKG
FT                   VLKHMAAAMVDSAFTAPHVTEFLQVDVTKTVKVVQKLRQRPEFADVKVSPLLLVARALL
FT                   IAVRRHPRINASWDEANQEVVVKHYVNLGIAAATDRGLVVPNIKEADRLPLPDLARALT
FT                   DLTEKARAGQTAPADLTGGTITITNIGVFGIDGGTPILNRGEAAILALGQIRDMPWVHK
FT                   GKIKIRKVTTLSLSFDHRLVDGELGSKVLRDVATILEDPEEMVLAWG"
FT   gene            206397..207149
FT                   /locus_tag="Tfu_0183"
FT   CDS             206397..207149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0183"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54221"
FT                   /db_xref="GOA:Q47TJ3"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54221.1"
FT                   /translation="MTDNRAAAPGWHLGPLVGFDIETTGINLEQDRVVTAAIIETAADG
FT                   SQRTRRTWLVNPGVEIPPEAVAIHGISTELAVADGIPAPVAVAEITDLLEQVLQSGTPL
FT                   VIMNAPFDLTILDRECRRYGVVPLSERLDTVAPVIDPLILDRHIDRYRRGKRTLEALCA
FT                   HYGVPYDGSHEASADAVAAAAVARGIGHAAAHVAALSPRELHELQVTAAAQQAESLAAF
FT                   LRRKGLSPERVTRAWPLVPVPGTQPKLI"
FT   gene            207217..209025
FT                   /locus_tag="Tfu_0184"
FT   CDS             207217..209025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0184"
FT                   /product="BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54222"
FT                   /db_xref="GOA:Q47TJ2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54222.1"
FT                   /translation="MHRACRGGGATPRQDVVVRPTHGSSDTTTNSADNQDLLWEPPPVL
FT                   EAERPPRTDWAVFLTAAAFTLAFVAWGAISDETLAQVAENLLAGLMRYGGWAFVLVAGV
FT                   FVVFALWLAFSKYGQIPLGREGEEPQYTTVSWVAMMFATGMGIGLVFYGVAEPLAHYVT
FT                   PPPGTDAASESQRTLTAIATTLFHWTLYPWGIYAVVGLAIAYTTFRRGHSQLISAAFIP
FT                   LFGERAAKGPLGKAVDVIAILATLFGSACSLGLGALQIAGGFQTLGWTSQTTFGLLFLI
FT                   IAAIMACYLVSAVSGIARGIKWLSNTNMVMAVLLLVFVLVTGPTVYILDLVPGAVATFF
FT                   QDFFEMAGRTQAVGGNTAEWLSTWTVFYWAWWISWTPFVGLFIAKISRGRTIREFVAGV
FT                   IVVPSVVSLIWFVIFGCTAIHFQQSGVDLAASNQIEAQFYGMLQNLPWSGVVNVVLAVL
FT                   VAIFFITGADSASIVMGTLTQGGVDKPRLAMTVLWGMLIAAVAAIMLLVGEGGSTAIDG
FT                   LQNITILGAAPWAIVMLLLCVALLKGLRRDPLAVRERKARELMDEAVITGARTYGESGF
FT                   QFPVAPARREEAPPPPRKGDGDASET"
FT   gene            complement(209081..209806)
FT                   /locus_tag="Tfu_0185"
FT   CDS             complement(209081..209806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0185"
FT                   /product="preprotein translocase YidC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54223"
FT                   /db_xref="GOA:Q47TJ1"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54223.1"
FT                   /translation="MFGLFSAFLAAAHALTMAVHSTLAVFLGPVSAAATIAFLTLAARV
FT                   LTLPLSYLQVRGEKIRARLAPQLYALRERYGHNPERLVAKTRELYAREGASPFAGCLPA
FT                   LAQAPMFTLLYTLFTVPEIDGSANALLALPFAGTPLGSTLPRILASGDLGALPVFAALL
FT                   AALAAVAWANRRWLTLPALSAAPAAGQPTPVPAFVTYLPFLTVVIAAFVPLASGIYLVT
FT                   STTWTVVERLTLRRLVRVD"
FT   sig_peptide     complement(209708..209806)
FT                   /locus_tag="Tfu_0185"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.639 at
FT                   residue 33"
FT   gene            complement(209915..210253)
FT                   /locus_tag="Tfu_0186"
FT   CDS             complement(209915..210253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54224"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54224.1"
FT                   /translation="MSTDRQKDPVRIPTGGAVAFLIFLAQSFLVGVDSVPLDPASLTVA
FT                   ATLAVGAALLWLALPARPVRTESATEPYARTSALRRWQQRVGVVVSAAPNVPGKPRSRA
FT                   PGAAATAA"
FT   gene            210474..210806
FT                   /locus_tag="Tfu_0187"
FT   CDS             210474..210806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54225"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54225.1"
FT                   /translation="MFATLAPTVDTAVHRAAGRTVRPVTICYESGHRQVCAAPAHRLRR
FT                   DQGGVVAVETSADTGFVLYAGTACHPTLAVGSGRGRTEFAAPICAATILIEDAAPRADR
FT                   IPLRVR"
FT   gene            complement(210803..211435)
FT                   /locus_tag="Tfu_0188"
FT   CDS             complement(210803..211435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0188"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54226"
FT                   /db_xref="GOA:Q47TI8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54226.1"
FT                   /translation="MDFADLFAGQQVMAILRGLSAQDTVAHAHRAWDLGIALVEVPIQS
FT                   PDALPALRAAVAAGRSRGRPVGAGTVTTPDRVAAAADAGAAFTVAPGFDGEVLAASLAA
FT                   GLPHLPGVATPSEIQQALRHGATWLKAFPATVLGTGWFAAMRGPFPEVNLVATGGVSAH
FT                   NAADYLAAGARAVAVGSALADETQWEALAALAASSTGPWGSGSGPAA"
FT   gene            complement(211440..212459)
FT                   /locus_tag="Tfu_0189"
FT   CDS             complement(211440..212459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0189"
FT                   /product="putative PfkB-family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54227"
FT                   /db_xref="GOA:Q47TI7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54227.1"
FT                   /translation="MTETDSYDVICIGETMGQLSPASAVPLVEQPPLLPRIGGAESNVA
FT                   CGLAGLGHRVAWMSRVGDDPFGAIITRTLARYGVDTSLVEVDQERPTGLYLKDPAPKGT
FT                   RVYYYRRESAASAIGPRLAERPELRTARLLHLSGITPALSTSCAAFVQRLFVSRPAHGP
FT                   LLSFDVNYRPALWPADDAAPVLLDLARAADLVFVGRDEAEQLWQASTADQVRALLPDVP
FT                   LLVVKDADVGATSYTGARRVFVPAPRVDVVEAVGAGDAFAAGFLSGLLDDRTPEECLRL
FT                   GHIMAAATLLSVADLAPFPPREARERLLALSPAAWAALCIPDPDLFPLDPSDPLFSGA"
FT   gene            complement(212622..213329)
FT                   /locus_tag="Tfu_0190"
FT   CDS             complement(212622..213329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0190"
FT                   /product="similar to Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54228"
FT                   /db_xref="GOA:Q47TI6"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54228.1"
FT                   /translation="MIRRDTPICFLYPSSQCPCVSVGSVIPFHTTNVSFVYISREDTML
FT                   CNEGFGRSPRGNASRLIGRAATAFSALALAATISVANATPVTGAAHRVDPAADSSQEDQ
FT                   HVRSGKGSGKGSQSIAQEAVRYAESKIGAPYRWGAAGPDAFDCSGLVQWSYRQVGVTLK
FT                   RTTYDQATQGKPVSRSQLRPGDLVFFYSGPSHVALYVGDNQIIHAPGSGKTVQIVSMSG
FT                   HYEENFNSARRVV"
FT   gene            213732..214541
FT                   /locus_tag="Tfu_0191"
FT   CDS             213732..214541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0191"
FT                   /product="similar to N-acetylglutamate synthase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54229"
FT                   /db_xref="GOA:Q47TI5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54229.1"
FT                   /translation="MAGRRPWSQPIPKVLRAGTGIVRPWVQGEAEDRGKGAAEPQAKTA
FT                   EPARVRKRAAPLHHPGRGRCRGGRERAPVQRISPAHSMARSMTGTVPTGTDRYPCMPQY
FT                   GASSGISPLWATISEAMIIREATRSDLGAILRLLRELGEEAPAQGGTVRMSSATVRAWT
FT                   RIENDPERTVLVAERRGQIIGTLDLIMIANLTHDAQPWAVIDNMVVDAAYRRTGIGRAL
FT                   VEEAINRAIQAGCYKIEMLTHESQGSAYEFCRAMGFTIATEGFRRYL"
FT   gene            complement(214616..215782)
FT                   /locus_tag="Tfu_0192"
FT   CDS             complement(214616..215782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54230"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54230.1"
FT                   /translation="MNERIPEIFPNLLREDAFPTVRKGGYDKRQVDDFVVRNHNQLRDL
FT                   QERLARAHDELEQLRRELAEAKAKAAVKPEHEQISERLANILRIAEEEAADKRAQVDKE
FT                   VKEIRAKAEEEAKAKIKSAQEQAERIVNGARDEAKELLTSTKQEAERLREEAAKEAERK
FT                   LNEAEARANKIHDVADRRLKRLVATHGEAVRRLNDMRDTLAELLKAEAKAGALDAGLKR
FT                   SDFEGSTDKESASAASSKQSSPQAAEPEGAANAQRPASPDNEPTARLNPADKEPTARLN
FT                   PASSGAAADGKAENQVKSAPAAQGARPIPGRPQGFRYAGPAPTDAGSSPTPPPPSTELT
FT                   GVYQASVPADSASSADSGSSAGSSNAGSSAGSSDSGSSGGSDSSGGGF"
FT   gene            216044..216661
FT                   /locus_tag="Tfu_0193"
FT   CDS             216044..216661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0193"
FT                   /product="similar to Carbonic anhydrases/acetyltransferases
FT                   isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54231"
FT                   /db_xref="GOA:Q47TI3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54231.1"
FT                   /translation="MGDCARAWTVSVIFAVRTCLWVGGDAMSGSGERPHIGSAEFGEPT
FT                   IHPDAWIAPGAVVVGRVRIGAHSSVWYGSVLRADTEDIIVGERCNIQDLCCLHADPGEP
FT                   AILGNGVSLGHKAMVHGAVVEDGALIGINAVVLGGATVEAGALVAAGALVPPGRRVPAG
FT                   TLWAGVPGKVIRELTDAERENLVGTAERYVGYAAQHRGVTWR"
FT   gene            218298..218522
FT                   /locus_tag="Tfu_0194"
FT   CDS             218298..218522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54232"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54232.1"
FT                   /translation="MDIDPHVPLHDAVALAEIDLYTDVLAAVGEADAPLTTDELDRVLG
FT                   LRPRTAQSASPMRLVLDEPVSQETPELSC"
FT   gene            complement(218961..221111)
FT                   /locus_tag="Tfu_0195"
FT   CDS             complement(218961..221111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0195"
FT                   /product="putative iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54233"
FT                   /db_xref="GOA:Q47TI1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54233.1"
FT                   /translation="MLYLILGIITTAFAVVGVAVWAYGISRMVRILRIGRPVEAARKAD
FT                   FGRRITNTLIETLGHTRMLKWRWIGIAHWFIMVSFPALVFTVAEAHGEVWDPHFQLPLI
FT                   HDWTIYGLFIEAIAALSLAGIVGLTIYRQLRGPRVLGRKSRFANSKHWTAYYVEAYIIA
FT                   LLVSIFVIRGVKVAMGDFPFPVWATPISHAFGAILPANEYLLASVAAFKLIISWLFFIA
FT                   IGVFLTMGVAWHRFTAPVNIFFKRNADGSAALGPAKQMLNKDGEPLDFEEADPDEDPFG
FT                   VGKIEDFTWKGLLDFTTCTECGRCQSQCPAWNTGKPLSPKKLVMDLREHAYAKAPYLMQ
FT                   GITEETPDIHEDVLALLSRPLVGTEEENGVIHPDVLWSCTNCGACVEQCPVDIEHIDHI
FT                   LDMRRYQVMIESSFPSEANTLLKNLENKGNPWGMSESKRMDWISEVDFEVPVVEDKLPE
FT                   GTEYLFWVGCAGALEDRAKKTTKAVAELLHIAGVKYAVLGGMETCTGDSARRLGMEFIF
FT                   QMLAQQNIETLKEVGATKIVVTCPHCFNTIGNEYRDLGGDFEVVHHTKLLAQLVKEGRL
FT                   APIERVDRNVTYHDPCFLGRHNKIYEPPRELINGVPGVSATEMPRNRERSFCCGAGGAR
FT                   MWMEERIGKRINTERVEEALSTKADLIATGCPFCQVMVSDAVNEKKSKKEAAESVEVMD
FT                   VAQLLLQSAKQKEEGEAAKETV"
FT   sig_peptide     complement(221043..221111)
FT                   /locus_tag="Tfu_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.847) with cleavage site probability 0.791 at
FT                   residue 23"
FT   gene            221550..223391
FT                   /locus_tag="Tfu_0196"
FT   CDS             221550..223391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0196"
FT                   /product="Heat shock protein Hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54234"
FT                   /db_xref="GOA:Q47TI0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54234.1"
FT                   /translation="MARAVGIDLGTTNSVVAVLEGGEPTVIANAEGARTTPSVVAFAKN
FT                   GEVLVGEIAKRQAVTNVERTIRSVKRHMGTDWKTHIDGKDFTPQQISAFVLQKLKRDAE
FT                   AYLGEEVTDAVITVPAYFSDAERQATKDAGKIAGLNVLRIINEPTSAALAYHLEKEGEA
FT                   TILVFDLGGGTFDVSLLDVGDGVVEVKATHGDNHLGGDDWDQAVVDWLVERFKSSNGID
FT                   LSKDKMAMQRLREAAEKAKIELSSSTETSINLPYITASAEGPLHLDEKLTRAEFQRLTS
FT                   HLLERTKGPFFQVIKDAGISVDQIDHVVLVGGSTRMPAVVDLVRELTGGKEPNKGVNPD
FT                   EVVAVGAALQAGVLKGDVKDVLLLDVTPLSLGIETKGGVFTKLIERNTAIPTKRSEIFT
FT                   TAEDNQPSVQIQVYQGEREIAKYNKKLGVFDLTGIPPAPRGVPQIEVTFDIDANGIVNV
FT                   TAKDLGTGKEQSVTITGGSALPKEDIERMIREAEEYAEQDRKRREEAETRNNAESLVYQ
FT                   TEKVISENEDKIPEDVKNETKEALDGLKKALEGSDIEAIRSASEKVALASQKIGSAIYS
FT                   QSQQASGAAAGGQQNAEDAEVVDAEIVDEEPKREGNS"
FT   gene            223425..224219
FT                   /locus_tag="Tfu_0197"
FT   CDS             223425..224219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0197"
FT                   /product="similar to Molecular chaperone GrpE (heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54235"
FT                   /db_xref="GOA:Q47TH9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54235.1"
FT                   /translation="MAVPENEHSTDKQGPVIRDKRRIDPETGQPRVPEGEAASPSEDSA
FT                   AAAAESTTAQPTDEENAELIRLRQEVAERTDDLKRLQAEYINYRKRVDRDRAAMREQAL
FT                   VQVLTELLPILDDIGRARQHNELVGGFKSVGEALESLVARMGLKKYGEKGDEFDPTVHE
FT                   ALSMVPSTDVTVPTVIEVFQPGYLIGDRVVRPARVVVAGPAEEDTSASEEEKKEEAATE
FT                   EAAAPSESDDEAKPAEASESAEAAESTEQSDATADKNTADEQ"
FT   gene            224240..225454
FT                   /locus_tag="Tfu_0198"
FT   CDS             224240..225454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0198"
FT                   /product="Heat shock protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54236"
FT                   /db_xref="GOA:Q47TH8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54236.1"
FT                   /translation="MSQARAWDTRLSHHWAQSTSGEKQTSMSTKDYLEKDYYKVLGVSK
FT                   TATADEIRSAYRKLARKYHPDANKGDAQAEKKFKEISEAYSVLSDEKRRKEYDEARSLF
FT                   GGAYRPGGGGIGDFNLGDLFGHTTTGGERLTDLFGGLFGGRGRATQSRRGADLETETTL
FT                   SFTEAVSGTTKSFTLTTTVSCPTCRGSGAKPGTTPRVCPRCAGTGHESTNLGGFSLSEP
FT                   CALCKGRGYLADDPCLTCSGTGNVKGTRTVQARIPPGVSDGQRIRLRGKGEPGERGGPA
FT                   GDLFVTVRVTPHPVFGRSGDNLTLTLPVTFPEAVFGAEVRVPTLSGPPVTVRIPPGTRN
FT                   GRVFRVRGKGATRRDGTTGDLLVTVEVAVPQNLNSEAREALQRFQAATADHNPRADLEA
FT                   RAKGA"
FT   gene            225460..225903
FT                   /locus_tag="Tfu_0199"
FT   CDS             225460..225903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0199"
FT                   /product="regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54237"
FT                   /db_xref="GOA:Q47TH7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54237.1"
FT                   /translation="MNDATFGEDTPVYVISVAAELSGLHPQTLRQYDRLGLVRPGRTPG
FT                   RGRRYSMRDIQMLREVQRLSQEEGINLAGIKRILELQREVAELREHIFHLHNELNAARS
FT                   AVAARRASSDHSSSSRSGGELLPVHRTRITIFNRTTTQPPESQ"
FT   gene            226000..228603
FT                   /locus_tag="Tfu_0200"
FT   CDS             226000..228603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0200"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54238"
FT                   /db_xref="GOA:Q47TH6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54238.1"
FT                   /translation="MDYKLTRKSQEALSAAIRRATADGNPQVEPVHLLSALIGQAEGVV
FT                   RPLLKEVGADPGRLSTKVEEEIARLPRASGSTVNAPASSRQLIISLNTAAQRAKQMEDE
FT                   YVSTEHLLVGLAADGGTAATLLREAGATPEALLDAFSRVRGSARVTSETPEDTYQALEK
FT                   YGVDLTQRAREGKLDPVIGRDAEIRRVIQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQR
FT                   IVAGDVPESLRDKRLISLDLPAMVAGAKYRGEFEERLKAVLNEIKQSEGQIITFIDELH
FT                   TVVGAGAAEGAMDAGNMLKPMLARGELRMVGATTLDEYRERIEKDPALERRFQQVMVNE
FT                   PSAADTIAILRGLKGRYEAHHKVQIADSALVAAATLSDRYITARFLPDKAIDLIDEAAS
FT                   RLRMEIDSQPVEIDELQRVVDRLKMEEMALSKESDAASKQRLERLRADLADKEEQLNAL
FT                   IARWEQEKAGLNRVGELKEKLDELRGQAERAQRDGDFEEASRLMYGEIPQLERQLEEAL
FT                   SEEDSAEHATMVKEEVGADDVADVVSSWTGIPVGRLMEGESAKLLRMEEEIGKRLIGQR
FT                   RAVAAVSDAVRRARAGISDPDRPTGSFLFLGPTGVGKTELAKALAEFLFDDERAIVRLD
FT                   MSEYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYTVVLLDEVEKAHIEVFDTLLQ
FT                   VLDDGRLTDGQGRQVDFRNTLLILTSNLGSQFLIDPTLDDAQRHEKVMQVVRNTFKPEF
FT                   LNRLDDVIVFDALSTDDLTKIVDLQVDRLARRLADRRLKLEVTPAAREWLALAGYDPVY
FT                   GARPLRRLVQTAIGDPLARELLAGNLVEGDTVRVDVDESKDSLTVGPVKEPASAA"
FT   gene            228887..229081
FT                   /locus_tag="Tfu_0201"
FT   CDS             228887..229081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54239"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54239.1"
FT                   /translation="MAKNGSWHHNNTNLAGLLGFVAVANGVAGLFFGDTVKIVVLVLTV
FT                   IIVGWAVYQMASNKKAGRA"
FT   gene            complement(229336..229899)
FT                   /locus_tag="Tfu_0202"
FT   CDS             complement(229336..229899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0202"
FT                   /product="conserved hypothetical conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54240"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54240.1"
FT                   /translation="MNDARVVETLGGCRVDGVPVRHGRALELVAVLALAKGSAPRDWLL
FT                   STLFEGDPAPSSLPTLALRARKLGIDVRYDRDRCCYLLAGEVRCDVVEVLELVEEGRLA
FT                   EAVARYRGPFLPKSYSPFAVQMRASLEERLVRAALLSDDVALMASVDRVVKHPELSQEL
FT                   VRRGGDAVVVSLSRSWLAGLEAAI"
FT   gene            230236..231198
FT                   /locus_tag="Tfu_0203"
FT   CDS             230236..231198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0203"
FT                   /product="similar to Coenzyme F420-dependent N5
FT                   N10-methylene tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54241"
FT                   /db_xref="GOA:Q47TH3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54241.1"
FT                   /translation="MTDYSVLVPFLPRRPEQLLPYAALVNWTRAERLWQGQALLIEPHQ
FT                   GFAYAAGAGFRVPAGLGVTLMPFRHPYEAALQARSLAMATGHPAIAGFGPGARSLQQGI
FT                   LGAPYRSPLTAAREYLTAVRALLSGKVVRLDGEYFTVHAQLPPAAAPEVKLGLGVLRPG
FT                   MAGVAGELADVAITWLTPAAYIRDTLLPAIRKSAVEAGRPAPTVTAIVPVALERPGTDP
FT                   AEVALASNAAHLQGPHYLDMLRRAGVHVHGSSPQDAARALIKGGAFVSGDLDTVCAELD
FT                   RYREAGVDEVVLNVTGVYKACGHQAAMDDLKQILAAVTR"
FT   gene            231243..232298
FT                   /locus_tag="Tfu_0204"
FT   CDS             231243..232298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54242"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54242.1"
FT                   /translation="MMDKTELRRIKRHLMSWSTGQFEVGLANQDSCSTIVVADPAHLAD
FT                   LLDTDLVGDNTVVLAPEGHGADPSRVVGFAGTLDEPNAEMSIGYDFFLQTQDYATSPFM
FT                   SVLGPTLVRVTGPDDLELFLADADRAREEGVFPDIAVVPAVRIADLPGLGAGPGVDGPQ
FT                   LRLYVNAEGEISTSIGGCSLGRVGDTLASLRANWDRRNAASTAPCAVCLRAVLPEADRT
FT                   RELLARPWLGRYLAAVDGLRMLATREIVGLRVSGFGQRLNPALDHHPDSADAATPLLFW
FT                   NDESGYVYEPASGRTFQVNLAAATAVEALLVTGSAEQASEYASPRSLAAVDRFFTESGV
FT                   TLTGIGSEVAV"
FT   gene            232298..233101
FT                   /locus_tag="Tfu_0205"
FT   CDS             232298..233101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54243"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54243.1"
FT                   /translation="MAATTLLPPGRAGQLVAELGDRARLCDLYGPHGAPIYHDMSLRDT
FT                   GEVRHLVGLVRPHPGPVLDLAAGSGRITLPLLALGREVTALDLSADMLALLRQQLDRAP
FT                   AHLRERCTVVQADMADFRLPRRYAVIVLGTTSISLLDRAGRAGLYRCVAEHLADGGRFF
FT                   LTTLDRGADSPEEEVEITATGASGTAYRLYEHWPAGADVRTITVLPSELPDGPVPVCTG
FT                   HVRVLPPDRLAAELTQAGFTVQQRRTPLEDAGRHRVTLIEAEIQR"
FT   gene            233098..234393
FT                   /locus_tag="Tfu_0206"
FT   CDS             233098..234393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0206"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54244"
FT                   /db_xref="GOA:Q47TH0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54244.1"
FT                   /translation="MSHTTSTALWPYLLPPSAHGDDSICAVSARGHRVRFADGRELLCG
FT                   ASGLWNANLGYGNPAIAQAVAQALHDASYLSAFRYENVYARRAAADLIEVSGPEHYSRV
FT                   LFSSSGGAANDAAMKVARHYHALLGRTRRSLVVSLRGSYHGLTFGGFALTGEDLGQRLY
FT                   GVDQRLVRHVRPNDTAELNALVSRAAKQIAAVVVEPVVGTGTIPLTDEYVAELLRLRAE
FT                   HGFLLIADEVATGFGRTGSFFASQRWPEQPDLLITSKGLTNGTCPASAVIVSQRVADAF
FT                   TEHDAVLSHAETQGATPLTCAAISATIAEMRRLDAVAAGQALGEKLGAGIAELMAEMPQ
FT                   IIGTTGVGCFRSLRIADASGAPLPQHRVPALVAAIRDAGAIVHPGPSGVQLVPALTYSD
FT                   AELAELLDCVRRGILLMSSLSAPGGRWLRGCR"
FT   gene            complement(234281..235642)
FT                   /locus_tag="Tfu_0207"
FT   CDS             complement(234281..235642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0207"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54245"
FT                   /db_xref="GOA:Q47TG9"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54245.1"
FT                   /translation="MLGPLQVEGPSGPIRIPPGRQRIVLAALLLEVNRQVSTDYLVDAI
FT                   WEHDPPETARTQVQICVSRLRRLLAPTGAAIETRTPNYLLRVNPLTVDAQVYSQRVDEA
FT                   RDLSNHGRISEAAALLRSAAGLWNGPALDGVPSRILRAKAARLDEDRLTTIETYLDLEL
FT                   QLGRHSQLIGEITELVEQHPLRERLRSQLMLALYRSGRQAEALEVYRTGRELLIKELGL
FT                   EPGDELRSLEAAILAGDPALRPADPPAPAAPPEPPPSSPTRGVTPYQLPTDTADFVGRT
FT                   EALETIRTTLLNSDGAVGVAVLLGRPGVGKSATAVHAAHQLAADHYPDGQLYCDLRASR
FT                   GAPLPPSDILGRFLRALGVPGQAIPDDPDERAAMYRGLLATRRVLVVLDDAVSESQVLP
FT                   LIPGGRGCGVIITSRSRLTGIPGATCLRARLTSSSTGFRGGRSPAVQPVQRRCR"
FT   gene            complement(235958..236392)
FT                   /locus_tag="Tfu_0208"
FT   CDS             complement(235958..236392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54246"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54246.1"
FT                   /translation="MRSPSESPKKRDAFGRHQNARNGAAALFPTRVVKPAPGNQQTTIR
FT                   DCKNINEIFLGLVAVLEDARHGHIHAFRDDPAHPVPARPAGPGRQRDSPFPAADGRHPG
FT                   KPHVNVFVQQRSTSVLVTAVQIEVEEPCMLDSDHGDASAG"
FT   gene            236555..237076
FT                   /locus_tag="Tfu_0209"
FT   CDS             236555..237076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54247"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54247.1"
FT                   /translation="MRARQVLRREGDTPRRHHHEFTNVVLRAITFHLGPRFFTLARDRQ
FT                   LAEGLRGAWQRTGDALPAEQRLSSAGLTTIFTVCGTLEAAVVVLPQPMRPGEAYLVCGI
FT                   RDNDPFHGPGDPDFYVLEADRTFRGSSTEPRTRLIRWTRDGRNLDLGEGPLPEVGAMLD
FT                   AIIRVMSIGS"
FT   gene            237191..239014
FT                   /locus_tag="Tfu_0210"
FT   CDS             237191..239014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0210"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54248"
FT                   /db_xref="GOA:Q47TG6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54248.1"
FT                   /translation="MTHYKSNLRDLEFNLFEVFNRQEIMGSGPFEDFDEDTARDILAEV
FT                   NRLATGVLAESFADADRNPPVFDPKTHSVTIPESFKKSYQAYMDAEWYRLDLPPELGGS
FT                   GAPRSLVWAVAEMILGANPAVHMYSAGPGFAHVLWQEGNEQQKKFAKLAIERGWGATMV
FT                   LTEPDAGSDVGAGRTKAIKQPDGTWHIEGVKRFITSAEHDMAENIFHLVLARPEGHGPG
FT                   TKGLSLFLVPKYLVNEDGSLGERNGVYVTNVEEKMGLKVSTTCELTFGAKHPAIGYLVG
FT                   DKHDGIRQMFLIIEYARMMVGTKAIATLSTGYLNALAYAKERVQGADLTQQADKTAPRV
FT                   TITHHPDVRRSLMLQKSYAEAMRALVLYTATFQDAVQIATARGEDPAEYEAMNDLLLPL
FT                   VKGVGSERSYALLAESLQTLGGSGYLQDYPIEQYIRDSKIDTLYEGTTAIQGMDLFFRK
FT                   IVKNNGQALGKLMGEIQEFAKSDPGNGQLKNECALLAQAAADVQAMVESMVGNAMRSME
FT                   EPREIYKVGLNTTRLLLSLGDLVLGWLLLRQAEIALARIDGADDNDRNFYLGKIAAARF
FT                   FADQVLPRLSVERAIAERTTLDLMDLPEEAF"
FT   gene            complement(239062..240729)
FT                   /locus_tag="Tfu_0211"
FT   CDS             complement(239062..240729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54249.1"
FT                   /translation="MPQGCTAPSVRSAAAPRDCRDPGRAPGVGLRRSVFRSHAGTQFAD
FT                   WSGLQDACHGRGGRGRHSCTPASDPRPGPAVPAFPACGRLVCAGNSAVACDSGHGPVLP
FT                   FSARSLVRAAHPGLACRTMAAQSSRSSRTPRRPAPPATGTSSRVAVIAMAVLCVTAIAA
FT                   CAILLSYNGIFQIALRGGVTGWAAHLYPGMFILLLLMAFWAIYLLRDAPRRRRIWVDLL
FT                   VLAMILAAAGASALHSLHYELVEWAATLVVAGGPWLALLISFRLLLWIVAQVRGERVAV
FT                   AGEPAAEEPAAGPAPDSPAAPAVEEEPVAVDSGSPAEPPTEPLAVLPRTETSPAATAAP
FT                   SSSEETAPLVSSTPAPRPAAADISAEADLGDDTVRPAPAEQSTAPPEPDRAADERGSLP
FT                   KRVPPAEGSAIRRAAEPSDRPPAAVADEPAELSAGSAVDAELDDADWESITDAEDDWET
FT                   GDTPLADDPSEDETHSEPAEVAAAPQAAPRSSAAGAPHPVSREEAAADDAASVPEQSPP
FT                   PAPRLRRRPIVLRPRRSSPPPLRPPSSEVRSSPTPPEE"
FT   gene            240817..242217
FT                   /locus_tag="Tfu_0212"
FT   CDS             240817..242217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0212"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54250"
FT                   /db_xref="GOA:Q47TG4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54250.1"
FT                   /translation="MSLRFYDTRTRQVRDFVPLREGCVSLYLCGATVQAPPHIGHIRSG
FT                   VSFDILRRWLMYRGYRVIFCRNVTDIDDKILNVAASEGVQWWEVSERNYRAFAEAYDTL
FT                   GCLPPTVEPRATGHIPEMIELMRRLIDRGHAYVAEDGSGDVYFDVTSYAEYGSLSNQRL
FT                   EEMRAAEDGDARAKRDPRDFALWKGARPGEPSWPTPWGPGRPGWHLECSAMATKYLGPT
FT                   FDIHGGGVDLVFPHHENESAQSRAAGDGFARYWLHNGLLTTGGEKMSKSLGNSLLIPEI
FT                   TRRVRPVELRYYLGQAHYRSNLDYSEESLREAASAYQRLENFLVRVNEIAGPIPDDVPV
FT                   PEEFAAALDDDLGVPQALAVAHNHVREGNSALAEGAKERAAQIGARLRAMLAVLGLDPL
FT                   SPQWAGSDDSGLHDVVDSLVSVVLEQRQEARKRKDYATADRIRDQLAEMGIAVEDTPQG
FT                   PRWELKRS"
FT   gene            242293..243267
FT                   /locus_tag="Tfu_0213"
FT   CDS             242293..243267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0213"
FT                   /product="RNA methyltransferase TrmH, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54251"
FT                   /db_xref="GOA:Q47TG3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54251.1"
FT                   /translation="MPSKRTKKGPTKGSGGKGRRALAGKKATLPAEKRHWYAEKQRIKA
FT                   AERAQYLATRKVRVVEELPGATVRARDGSELLIGRNPVVEALRAKVPAVRLLLSNSLDP
FT                   DERITEAARLAGQQGIAIAEVARPELDRRCERLGLPKAAHQGLILQVEPYEYATADDLL
FT                   AEARKGETTPLIVALDGVTDPHNLGAIARSAAAFGAHGLLVPERRAAGVTTAAWKASAG
FT                   TLARIPVAQVVNLTRTLKQFQEAGFFVSGLDADGDTPLDQWELATEPSVVVVGSEGKGL
FT                   SRLVRETCDVVVSIPIHGVESLNASVAAGVALYEAVRRRTAAK"
FT   gene            243307..243382
FT                   /locus_tag="Tfu_R0007"
FT   tRNA            243307..243382
FT                   /locus_tag="Tfu_R0007"
FT                   /product="tRNA-Thr"
FT   gene            243597..244430
FT                   /locus_tag="Tfu_0214"
FT   CDS             243597..244430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0214"
FT                   /product="similar to Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54252"
FT                   /db_xref="GOA:Q47TG2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54252.1"
FT                   /translation="MVRCRVPGHRRPALHAPDTPERYTFDPVTDWADVTRAHIRGWLAC
FT                   LFARGYTDSYVNNQYRCLQQFFRWFAEDEEVPNIMLGMTPPRVAEKPVPVFSDDEIRAL
FT                   FATVQGRDIWSRRDLAILLFLRDTGVRLSELSGLQLDDVDVVEREATVTGKAKRTRTVK
FT                   YSFEAARALDKYLRMRAKHAHAHVSAVWIGPKGPLTDSGIYQLVQRRAAQAGLQGVHPH
FT                   RFRHHFSHTWLDRGGAEGDLMELNGWNSPQMLRRYGRSAAAARARRGYDRIMGSQ"
FT   gene            complement(244532..244714)
FT                   /locus_tag="Tfu_0215"
FT   CDS             complement(244532..244714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54253"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54253.1"
FT                   /translation="MHSFHIEWRKSSFSQNENCVEVADLPGATAVRDTQHRDLMLLFPS
FT                   AEWVAFVKAAKRDLL"
FT   gene            complement(244725..245561)
FT                   /locus_tag="Tfu_0216"
FT   CDS             complement(244725..245561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0216"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54254"
FT                   /db_xref="GOA:Q47TG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54254.1"
FT                   /translation="MASPTVRRRQLSAILREMRKASGLSLDAVAARLEWSRAKVGHIET
FT                   GQRKKPSVLEVKALMAEYGVTPEDPRYETVLMLTRQAQARGWWRRYDDLFPGSYIELEA
FT                   EASEIRTYEAFVVPGLLQTPGYTRLLQQARLDRDPDDVERAVESRRKRQEIFDRTSPPA
FT                   VYAIIEEHALERLRGTPDVLAEQVAHLLHMAGRNSVTLQVLRTRVGVHAGAMGPFVILD
FT                   FPEPASPVVYLETYTDGLFLERREEIDQYRSLWDRIRDAALPPDRTVEFLRSLLTL"
FT   gene            245764..246144
FT                   /locus_tag="Tfu_0217"
FT   CDS             245764..246144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54255"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54255.1"
FT                   /translation="MLRVLLASLLICAAALLMPAPASGHSRAGRVSRQATPAETPRRQA
FT                   RIIPQRIPNYAEFAACAEQHSALWEITYEYGNPRPYTARNRVTGHTVAVDDLDLLDHIL
FT                   GTYEPPHPVRGYYGQQVVGGGA"
FT   sig_peptide     245764..245838
FT                   /locus_tag="Tfu_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.789 at
FT                   residue 25"
FT   gene            complement(247073..247345)
FT                   /locus_tag="Tfu_0218"
FT   CDS             complement(247073..247345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54256"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54256.1"
FT                   /translation="MDGDPYDLTDANLELLIKPAADTPDDGPGVVVLSTGTGEITITDA
FT                   AGGAATAEVSRTALADPGTRVWRVDVVRPGSRRTAMYGPLHVVNL"
FT   gene            247449..247931
FT                   /locus_tag="Tfu_0219"
FT   CDS             247449..247931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54257"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54257.1"
FT                   /translation="MRTAPPAHAQPASGSCSLRAQEESTVCRVSRFFPAAGEPGKPARQ
FT                   ATAAAGVPERAERARSVLSQRGLGAEADAAQSAPQRRSDEAGGAGTVFRGAHEPWSAPD
FT                   DRAEARGRSAGLLSSAWRESMRGGLQLCRMAPELPLPRGVLLWRLVDAGRAQPPAQ"
FT   gene            248360..249379
FT                   /locus_tag="Tfu_0220"
FT   CDS             248360..249379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0220"
FT                   /product="putative secreted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54258"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54258.1"
FT                   /translation="MRDGEWVADTGTELRGILKVMVDVGWLPGGVAVVGSGEVWENVAV
FT                   GRVGVECGEAVAAPDTRYDAAELTKVMATWPLVGQAIADGLLDLDAPMAHYFPGSYPGS
FT                   KVTIRQILTYTCRLSPVTWLERYVGTDQPLAEAILVEELEKPGYCVTDRGFILLGLLLE
FT                   RVRRQSLDQLATDLWRHMGLSATRYGPLPRSPSVAPTERRIPGAPATWGVVHDENAALM
FT                   GGVAGHAGVFTTIIDLGIFARELLAWHAGEHGTAQLTGFVRQSWLPHQPVDDRFARGLA
FT                   WKVTDDGLVYHNGSTGTSLFLHPSTGRYIGLLTNAIHYGRRCPGLSDLRATIRAVFTY"
FT   gene            complement(249369..250619)
FT                   /locus_tag="Tfu_0221"
FT   CDS             complement(249369..250619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0221"
FT                   /product="similar to Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54259"
FT                   /db_xref="GOA:Q47TF5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54259.1"
FT                   /translation="MCTTRGWTPAALALCSALAVGLSAAPAAADVSDLRLEQWGLDMVG
FT                   AAEVWEEAQGSGVTVAVLDTGVVTDHPDLKDVTVGPDFTGHDLSSDSDGYGIHGTMMAG
FT                   IVAASGHGVEHTGGVMGVAPEAEILAIRITAEPDGPDRDSVDPGALAAGIRYAVDEGAQ
FT                   VICLPLAGAEFSVQANEADQEAIAYAVNHGVVVVASGGPLGEASYPAAYPGVLAVGSVG
FT                   PDGSLSEFSSRGDHIAVTAPGEEITVVDPDGGYTTVSGSDAAAAFVAGVAALIRGEFPQ
FT                   LKPEQVVEAITSGAQAADPAAAGQPGYGAGVVNAPDAFTTAKSTADHVPPFDPELAEQL
FT                   EEEPLIPYWMLWTGGAVLLIVAAVVAMVVAHRRAADPYGFGKRKPEEPEEPEPVPTARR
FT                   PVRGRRRRGRGRRGVSR"
FT   sig_peptide     complement(250530..250619)
FT                   /locus_tag="Tfu_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 30"
FT   gene            complement(250690..251535)
FT                   /locus_tag="Tfu_0222"
FT   CDS             complement(250690..251535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54260"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54260.1"
FT                   /translation="MTDHGGYTCLTFLTDYGTQDGFVAACRAQMLRHAPGLPVIDITHD
FT                   IPPGDVRRGATVLADTVPEFPAAVHIGVVDPGVGTARRSVALAAGGHVLVGPDNGLLVW
FT                   AAEALGGIDTAVELTNESLWRHPVSRTFHGRDIYAPVGARIAAGLPLSEAGQALDPAVL
FT                   VRLSAPLRDVSGGVARGEVHAIDRFGNCQLSLHPEDLRSVVAAPGLPDRVAVRLPDGSH
FT                   TVAVAATFGAVPLGEPVLLTDSAGLLALAVNGGSAAQRFGLGVGAPVVLSRTSSEPMKE
FT                   "
FT   gene            251609..251926
FT                   /locus_tag="Tfu_0223"
FT   CDS             251609..251926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54261"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54261.1"
FT                   /translation="MADSGSQAPDPSDHGLPRSDTPSALDERDQRILAFERQWWKLEGT
FT                   KEQAIRDEFGFSPTRYYQLLNQIIDRPEALAFDPMTVKRLRRRRSERQRQRVARKLGIQ
FT                   L"
FT   gene            252001..252876
FT                   /locus_tag="Tfu_0224"
FT   CDS             252001..252876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0224"
FT                   /product="trehalose-phosphatase:HAD-superfamily hydrolase
FT                   subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54262"
FT                   /db_xref="GOA:Q47TF2"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54262.1"
FT                   /translation="MRAVSGIPPAFSPPSGKPSMSLLQSTTQSGKVALDRIRDMPDRAV
FT                   CAFDFDGTLAPIVPDPRDSRAHPGAVPALRALAGRVRAVAVITGRPAQTAVDYGGLDAV
FT                   PGITVLGHYGRERWEDGKLTVPEPPPGVAMVREALPGLLDEVGAPEGTWIEDKKHALAV
FT                   HTRRTADPEAALELLRAPLADLAKRAELAVEPGRMVIELRPPGVDKGAALTDLVTRLGA
FT                   EAVLYAGDDLGDLAAYDAVERLREQGVAGFKLCSGSAEVTELARRADAVVPGPEGVVAF
FT                   LEELVAAVGG"
FT   gene            complement(253119..254558)
FT                   /locus_tag="Tfu_0225"
FT   CDS             complement(253119..254558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0225"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54263"
FT                   /db_xref="GOA:Q47TF1"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54263.1"
FT                   /translation="MDKAQILVASNRGPVSFSIGDDGAVKSRRGGGGLVSGLSSVATEI
FT                   ETLWVCAALSDADRKAAAAAPEGRLDKAGYDVGGASVRMLNIPADVFNNAYNSVANSTL
FT                   WFVHHMLYDTPNKPSFGSRFRAEWEDYRAYNSAFAEALLTGADEGAKVAVQDYHLALVP
FT                   KMLRVRRPDLRIAHFSHTPWAPPEYFRMLPADIGRELLEGMLGADHLGFLSVRWADAFL
FT                   RCCEVFLRAPVNWGTRTVEHGGRVIRVGVHGLGADAQGLRERAAAEDVARWRERLRERV
FT                   GDRKLIVRVDRTELSKNIVRGLEAFGELLRKRPEWRNRVTHLAFAYPSRSGVAEYRAYT
FT                   ESVRATAEAINAEFGTDDWTPVVLEVNDDYPRSLASYQIADVLLVNPIRDGMNLVAKEG
FT                   PVLSLNGVALVLSTEAGAADDLGADAILVNPYDVSETAEALHRALTMDEEERRQRTERL
FT                   AEAAAALPPQRWFTDQLRALD"
FT   gene            254958..256244
FT                   /locus_tag="Tfu_0226"
FT   CDS             254958..256244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0226"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54264"
FT                   /db_xref="GOA:Q47TF0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54264.1"
FT                   /translation="MRGERLMALTATESVTSATGSFGSASALSCRECGARYDLGPIFAC
FT                   IECFGPLEVAYDFGTVTRESIEQGPKNIWRYKALLPVPVDVEKLPNMNPGLTPLVKADR
FT                   LAAELGLRSLYVKDDSANPTHSFKDRVVAMAVEAARVFGFTTLSCSSTGNLAGAVGAAA
FT                   ARAGFRSCVFIPAGLEEAKVVMAAVYGGQLVAIEGTYDDVNRFCSELIGDPAGEDWGFV
FT                   NVNLRPYYAEGSKTLAYEIAEQLGWRVPDQIVIPIASGSQLTKIDKGFQELIALGLVED
FT                   KPYRIFGAQATGCAPVARAWEKGYTVVQPVKPDTIAKSLAIGNPADGPYVLDVCRRTGG
FT                   AVEHVSDEEIVDSIRLLARTEGIFAETAGGVTTGVLRKLLAKGVLDPEAETVVLNTGDG
FT                   LKTLNAVSGTGVTATIKPSLSAFKDAGLL"
FT   gene            256314..256592
FT                   /locus_tag="Tfu_0227"
FT   CDS             256314..256592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54265"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54265.1"
FT                   /translation="MSVSVRIPTILRTYTKGQAEVSAEGATLKEVLADLEANYSGIQAR
FT                   ILGDDGAIRRFVNIYVGDEDVRFASGLDTPTPDGVQVSIIPAVAGGC"
FT   gene            256923..258548
FT                   /locus_tag="Tfu_0228"
FT   CDS             256923..258548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0228"
FT                   /product="chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54266"
FT                   /db_xref="GOA:Q47TE8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54266.1"
FT                   /translation="MAAKLIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWG
FT                   APTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGL
FT                   RNVAAGANPIGLKRGIDAAVARISEELANLSKEVETKEQIASTASISAGDPQIGEYIAE
FT                   AMDKVGKEGVITVEEGQTFGLELELAEGMRFDKGYISPYFATDLERMETVLEDPYILIA
FT                   NQKISNNNEFLPVIEKVLQAGRPLVVIAEDVEGTALQTLVVNKIRGTFKSVAIKAPGFG
FT                   DRRKAMLQDIAILTGGQVITEEVGLKLENTELDMLGRARKVVVTKDETTIVDGAGDASA
FT                   IAGRVNEIRAEIERTDSDYDREKLQERLARLAGGVAVIKAGAATEVELKERKHRIEDAV
FT                   RNAKAAVEEGILPGGGVALLQASIAAFEKLELEGDEAIGASIVRRAVEEPLKQIAINAG
FT                   YEGGVVVEKVKSLEPGIGLNAATGEYTDLFKDGVIDPTKVTRSALQNAASIAGLFLTTE
FT                   AVIAEKPEKPAANNAGGDMGGMDF"
FT   gene            complement(258636..259061)
FT                   /locus_tag="Tfu_0229"
FT   CDS             complement(258636..259061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0229"
FT                   /product="putative MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54267"
FT                   /db_xref="GOA:Q47TE7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54267.1"
FT                   /translation="MGAVDSATPAVVDALAWVHVRDGRVLQVRPKGKDVFYFPGGKREP
FT                   GENDAEALIREVAEEVSVQLDPATLQLFTVVDAAAHGYPEGTRVRLTCYTAECTGDLAP
FT                   RSEIAELAWFTQADADRCAPAGVRVLAELAQRGLVTR"
FT   gene            259194..259505
FT                   /locus_tag="Tfu_0230"
FT   CDS             259194..259505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54268"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54268.1"
FT                   /translation="MLAAWAADVGRGRISASAFTDSGDKVFCGDPLEQGYQKCVDQMEL
FT                   FALASLIPAVLALALMVAAFTTPVLRAKPALRAQTLGYSLVAWMIAGGTVLMGWLPAI"
FT   gene            complement(259546..259953)
FT                   /locus_tag="Tfu_0231"
FT   CDS             complement(259546..259953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54269"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54269.1"
FT                   /translation="MNSQWPGPGNPWGDRTASPPPHHPGSGPPGVPGFSWHASPQPGFP
FT                   PPPPAGEPSFPGPPLAKGNAVLALIIAIILTLTCVGITDVIGIVLAAVALSKDEDPEEF
FT                   DRYVRWAWLSNFIHLGFLILLLVLFIMLSTV"
FT   gene            complement(260015..260422)
FT                   /locus_tag="Tfu_0232"
FT   CDS             complement(260015..260422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54270"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54270.1"
FT                   /translation="MSNPPLPPGAADPRDEPLPRARRTAGTQDGDRAEGDAAFRPSGAS
FT                   SSTMALILHALTFLCCGNWLFGILGIVFAVRAAHKRDQGLYTQAETLTRYSWYCLGAGA
FT                   VMLLVMLISFGVLLTQAGSWVEEAISPGVNY"
FT   gene            complement(260468..260734)
FT                   /locus_tag="Tfu_0233"
FT   CDS             complement(260468..260734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54271"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54271.1"
FT                   /translation="MPLRYPVTDPQRSLQPFRAAMPLRPAPARGEPLRSPGDNPHRGHD
FT                   RSRTVLPRAGGARHPPAPSAARAAPRSPRQATGLFGTPPQILM"
FT   gene            261374..261757
FT                   /locus_tag="Tfu_0234"
FT   CDS             261374..261757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0234"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54272"
FT                   /db_xref="GOA:Q47TE2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54272.1"
FT                   /translation="MPTGKVKWYDAGKGFGFLTKDDGGEVFLHASALPPGTTTLRPGQR
FT                   VEFGIVEGRKGTQALQVRLLDTPPSVAKALRKKPDEMVVIIEDLIKLLDNVSNTYRRNK
FT                   YPDRREATKIAKVLRALADDIEL"
FT   gene            261894..262712
FT                   /locus_tag="Tfu_0235"
FT   CDS             261894..262712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54273"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54273.1"
FT                   /translation="MRRTRRSPVPDKACIEAQDLARAAAVEIGRPEWVGEHLGTKVEDT
FT                   RLVTHFFECLNPAYPGWHYAVTVVRAARAKYVTVNESVMLPGPDALIAPEWLPWKERLR
FT                   PGDLGVGDLLPTPEDDERLMPGYAQVPTEETDADGEDQQMLWELGLGRARVLSEVGRQA
FT                   AAKRWYAGPGGPKSPIATAAPAQCATCGFLVPLAGKLRQMFGVCANEYAPDDGRVVSLD
FT                   HGCGAHSEAAVPERTSERLTPVVDEMGYDTIVFDDTSELELVSSDKQARQ"
FT   gene            262990..263649
FT                   /locus_tag="Tfu_0236"
FT   CDS             262990..263649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54274"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54274.1"
FT                   /translation="MRSELFNQAQENDLPGMSLQNPRMLRVVCDGEFYARKGAMVAYQG
FT                   DIDFAHQGSGLGRFTKKMLTGEGLPLMRVFGKGTVFLARDAWEIHILDLEDESITVNGN
FT                   NVLAFEAGLEWDIHRVRGMGIIAGGLFNTVFRGRGRVAVACHGTPVLLNADQMTFVDTK
FT                   AAVAWSTSLTTSLRSTVKAGALIGRGSGEAFQLALEGRGFVLVQASEGGVRAMQQG"
FT   gene            complement(263655..266744)
FT                   /locus_tag="Tfu_0237"
FT   CDS             complement(263655..266744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54275"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54275.1"
FT                   /translation="MSRSSRSVSGMTHTMADPFGVADLRARILDSWAASPARFREDANA
FT                   EDDYALGGYRNRVVVELAQNAADAAQRAGRRGRLVLRLRGREFTAANTGAPLTAEGVES
FT                   LSTLRASAKRDAAAVGRFGVGFTAVASLSDDVVFASRDGAVRWNRDRAAALVHDELIAT
FT                   GRAHPKLAEELARRDNRVPLLRLPFADRTRPPDGFDSAVILQLRDADAGARLALQLAET
FT                   GQALLLALPWLAEITIDTDSHVRSLRSTWEPDGTVTIRSSDASGDHVTRWSTVTRSGQF
FT                   TEADLADRPVEERERRDWSLTWAVALDPASGAAVLPPDVPRVVHAPTPSDDELHVPALL
FT                   IGTFPLSPDRRRIAFGPATDVLLDAAADAYTELLRRIAAPATWDLIPLERLSGDEFDAR
FT                   FRARVAALLPDLPFLQTVTGVSLSPRDAVLVEGGDTLLDVLDGLVPNALPGDTDLHHPG
FT                   VRALQLRRVSLADLADLLTGVDREPAWWARLYAALRAVGQRGAALDNLGALPVPLWDGR
FT                   LVRGPRGLLLPTGEAFTSGILDATALEPLGLRIVHPEAVDPLLVRLGAVEANERAILTD
FT                   PMTRAAVENSLDANDPDLIARAVLELVAASGVTVADEPWLAELALRDADGDYAPAAELL
FT                   HPDSPLVDIFTDDAPFGVLAADLAEAYDTETLESVGVMRLFTVHRAHDVTLGAGLEDSL
FT                   DDLPLDGVDEWAAAVSALLGDPELPPVVPEFVGVRDLEFVREDRWPQALELLSAPGPRA
FT                   AIVEPTRVFTGDGRVVDVPSYTAWWLRTGALLGDRTPSELRTADADPALTGLYDELPVD
FT                   VDPEFARALGVRSRLDDLLADPDGPDDLLERLGDPDRHISRAELRRLWAALADVPPDRV
FT                   TPPDRVRAVHGGSVVVADAEETVVVDAPDLLPLLADRPVILAPVDRAVDLADVLDLDLA
FT                   SEVVAGRVTSTGEARPVPEEVRAFLGTVPLTYLHHGELLVDGAAVEWRCTSGQLHAATS
FT                   DGLARALCWATGQWPRRHLVAALLRDPQSLPLLHAEADLE"
FT   gene            complement(266788..268272)
FT                   /locus_tag="Tfu_0238"
FT   CDS             complement(266788..268272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54276"
FT                   /db_xref="GOA:Q47TD8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54276.1"
FT                   /translation="MSETFRPFPPHLADRLRHALLDADYTVSGVRDRLGDIAARALARE
FT                   QVVPALRATGGEERLGLLLRLWWLGEAVPQTALRSLPLTDLAEAGLLTIRDGQARALVQ
FT                   IKPWELADGRPYYTVSDLTVRPGQGQPRPDHVVGAGGASATLAQLIVDGPVERALDLGS
FT                   GCGVQSLHLAERATRVCATDVNPRALWMTRLSCALSGVDNVETRQGSLYEPVQGERFDL
FT                   IVSNPPFVITPETARYTYRESDLPGDAVCAALVSAAPAHLTEGGWCQLLANWLHVDGED
FT                   WRDRVGGWVEGTGCSGWVVQRDVQDPAEYVELWLRDSCEAGSPEYAQRYDAWLDYFERE
FT                   GVKGIGFGWICLRNDAAQDATVRVEELRHEIDQPVGPYLPDVVDGAMSAHRLTDAALLA
FT                   ARVALAPGVREERISVPGAPDPERILLRQTQGLRRVAQVGTVEAALAGVCDGTIPVGPL
FT                   LDAIAELIGQDPAVLRERTPASLRGLIAEGFFRVAR"
FT   gene            complement(268311..268655)
FT                   /locus_tag="Tfu_0239"
FT   CDS             complement(268311..268655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54277"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54277.1"
FT                   /translation="MRKPRQPDPEVHESDYRIPAAVGTAAWTIALIVLLLQGDRIPEDS
FT                   RWWIWVCVTGIALGVFGFWYVPRLLRSRAEAEERRRAQRAASGSDRSSSPPSDSASDPA
FT                   TGKVSRQSRP"
FT   gene            268786..270267
FT                   /locus_tag="Tfu_0240"
FT   CDS             268786..270267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0240"
FT                   /product="putative xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54278"
FT                   /db_xref="GOA:Q47U29"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54278.1"
FT                   /translation="MSESSTPVAPVPPTKRTGFAAALDRYFHVTARGSNFAREIRGGLA
FT                   TFFAMAYIVVVNPLIIGTAPDINGDTLGLERVAAVTALVAAVSSILMGVISRYPFAIAS
FT                   GMGLNAIVAYVLAPMMTWADVMGLVVIEGVIMLLLVFSGFRKAVFNAVPASLKSAIGVG
FT                   VGLFLALIGFVNAGFVRPGDGTPVQLGVGGSLNGWPILVFVLGFVVTIVLMVRQVKGAV
FT                   LIGIVFATVLGIVVELFAKVGPRVDEAGQVNDLGWALNVPTVPTSADDLVSLPDLSLVG
FT                   QFNLLADWRGVGIATMLMLVLTLLLADFFDTMGTMVGVAGQAGLTDKDGNVPNSQGVLV
FT                   ADALGTVVGGAASASVATTYAESAAGVGEGARTGIAPIVTGLLFIGAMFITPLAVLVPA
FT                   EAATPVLVAVGFLMMTQITKVDFTDLGIGIPAFLAIVIMPYTYSIANGIGVAFIAYTIV
FT                   RTAQGRWRDVHPLMLLISLVFLIHFAEAPIQALLG"
FT   gene            270407..270862
FT                   /locus_tag="Tfu_0241"
FT   CDS             270407..270862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0241"
FT                   /product="regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54279"
FT                   /db_xref="GOA:Q47U28"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54279.1"
FT                   /translation="MLMNQPHPSTPASTDASLAAALRMAVGRLARRLRAQRPDSSLSLG
FT                   QGSALFTLARHGTMTPGALADHEKVQPPSMTRIIAALEERGLVRRRRHPDDGRQQLVEI
FT                   TEEGIQLVQADHQRREAWLTRQLAELSHEDKEVLRRAAEIMDRLSQS"
FT   gene            271001..272275
FT                   /locus_tag="Tfu_0242"
FT   CDS             271001..272275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0242"
FT                   /product="putative integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54280"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54280.1"
FT                   /translation="MFRSLANRNYRLFALGQVISNPGTWMQRIAQEWLVLQLSGGSGIA
FT                   LGVATALQFLPTLLFGLWGGALADRMSKRRLLITSQSMMGLLSLGLGLLVTFGTAQVWH
FT                   VYLFALGLGLVTVVDSPARQSFVVEMVGREDLPNAVALNSASFQLGRVVGPAAAGILIG
FT                   LIGTGPVFLINAVSFAGVITGLLMMRPSELHVSELAPRSKGQVRQGIRYVAGRRDLLLL
FT                   LATVAFVQLFGSNVQNQLALMVNNVFQAGSEAFGLAATFLALGSFTGALIAARREAPRL
FT                   RTVLIGALLFGVLQVVAGLMPGYTALLVALVPMGICFMTFTTSMNAYFQLNVEPQMRGR
FT                   VMAMYMLVFLGVAPIGAPIVGVLADLFGPAVSMVVGGTVSVTIAVSAAMLLGRSLGVKV
FT                   RLRARRPFVDVIRDKGPERRPELEE"
FT   gene            272275..272823
FT                   /locus_tag="Tfu_0243"
FT   CDS             272275..272823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0243"
FT                   /product="2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54281"
FT                   /db_xref="GOA:Q47TD6"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54281.1"
FT                   /translation="MRLFTAVTPPAAALDALDAAVASARPTARGLRWVAREQWHMTLVF
FT                   LGDVPDDQVDTVAGELGRVAARHPAMSLSLRGSGTFPPQPVRSRVLWAGVDGDTAALTA
FT                   LATDLREAAVALGIPVENRRYVPHVTVARARITTNLTAPCARLETLATEPWQAAEVHLV
FT                   HSRLGAVPRYQTIATWKLA"
FT   sig_peptide     272275..272349
FT                   /locus_tag="Tfu_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.871) with cleavage site probability 0.859 at
FT                   residue 25"
FT   gene            273047..274111
FT                   /locus_tag="Tfu_0244"
FT   CDS             273047..274111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54282"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54282.1"
FT                   /translation="MGAMTRGVRGVGVVVLLGVCCIAGAAAPAPATPEPSPTSPSRAVP
FT                   EGTEQLFTLTDPRIAESSGLAVSHRHEDIYWTHNDSGPDYGPTLYAVNGEGDTVATVWL
FT                   AGEGVEARDWEAIGIGVDEHGEPAIYVADIGDNYQGGWPNVRVYRIPEPRELVDQTVTA
FT                   TTFTFVYEDGGRDAEGLLIDPRDNRLYLVSKEFTGGVYAAPEQLDPDGVNTLTRVGSAP
FT                   LFATDAAFSPEGSYYAIRTYWNATLYDASEGVPGRRIATVTLPESDQGESLAFTRDGSA
FT                   LLVGSEGTHSPVWRVPVDEFLDAPPEAADEEPSPEATEEADLSGGGGAGGLILVGAGIA
FT                   AVAILAIVWLARNS"
FT   sig_peptide     273047..273178
FT                   /locus_tag="Tfu_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.831 at
FT                   residue 44"
FT   gene            complement(274217..275215)
FT                   /locus_tag="Tfu_0245"
FT   CDS             complement(274217..275215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0245"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54283"
FT                   /db_xref="GOA:Q47TD4"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54283.1"
FT                   /translation="MPKKKPQPPHLKIISHRGASGHRPEHTLASYELGARYGGDFIEVD
FT                   LVATADGHLIARHEPEIGQTTDVASRPEFADRRRTVTIDGREVTGFFAHDFTLAEIKTL
FT                   RAVERLPDVRPYNAELNGRYEIPTLEEIVDLADELTRELGRPIGVYPETKHPSYHASLG
FT                   LDLEPPLIALLRERGLHGPEPRLPVFLQSFEADSLRKLQELEVPLVFLMGTGEQWQRYT
FT                   TPEGLAEVASFAQAIGPEKSLVIPVTEEGGLGEPTSLVADAHEAGLLVHPYTFRSENHF
FT                   LPPKLRSGDDPTAYGSFAAEYEAFFAAGVDGVFTDHSRHAFLAREMFLAQA"
FT   gene            complement(275316..276437)
FT                   /locus_tag="Tfu_0246"
FT   CDS             complement(275316..276437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0246"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54284"
FT                   /db_xref="GOA:Q47TD3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54284.1"
FT                   /translation="MTEIHIPENLLPGDGRFGCGPSKVRPEQVTALASSGATYLGTSHR
FT                   QKPVKSLVGRVRSGLAELFSLPDGYEVVLGNGGTTAFWDIAAHTLVRRKSQHVSFGEFS
FT                   SKFAKVTQGAPWLDEPTVITAEPGSYAPPRAEAGVDVYALTHNETSTGVATPIERIAGA
FT                   DEDALVLVDATSGAGGLPVDITQTDVYYFAPQKCFAADGGLWIAIMSPRALERMAEIAA
FT                   TDRYIPAFFSLTTAVDNSRKDQTYNTPAVSTLLLFAEQIEWLNKQGGLEWAARRTAESS
FT                   SILYSWAEKSEYATPFVADPALRSQVVGTIDFSDEVDAAKVAAVLRANGVVDTEPYRKL
FT                   GRNQLRIGMFPAVEPEDVRALTECIDYVVGKLG"
FT   gene            complement(276595..277800)
FT                   /locus_tag="Tfu_0247"
FT   CDS             complement(276595..277800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0247"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54285"
FT                   /db_xref="GOA:Q47TD2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54285.1"
FT                   /translation="MGGPLTAPRMSAKDPRTVQWITNPRTEETEEAGMSDFKPGLEGVV
FT                   AFETEIAEPDKEGGALRYRGVDIEQLVGHVTFGRVWGLLVDNSFNPGLPFADPIDLPVS
FT                   TGDVRVDVQSALATLAPRWGFKPLLDIDEAEARDNVARAASAALSIIAQSARGDQPKVP
FT                   QSRVDEGKTIVERFMIQLRGEPDPLHVKAVDAYWTSAAEHGMNASTFTARVIASTGADV
FT                   AAALSGAVGAMSGPLHGGAPARVLHMLDETERLGDARKYVTQALDRGERLMGFGHRVYR
FT                   AEDPRARVLRRTAKELNAPRFEVASALEKAALEELQARKPDRVLATNVEYWAAVVLDFA
FT                   QIPASMFTSMFTCARTAGWSAHILEQKRTGRLVRPSARYVGPAVRDIKSVEGADEALAQ
FT                   GI"
FT   gene            277842..278507
FT                   /locus_tag="Tfu_0248"
FT   CDS             277842..278507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0248"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54286"
FT                   /db_xref="GOA:Q47TD1"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54286.1"
FT                   /translation="MDYSDPAELRESYDGAPLDPRGLAPQPMDQFHAWFTEACEAELSE
FT                   PNAMVLSTVDPDGAPSARTVLLKGYDRRGLRFFTNYRSRKGVALAREPRACVVFPWHAI
FT                   RRQVIVYGFAERLSDEENDAYFAQRPHGSQLGAWASEYQSAPVADRAELDRAYARCAEQ
FT                   WPPGTPVPRPEYWGGFLLVPQEVEFWQGRSDRMHDRFRYRLVSGTPSEGAWQIDRLSP"
FT   gene            278761..279471
FT                   /locus_tag="Tfu_0249"
FT   CDS             278761..279471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0249"
FT                   /product="iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54287"
FT                   /db_xref="GOA:Q47TD0"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54287.1"
FT                   /translation="MTAQGLIDTTEMYLRTIFELEEEGIVPLRARIAERLRQSGPTVSQ
FT                   TVARMERDGLVRVENDRHLVMTEEGRRLATQVMRKHRLAERLLVDIIGLPWEDVHVEAC
FT                   RWEHVISEAVEERLIGLLKEPWTCAHGNPIPGLDELGVEGYEPEPFASSSIVPIPEALS
FT                   DTPTRVTIRRISEQIQSDTKTMLALKRTGVQPGKEVTLEASDDGVRVIGGNGKDGESIE
FT                   LPRQVASLIFVTRV"
FT   gene            279658..281919
FT                   /locus_tag="Tfu_0250"
FT   CDS             279658..281919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0250"
FT                   /product="PAS containing protein phosphatase 2C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54288"
FT                   /db_xref="GOA:Q47TC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54288.1"
FT                   /translation="MKRWGEAFYDDALSGAEVLEQVQIAVVVTDRFSNLRYWNSYATQL
FT                   FGLDDGRDYLGTPLVDIGIHEADHEQLAQLARRVLRGDTWEGTFAVLRKDSTWMHLRAS
FT                   AVPLRPSSGAVEGVVLFITEALRSGRIEEQYGLLDRIGRRLASSLEFEATVKAVAEILV
FT                   PQFADHCFIDLNDHGRLIRRVSVHAEGWTPPPGSWPDVGEEVHYPEKHFVSKALRRMET
FT                   VVVSDYSNPGSTAGVFPNRRSVRVSEQVGVTSVIAAPLRARGVTLGVLTLARSGLTSRD
FT                   KTDYDSFDRDLVGTIASRVAVAIDNARLFEEERDTALAFQNSLLPREFPEFDGLSIAHD
FT                   YIPAKPLEAHGQGIQTQVGGDFYDVIPLSAGRVGIVIGDVEGKGPHAAAVMGQLRAALR
FT                   AFAQADREPAEILRELDEWVRQLGRPDGEGNTWVPSVSCLYMAYDAWSRELTYANAGHQ
FT                   PPLLICGGKVDDLDMAIRDKLLGVKPKGVPGDSVYRQGELTLPPGATLLLYTDGLVARR
FT                   SYDGTVDMEAGLEQLRSRVREVADKDVHQILEVAKRAVPGVADDDTALLVVRSHPEELA
FT                   LKQEWFPAEAPTVAEARHLAVDTFKEWGMDRDQAELACLLVSEIVTNVVIHATPHPVTR
FT                   EFTDDGVKDSDEQLPLDGFDEFDEDWSDLLEEAAEQDEEPVPTSREFLLRLRRGASSVW
FT                   VEVFDHDLRLPRIRTAGAEDEGGRGLYLVDQLAERWGSRPTPDGKAVWFQIPMHQPDSE
FT                   "
FT   gene            complement(281979..282980)
FT                   /locus_tag="Tfu_0251"
FT   CDS             complement(281979..282980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0251"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54289"
FT                   /db_xref="GOA:Q47TC8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54289.1"
FT                   /translation="MSKRSASSSRSPAAGTGAAVPESPAELPATSWWASLKRTVVEFKE
FT                   DNLTDLAAGLTYYAVLSIFPALLVLVSLLGLAGQSATDTISDQLSAVAPDETVEIVTGV
FT                   LTNLQANQATASLVGLLSLALAVWSASAYVAAFMRAANIVYDIREGRPFWKTLPVRVGI
FT                   TLLLLTLVAISALAVILSGGVAQWVGNFIGAGPTAVTLWNIVKWPVLVLLMMFMVSVLY
FT                   WAAPNVKRPFRWVSPGGIVAVLIWLGASAAFAFYVANFANYNRTYGSLAAVVIFLVWLW
FT                   ISNIAILLGIEYNAEIERSRALQAGQRLTVEPYVEPRDVPKPRPFHHRPKPE"
FT   gene            complement(283063..283233)
FT                   /locus_tag="Tfu_0252"
FT   CDS             complement(283063..283233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54290"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54290.1"
FT                   /translation="MSGAYDGAILLGLLVLFVVLGVRWLRKRVHVPWSTKGIAVVFIFA
FT                   VLLLWAYQTTT"
FT   gene            283496..284638
FT                   /locus_tag="Tfu_0253"
FT   CDS             283496..284638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0253"
FT                   /product="thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54291"
FT                   /db_xref="GOA:Q47TC6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54291.1"
FT                   /translation="MAEAYIVGAVRTPIGTRKGALAAVHPADLGAHVLKELVNRTGIDP
FT                   AAVEDVIMGCVTQVGPQALDLARTAWLSAGLPESTPGVTIDRQCGSSQQAVHFAAQGVM
FT                   SGTQDLVIAAGVENMGMVPMGANVQFAVDNGLSVYGQGWVERYGTQEISQFRGAQLMCE
FT                   KWGYTREDLEKYALESHRRAAAAIEAGYFDAETAPLAGVTHDEGVRPDTSLEKMAELAP
FT                   LREGWALTAAVSSQISVGASALLIASERAVAEHGLTPLARIVQLALAGDDPVYMLTAPI
FT                   PATRIALRKAGLDIDDIDVVEINEAFAPVPMAWIDEIGADPAKVNPNGGAIALGHPLGA
FT                   TGAVLMTKLVHELRRTGGRYGLQTMCEGGGQANVTIIERV"
FT   gene            complement(284679..285890)
FT                   /locus_tag="Tfu_0254"
FT   CDS             complement(284679..285890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54292"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54292.1"
FT                   /translation="MYESAALPSPRRDATLSLTQARHVALAAQGFADPRPSGTVTAHHL
FT                   RQVVDRIGVIQIDSVNVLCRSHYLPVYARLGPYDRALLDRAATTPGHFLVEYWAHEASL
FT                   IPLHTHRLLRWRMADITGAWRIVQRAGEEHPELVRAVLDEVARTGPVTARQVADALRHD
FT                   LPHSAKRWGWNWSVVKSALEYLFWRGEITANGRNQHFERRYDLTSRVLPAEVHTAPDPD
FT                   PDDARRQLVAIAARAHGVATERCLRDYFRLSAAHGRAAVRDLVDSGELIPVRVEGWRQP
FT                   AYLHRDARFPNSVAARALLSPFDSLVWERARIKALFDFHYRLEIYVPAAKRVHGYYVLP
FT                   FLLGDRLVARVDLKADRASGRLLVRRTTLEDHAPADTMAELSAELDQMAEWLGLPEGVV
FT                   HSAD"
FT   gene            complement(285922..286440)
FT                   /locus_tag="Tfu_0255"
FT   CDS             complement(285922..286440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54293"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54293.1"
FT                   /translation="MRLAFCRRPGCRPRHARPPWIVRATRARWLVASFAVLSLGGAAGL
FT                   LSPHAEDSIAQSTPDAEIQPAAVASYFAPQHTTPPVPVVRTTPPQTLTRAADLQPVTLP
FT                   RPSEPTPTPPAETDDRSNDRREIAELSGPDHWSPRSEAPHRYSPSSSPEATCSDSVFML
FT                   WEGCGEEDF"
FT   sig_peptide     complement(286273..286440)
FT                   /locus_tag="Tfu_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.646 at
FT                   residue 56"
FT   gene            complement(286805..288229)
FT                   /locus_tag="Tfu_0256"
FT   CDS             complement(286805..288229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0256"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54294"
FT                   /db_xref="GOA:Q47TC3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54294.1"
FT                   /translation="MIIGGLFAPPGTLRSRLLAGLLIVTGVGLLVSSLVSVLTLRSFIT
FT                   ERLEAQLLFTTERAMIRLDNDTPPVGVDAPSPSPYFVVLLNPETGEVNQIYGDTLREDV
FT                   VLNRLAHLSLTELRSYASSQEIVELDTPDERVPPHLITVRMRPNAIMVSGVPTDEREDY
FT                   PRQLVTVQLITAVLLLGGLLLIGGRLIVRALAPLDRMATTAGQISTGSDLGDRMPDADP
FT                   YSEVGRLGMAINTMLARLENAFRAKAESERRVRDFAADASHELRTPLTTILGYAELYRQ
FT                   GAIPDAELPEAMRRVEAEATRMSKLVGELLELARLDRTGSLELATRDVAEIVRDMTGDA
FT                   ASLEPEREFTLDVPDRLFWRIDETRFRQILANLLSNVREHTPPDTPVTVRLHSDGDEVV
FT                   LSVTDAGPGMSPEDASRVFDRFYRAARDPGGGSGLGLPIVKAIADAHGGSVTLDTRPGE
FT                   GTTVTVCIPSGDHSTD"
FT   sig_peptide     complement(288101..288229)
FT                   /locus_tag="Tfu_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.632) with cleavage site probability 0.271 at
FT                   residue 43"
FT   gene            complement(288226..288951)
FT                   /locus_tag="Tfu_0257"
FT   CDS             complement(288226..288951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0257"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54295"
FT                   /db_xref="GOA:Q47TC2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54295.1"
FT                   /translation="MTESETTARPHVLVIDDEPNIRDLVQAALRFHGFEVSTAGSGEEG
FT                   LALARSERPDLILLDVLLPDISGFDVCRRLRDEDDDVPVIYLTARDTPSDTVTGLSLGG
FT                   DDYVTKPFSVEALIARVRALLRRVKRDPNSAQSSDGVLRVADLELDEKTWTVRRGGVPI
FT                   DLSPTEFRLLAYMMHNAGRVLTRAQLLENVWGWDYAGQSQIVETYVSYLRRKLDPFGPN
FT                   LIHTQRGVGYALRVKEDDK"
FT   gene            289275..290069
FT                   /locus_tag="Tfu_0258"
FT   CDS             289275..290069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0258"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54296"
FT                   /db_xref="GOA:Q47TC1"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54296.1"
FT                   /translation="MRLATWNVNSVRARSERIAAWLRRSDVDVVALQETKCRDDQFPTA
FT                   VFTELGYEVAHHGLSQWNGVAIASRVGLSDVQIGFPGQPGWGEPEEAEARAISAVCGGV
FT                   RVWSLYVPNGREIDHPHYTYKLQWLARLREAGEAWLSEDPKAQIALCGDWNIAPYDEDV
FT                   WDMAEFEGRTHVTKPERDAFHAVVDAGFTDVVRPHAPGPGVYTYWDYKGLAFPKRKGMR
FT                   IDFILASPALAERATDAKIDREERKGKGASDHAPVIADFQLD"
FT   gene            290106..290993
FT                   /locus_tag="Tfu_0259"
FT   CDS             290106..290993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0259"
FT                   /product="ribokinase, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54297"
FT                   /db_xref="GOA:Q47TC0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54297.1"
FT                   /translation="MAPRIAVFGSVNMDLVAYVDTPPARGETVQGRQFSQVPGGKGANQ
FT                   AIAAARAGADVVFLGAVGDDVFGPQLRATLVDNGIDVSGLRTVGGASGIAHIVVDREGN
FT                   NSIIVIPGANGTVTGLRENDTLLLDGAQALLLQLETPLSGVIAAARAGRSLGVTTVLTP
FT                   APAQPLPQELLECVDVLLPNQYEAATITGEDTPERALAALLETVPEVIITLGSRGALYG
FT                   ARDREPLWVPVVQVEAVDTTGAGDTFCGAYAVARTEGQDPESALRFAAKAAALSVRIPG
FT                   ASTSMPTRAEIDAF"
FT   gene            complement(291087..291710)
FT                   /locus_tag="Tfu_0260"
FT   CDS             complement(291087..291710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54298"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54298.1"
FT                   /translation="MTHPVPPVPQPQPKKSRGCLWATLIGLGLVVLFGFVGCVAVIASV
FT                   GSDSSSSGQSASSGDKKDDKGDSAESSDEEKTAGIGDTVEDGAFAFTVTDIETGVSRIG
FT                   NDFLHHDAQGQFVIVHVTVENIGDQAEMFHGSSVKLYDADGKEYSNDGEAEIYLEDSEA
FT                   FLTDINPGNKVDAKVVFDLPEGVEPVSVKLHGSLFSSGVTVSLS"
FT   sig_peptide     complement(291567..291710)
FT                   /locus_tag="Tfu_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.409 at
FT                   residue 48"
FT   gene            291938..293980
FT                   /locus_tag="Tfu_0261"
FT   CDS             291938..293980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54299"
FT                   /db_xref="GOA:Q47TB8"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54299.1"
FT                   /translation="MPSTPAGTATVNSVGIARLAGVGRAAVSNWRRRYPDFPAPVGGTE
FT                   NSPLFDLAEVKEWLRKTNKLAEKETPEAAVEAVWSLLDPLRRHLDGADAVAFLGAALAL
FT                   RDQGFELAELSDDALGAHLLAQLGPDPDPPVLPDPAVWRRPLLEAVTRVGVLGPAPDAL
FT                   EHLHQRYLSSASRQLFADTPKLGALIAELAAQQTGTVFDPSCGSGTLLHAMARHAPGVT
FT                   LYGQDIDPAAARLARVRLQLAGADADIRVGDSLRADAFPGLAADTVVLHPPFNQTDWGF
FT                   EELSFDSRWRYGTPARKEPELAWVQHALAHVRPGGTAIVVLPPAVASRGSGRRVRRELL
FT                   RRGALRAVIALPTGLATPMGTPLTLWILRNPEDSTDLPGKVLLFDASDGRVDDSPESST
FT                   QPWSAVAHAITATYREFLTDPDAVAKTPGRHRAVPLADLLDEAVDVAPGRYVQRLSAGT
FT                   DNLDETRSDLMRLSEDLVTSLPGLRPATGTLYQAMVTLGELSRIGGLDIVYRRSGEDPG
FT                   DDEPSLPALTAEDIERDTAPSGRVRSDNNTVQLQAGDVVLPRIARRPVARVITDEQAAL
FT                   HSSIYLLRPNPEVVDPWFLAGFLTGSGACAAAASTSRPGVTRIAELRKVEVPRLPIAEQ
FT                   RAYGDAFRRLHEFRRTLRRTTEVGDRLWWLLTEGLAVGTLRPEQD"
FT   gene            complement(294442..294630)
FT                   /locus_tag="Tfu_0262"
FT   CDS             complement(294442..294630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54300"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54300.1"
FT                   /translation="MNHHTEWRKSSYSSDTGGNCLEIAEVPGSVLVRDTQHRELGHLDF
FT                   TPEAWAAFLADVKAGRL"
FT   gene            complement(294627..294974)
FT                   /locus_tag="Tfu_0263"
FT   CDS             complement(294627..294974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0263"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54301"
FT                   /db_xref="GOA:Q47TB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54301.1"
FT                   /translation="MVVLDESALIRPIGGRAVMGQQLDHLLEISQLPNVRIYVVPMSTE
FT                   FHPELMAGFQVITVPDRGQVLYLETRISGMLVDTTDELHHYARLFGELRGAALPPDASR
FT                   KLIEKIRGEFL"
FT   gene            complement(294998..295438)
FT                   /locus_tag="Tfu_0264"
FT   CDS             complement(294998..295438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0264"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54302"
FT                   /db_xref="GOA:Q47TB5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54302.1"
FT                   /translation="MADRVNPHWLKLGSQIRLLREAQGLSQAQLSQALNISQAMLSAVE
FT                   RGIRNCKPDLAAQIDHVLNTGGKVRRLWEINHTNSAFPHWFRDIVQLQRAASEIWEFQI
FT                   ALIPGLLQTKEYARTRIQLSQPTASVEEIDQKVRARLDRQST"
FT   gene            295713..296204
FT                   /locus_tag="Tfu_0265"
FT   CDS             295713..296204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54303"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54303.1"
FT                   /translation="MQYLLFCPINPDRFSRTVRSGGGPVTISLTSFPGIPDSVAAARRF
FT                   VTGMLRLCPQTSAPDEVVHRVELIVSELCTNAIRHTRSGDPGQKFHVHVCTDERGVHVE
FT                   VRTLPPRRPRSVPRVVPPEDPFSEHGRGMFLVDQWATQWGTLSPRENGVYFLLAWEPSD
FT                   "
FT   gene            296341..296664
FT                   /locus_tag="Tfu_0266"
FT   CDS             296341..296664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54304"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54304.1"
FT                   /translation="MTTTIRHPQPRIRPPRPWIPNDPPETVLPAWMYARREPRFPYRII
FT                   HPDDSRTASTADQAEHLNKQRCTSPRIQSCLGLRTLVLLTSTALLASTVLHACTQLTAF
FT                   CPL"
FT   gene            296910..297866
FT                   /locus_tag="Tfu_0267"
FT   CDS             296910..297866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54305"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54305.1"
FT                   /translation="MNHGTRGPPNLEAAVTGQTRREQVSFDSAGVACAGILYHPAEPAP
FT                   GRQPCVVMAHGFTGTMDRLSHYAQRFADAGLTVLTFDYRNFGASGGQPRQLVDIAGQQA
FT                   DWHAAIRFARSRDDIDPDRIALWGSSLGGGHVLTVAADDQRIAAAVAQIPWLGDWRTTR
FT                   DKLRSLADPSTRKLAVAAVRDAWRAWRGRAPLLVKVVGQPGQAAMFTDPSVRRALNVND
FT                   SEDTLWRNEFAPRAVFSFARYAPGSVVDRITVPVLVCAAEQDQEIPFEYVRKVAARNPR
FT                   IELRGYPGRHWEVYRGGESYERVVADQLVFLRGHLGW"
FT   gene            complement(297917..298615)
FT                   /locus_tag="Tfu_0268"
FT   CDS             complement(297917..298615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54306"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54306.1"
FT                   /translation="MCYVNFLTRFSASCGPRHTHISLPIHPVTREQAMTVQEEKAQRVG
FT                   PQPGTWYLDPLHSNLIFVAHYLKFGRVQGTLNRARGRVWVAEDPRESKVEVTVNTASLN
FT                   TGVKARDTHLRSADFLDVERYPEMRFVSTGIETPTDRKANAFILHGELSLHGVTAPVSL
FT                   DCQWVGEAPHYLGAEHGYGHFFSGSTVLRLSDFGISDGGELPWGGRLIGDEVDIVLEIR
FT                   LQDSDPGDVE"
FT   gene            complement(298664..300394)
FT                   /locus_tag="Tfu_0269"
FT   CDS             complement(298664..300394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0269"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54307"
FT                   /db_xref="GOA:Q47TB0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54307.1"
FT                   /translation="MADPQTVLARRVQSALGAAFGPEYRDTDPVIRPSQFADFQANVAL
FT                   ALAKRLRRSPRDVATAITEHLDISDVCSKVEISGPGFINLTLRDDWIAHQVHDLLTDER
FT                   LGTPVQESQNIPIDYSAPNVAKEMHVGHLRTTVVGDALARILEFLGHHVIRQNHIGDWG
FT                   TPFGMLIEHLLEVGEDSAEAAQLKSDPNAFYQAARAKFDSDEDFADRARRRVVALQSGD
FT                   AETLRLWRDLIELSKIYFNRIYRKLDVTLTDAHLAGESTYNDMLGPVCDELAEKGLAVV
FT                   SDGALCVFLEGFTGREGKPVPLIIRKSDGGYGYATTDLATIKYRVEQLKADRIIYVVGA
FT                   PQSLHLRMVYETARQAGWLGNAEPIHVQIGNVLGSDGKILRTRSGAPVRLMALLDEAVE
FT                   RASAVVAQTRPDLDEETRAAIARDVGIGAVKYADLSIAHDTEYVFDFDRMLALNGNTGP
FT                   YLQYAVARIRSIFRKGGIDPAQVTGPIQVTEPAERALALKLLDFGATVVQVGDTLEPHR
FT                   LCTYLFDLAQTFTAFYEACPVLKADRDEVRNSRLALTAVTLHTLVKGLDLLGVRAPEQM
FT                   "
FT   gene            complement(300444..301760)
FT                   /locus_tag="Tfu_0270"
FT   CDS             complement(300444..301760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54308"
FT                   /db_xref="GOA:Q47TA9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54308.1"
FT                   /translation="MTDEPPHRSPAGTTAAVLLTVAAVMVTGVVTLATVRSHTPSPLER
FT                   TDADVVADALPRLEFVREALHEGAGTAMQELFPEGYFFTHALYGLTWLSVAQRDPDLQD
FT                   RALREARWSLKRLYSPEGTGPFSSVAVPAYGVFHAGWSAWLRGQIVAVAGGPEQAPEEM
FT                   AALDAAAEEIAEAFEASLAHGTPYLTSYPGQAWPVDNVVAMAALRLRDHLAGEDRYAAL
FT                   FRLWMTEVRARLDPATGLIPHRVDPVTGHPVEGARGTSQTLLLRFLFEIDPEWAAADYT
FT                   VFRELFASEHAMLPGVREYPRGNRSPGDVDSGPLIFGLSASASTVALAGSILAQDTATA
FT                   DALTGFAEATGMAVEWRGKRRYLGGVLPVGDAFLMWALTTVPTVPDRIPAAPTTTVSPW
FT                   WRVPWYALTLLPIAALWWIVLVRWRSLRPPRPVPERSDP"
FT   sig_peptide     complement(301647..301760)
FT                   /locus_tag="Tfu_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.764) with cleavage site probability 0.576 at
FT                   residue 38"
FT   gene            complement(301822..302904)
FT                   /locus_tag="Tfu_0271"
FT   CDS             complement(301822..302904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0271"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54309"
FT                   /db_xref="GOA:Q47TA8"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47TA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54309.1"
FT                   /translation="MSSPVTAQRPPAAPPLIAVDAMGGDHAPREIVAGAVRAVREHGLR
FT                   LALVGRSSELAPLVAAEQAARELPIVHAEEALAMHEGALAAWRRARSSVAVGCKLVRQG
FT                   TAAALVSAGSTGGVVSTATVRLRTLPGVLRPALALVLPTTPTPTILLDAGANADAKPEM
FT                   LVQFAHLGAAYARVGHGIAEPRVGILTIGSEPGKGNKLARRAAELLSANATEDRLDFRG
FT                   NIEGHDLLAGLVDVVVTDGFTGNVALKSVEGAVRFAFDEIRAALTSSPLARFGTLFQRR
FT                   ALRELRTRFDSETYGGAVLLGLNGTVVIAHGASRAEGIAHACLLAHNLVVGRITDQIRR
FT                   GIAGVSRTPSWLHRLSAPEE"
FT   gene            303287..304648
FT                   /locus_tag="Tfu_0272"
FT   CDS             303287..304648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0272"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54310"
FT                   /db_xref="GOA:Q47TA7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54310.1"
FT                   /translation="MSLTHDMAPQASAGRRFRAYTSKHLDELTARAGFGEEERLAIRAV
FT                   ATVLPFRVNSYVIDELIDWDAAPDDPIYRLTFPQADMLPEADVARIADLLRKDAPRQEI
FT                   NRVASEVRARLNPHPAGQLQLNLPKMDDEPMPGVQHKYPETVLFFPKQGQTCHSYCTYC
FT                   FRWAQFVGEPDLKMASDEIDRLVAYLRQHPEVTGVLLTGGDPMIMGEAVLRRYIEPLLE
FT                   VETLESIRIGTKALAYWPQRFVTDPDADDTLRLFEQVVNSGKNLAFMAHFSHPRELEPD
FT                   IVREAVRRIRDTGAVIRTQAPLIRTINDSSETWATMWRTQVRLGMIPYYMFVERDTGPQ
FT                   DYFAVPLAQAYEIFRKAYNSVSGLARTVRGPSMSATPGKVCVDGITEINGEKVFMLHFI
FT                   QARNPELVNRPFFAKYDEKAVWLFDLKPALGATRFPYEEEAPSEPGALVDTPHP"
FT   gene            complement(304625..305710)
FT                   /locus_tag="Tfu_0273"
FT   CDS             complement(304625..305710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0273"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54311"
FT                   /db_xref="GOA:Q47TA6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54311.1"
FT                   /translation="MVFTRTTGRRTRGLVIGIDIGGTKVAGGVVTPAGHVLDRIRTETP
FT                   DRSKSPKIVEDTIVDVVEQLRRDHRIQAVGIGAAGFVDARRSTVLFAPHLSWRDEPLRE
FT                   ALQDRLGLPVIVENDANAAAWAETRFGAGRGVRDAVVVNLGTGIGGAIIIDGALRRGRY
FT                   GLAGEFGHMVVVPDGHRCECGNRGCWEQYASGNALTREARELAAAHSPMASRLLDAAGG
FT                   DPAQITGPLVTALAREGDRACIELLEDLGAWLGAGLANLAAAFDPELFIIGGGVCEADE
FT                   LLLAPARAHFHRALTGRGHRPEARIVRAALGNDAGLIGAADLARSLPLRGLRLPGGAAR
FT                   SRLFFRPPGPRPRRSGVRGVD"
FT   gene            complement(305720..306550)
FT                   /locus_tag="Tfu_0274"
FT   CDS             complement(305720..306550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54312"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54312.1"
FT                   /translation="MSEWFAVHIVATGRLPLFSFFVAFVAGFLMIRCSVRMIRARVRWW
FT                   PGNLTPFGLHIHHVVFGVAFMLIGGVAGLLITDRDGAAMATAAALFGFGAALVLDEFAL
FT                   ILHLRDVYWTEQGRTSVDAVFVAIALSGLLLTGLRPVGWGLWGITVDTTITQIGMVALI
FT                   LINFAGAAVSLLKGKIWSGIIGIFIPVISIITAIRLAVPGSPWARWRYPEGSAKLAAAI
FT                   RRDQRLRRPFIRAKIWFQELIAGRHDLILEPSPAFHQQLPTVSERSTPPVRHVD"
FT   gene            306878..307651
FT                   /locus_tag="Tfu_0275"
FT   CDS             306878..307651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0275"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54313"
FT                   /db_xref="GOA:Q47TA4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54313.1"
FT                   /translation="MELNGVAALVSGGASGLGEATVRELTAAGATVVIADVNTERGEAL
FT                   AKEVGGVFVRTDVADEDQVQAAVQAAVDTGKPLRAAVSCAGIAWAARTVARDGTPHDLA
FT                   SFRKIIDVNLIGTFNVVRLAAAAMAKTEPINDDGERGAIVNTASVAGIEGQIGQIAYSS
FT                   SKGGIIGMTVPAARDLAAVGVRVNTIAPGILDTPIYGQGPEAEEFKQRLAAPVPFPKRL
FT                   GTPAEFAQLVRALLEISYINAEVVRIDGGLRMQPK"
FT   gene            307663..308427
FT                   /locus_tag="Tfu_0276"
FT   CDS             307663..308427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0276"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54314"
FT                   /db_xref="GOA:Q47TA3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54314.1"
FT                   /translation="MADEVLYEAADGVAVITINRPQAKNAVNRAVAEQIAAALDDLDSR
FT                   KDLTVGILTGAGGTFCAGMDLKAFLAGEVPIIEGRGFGGFAQRPPRKPLIAAVEGYALA
FT                   GGFEAVLACDLVVAAEDAKFGIPEVKRGLVAAAGGLLRLPQRIPRNIAMEFALTGDFVD
FT                   APRAAELGLVNRITPSGKALDGARELAARIAENAPLAVAVSKQVIVESADWSAAERWQR
FT                   QDELTGPVFTSRDAAEGAAAFAEKRKPVWTGE"
FT   gene            complement(308503..309411)
FT                   /locus_tag="Tfu_0277"
FT   CDS             complement(308503..309411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0277"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54315"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54315.1"
FT                   /translation="MRNRQRSLLGGRLSLLVRGIAASGLSAALTFSAISFLAWHTADRS
FT                   VTEPEADSATVLVHDASDISVWECFSPGSGAAGCSEREHHNLPAGVTLPPNAADPRDLA
FT                   ASWPTEWPPPAATRLGGEALNSTSGQHHHSHKPTHHHPTHLPTHSPTHRPPRPTHHHPT
FT                   HHPTHSHHPTHHPTHHPTHSHKPTHHPTHHPTHSHKPTHHPTHHPTHSHKPTHHPTHSH
FT                   KPTHKPTHHPTHSPTHSPTHSHSPSPSVAPTAPSTPGGGTLPVTGSETSAFTVIAAAAA
FT                   FLGAVLIAMTRRRRPARHRLK"
FT   sig_peptide     complement(309313..309411)
FT                   /locus_tag="Tfu_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.397 at
FT                   residue 33"
FT   gene            complement(309714..311102)
FT                   /locus_tag="Tfu_0278"
FT   CDS             complement(309714..311102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0278"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54316"
FT                   /db_xref="GOA:Q47TA1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54316.1"
FT                   /translation="MTVRSGSGLAANDFQQAAKDHLWMHFTELAAYQDTDVPVITRGEG
FT                   PYVYDTNGKRYLDGLAGLFVSQVGHGRTEIAEAIAEQSRKLAYFPIWTYAHPTAIELAD
FT                   RLADLAPGDLNRVFFTTSGSEAVESAWKLARQYFKLIGQPTRHKVISRRIAYHGTTMGA
FT                   LSITGLQAIKTPFEPLVPSTIQVPNTNIYRAPVHGDDPEAFGRWAADQVEEAILQNDPE
FT                   SIAAVYVEPVQNSGGCFPPPPGYFQRLREICDRYGVLLVSDEVICAFGRVGAYFGAQRF
FT                   DYLPDIITFAKGVTSGYVPMGGLIAREHLVEPFREAGNTFLHGSTFAGHPVAAAAALAN
FT                   LDIFEREGLIDHVQANAPAFRATLEKLLDLPIVGDVRGEGYFYGIELVKDKETKETFTD
FT                   EEAHRLLKGFLSPALFDAGLVCRADDRGEPVVQLSPPLICGPEHFAEMESILREVLTEA
FT                   WQRI"
FT   gene            311344..312798
FT                   /locus_tag="Tfu_0279"
FT   CDS             311344..312798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0279"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54317"
FT                   /db_xref="GOA:Q47TA0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TA0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54317.1"
FT                   /translation="MTSHSDGLRRLRNFINGEYVDSVDGRTAPVVNPATGEAYAEAPVS
FT                   TAEDVDRAFRAAADAFENGWRDSTPAERQIILNKIADAVEERADELVAAEVENCGKPVK
FT                   ATREEEIWQVTDALRFFAGAARVLEGKAAGEYMADHTSWIRREPIGVVGQITPWNYPMA
FT                   MAAWKIGPALAAGNTIVLKPSDTTPVSTLLLAEIAAEFLPPGVFNVVTGDRDTGRALVD
FT                   HPIPRLVSLTGSTRAGYEVAQSASRDLKRLHLELGGKAPVIVFDDADVEKAAEGIAGAG
FT                   YFNAGQDCTAATRVLAAPGIHDDLAAALAEQAKKTKTAGPDETDAYYGPLNNPNQLDRV
FT                   SGFFERLPDHAEVLTGGSAVDRPGYFFSPTVVSNLRQGDEMVSEEIFGPVITVQRFDDE
FT                   DTAVAWANSVKYGLASSVWTKDHARALRVSRRLDFGCVWINTHIPIIAEMPHGGFKHSG
FT                   YGKDLSLYSLEEYTRIKHVMSYIGRD"
FT   gene            312892..314046
FT                   /locus_tag="Tfu_0280"
FT   CDS             312892..314046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0280"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54318"
FT                   /db_xref="GOA:Q47T99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47T99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54318.1"
FT                   /translation="MATTTEKTPAAPGVVATESNQAVPAISLEKVSKTYRSGQVTTTAV
FT                   ESIDLEIRQGEFFSLLGPSGCGKTTTMRMIAGFEEPTSGVVRLSGKDVTGVPPNRRDVN
FT                   MVFQSYALFPHMTVAENVAFGLKRKKVPAAEIRTRVAEMLELVELGDRAKYKPRQLSGG
FT                   QQQRVALARALVNRPSALLLDEPLGALDLKLRQAMQLELKRIQREVGITFVYVTHDQSE
FT                   ALTMSDRIAVMNKGRIEQLGTPAQIYETPATRFVAGFIGTSNILTGTAQRVSDTLVRID
FT                   YGGDQHVLANTPQQMSDLGLVITVRPEKIRLGKDVPDANVSRIRGTVREVVYLGATTHY
FT                   TVRTVDDTDIVVFQQNSSDASNLADHGDTVWLSWRPEHSYVLPG"
FT   gene            314100..315338
FT                   /locus_tag="Tfu_0281"
FT   CDS             314100..315338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0281"
FT                   /product="putative polyamine-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54319"
FT                   /db_xref="GOA:Q47T98"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T98"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54319.1"
FT                   /translation="MRRKHTINPAVLRGFTQRRVSRRDTFKLAGLSAAALALAGCGIEG
FT                   QGQQSTTSENFWNGKESNGKVRFVNWPLYMDPEKPELKRFTEQTGIEVEYSEAIQDMPS
FT                   WFGEIQPLLANGDDIGADLMVISNGQELTKLIALGYLAPLKRDQLTNFAEFADEFYTMS
FT                   AYDYGNQYTVPYASGITGIAYDPERVGREITSIKDLWDPEFKGRVGMMRDPQEISNFAL
FT                   LYNGVAPEDSTPEDWEAAAEVLKKQRDDGIVRAYYEQDYIQPLTNGDIWITMAWSGDIY
FT                   QVNAEEGTNLKFVIPEEGATLWTDNLTIPITAQNPVDALMLIDFFYDPDIAASLTEYIN
FT                   YICPVPHAKEVLLDRAAELDGEDREALEELANSPLVFPSESDYARLHNYVVLDVEAGED
FT                   EEFNSIFQAVTHA"
FT   sig_peptide     314100..314243
FT                   /locus_tag="Tfu_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.862 at
FT                   residue 48"
FT   gene            315345..316208
FT                   /locus_tag="Tfu_0282"
FT   CDS             315345..316208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0282"
FT                   /product="polyamine ABC-transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54320"
FT                   /db_xref="GOA:Q47T97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T97"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54320.1"
FT                   /translation="MTRLLNRAAPYLLALPAWIWLGLFFVVPIVGLLWMSLMTGNIIVG
FT                   FQQTFNVGIYPEVITTYWEHILRSLGYGLAATLLCIAIGYPVAYWIAFHGGAHKSTYLL
FT                   LLLLPFFVTQVLRTISWKFLLADDGLILGTLKAIHLLPQDARVLSTSIAVIFGLAYTFL
FT                   PFMVLPIYAVLEQVDHRVVEAAYDLYASRFHAFVHVILPMSLPGVFAGVLLVFVPSSAD
FT                   YVTAWVLGGTHNTMIGNVIQSQYLVNNAYPTAAAITFVLMSVLLIGIFSYAKALGTERV
FT                   MEVQAG"
FT   gene            316205..317029
FT                   /locus_tag="Tfu_0283"
FT   CDS             316205..317029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0283"
FT                   /product="polyamine ABC-transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54321"
FT                   /db_xref="GOA:Q47T96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54321.1"
FT                   /translation="MSATATKAEATVSRRQRRPRITLGKVFTWAVLVWLFLPIAGMIAF
FT                   SFNDISGRHNVTWQGFTLKWYGKAFVYPDLNQALFNTLLIGFATMLIAGITGTLLGLAM
FT                   GRYRFRGQQASNLVMFAAISAPEVVIGASLLSLFIALNLTLGMTTVIIAHVMFSISFVA
FT                   ITVRARVMTMDPSIEEAARDLGADSWTTFRLVTFPMLFPAIMAGGLLAFALSVDDFIIT
FT                   SFVSGDLTTFPLWIWGSTRVGIPPQVNVMGTLIFVVGVLLAITNIILARRRS"
FT   gene            317069..318490
FT                   /locus_tag="Tfu_0284"
FT   CDS             317069..318490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0284"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54322"
FT                   /db_xref="GOA:Q47T95"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T95"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54322.1"
FT                   /translation="MSALARLAAAALADAKPTVFWQDPQVAGHTVPEPEPELRGHITTD
FT                   LAVVGGGYSGLWTALLAKERDPDRDVVLLEARTVGWAASGRNGGFCESSLTHGHANGVE
FT                   RWPDEIAELERLGHENLDRIAEAVARYGIDCEFERTGAIIAATEEWQLPGLREDAQRMR
FT                   DLGYDVVDLDAAQMRAEVNSPTYLGGIYDRDGVAMLHPAKLAWGLREACLRLGVRIFEH
FT                   TPVRAIRSEPGRLRLESRHGSVRARQVAWGTGAFPGPLRRIRHFVAPVYDYALMTEPLT
FT                   TEQREAIGWASRAGMSDASNQFHYYRLTADNRILWGGYDVIYHYGGKVRPEFHQRPETF
FT                   QRLAEHFFTTFPQLEDVRFTHKWGGVIDTCSRFCAFFGTAYGGRLAYAAGFTGLGVGAT
FT                   RFGAEVMLDRLAGVETERTRTAMVRSKPIPFPPEPLRYLGIELTRRSIAAADRNGGRRN
FT                   LWLRALDAVGMGFDS"
FT   gene            complement(318539..319159)
FT                   /locus_tag="Tfu_0285"
FT   CDS             complement(318539..319159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0285"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54323"
FT                   /db_xref="GOA:Q47T94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T94"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54323.1"
FT                   /translation="MSYKANILLVDDREENLTALEAILSSLDQNLVRANSGEAALKALL
FT                   ERDFAVILLDVVMPGMDGFETATHIKQREKTKDIPIIFLTAEGIDRHRVFRGYASRFVD
FT                   YMTKPLDPWLLRAKVEVFLELDRLKRQLHSQTELLRRDLSSSAAGVEMVVAELSALVNE
FT                   LNDTLEEVRERSAGDQRVLDMVQELDAPTQRLTRLVQALRPQR"
FT   gene            complement(319162..323382)
FT                   /locus_tag="Tfu_0286"
FT   CDS             complement(319162..323382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0286"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54324"
FT                   /db_xref="GOA:Q47T93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T93"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54324.1"
FT                   /translation="MPRLMPRMKNRTLTESELDALLDALYRMRDGDFTVRLSPRGATRF
FT                   SEVARVLNEVFDQCEQLSNEVQWVSETVSTDGRLSERVSISPARGSWGQSVRALNQMLD
FT                   EVSEPVTAVARILDSVANGDLSQRVDLASRHGELHGDLLRLATSVNRMADQMSEFAGEV
FT                   TRVAREVGTEGKLGGRANVKGVSGIWKDLTDNVNSMADNLTNQVRDISQVTTAVARGDL
FT                   TKKVTVDVQGEMLQLKDTVNTMVDQLSTFADEVTRVAREVGTEGKLGGRANVKGVSGIW
FT                   KDLTDNVNSMADNLTNQVRDISQVTTAVARGDLTKKVTVDVQGEMLQLKDTVNTMVDQL
FT                   STFADEVTRVAREVGTEGKLGGRANVKGVSGIWKDLTDNVNSMADSLTHQVRNISQVTS
FT                   AVAAGDLTKKITVDAQGEILELKDTVNTMVDQLSAFADEVTRVAREVGTEGKLGGQAHV
FT                   SGVSGVWKDLTDNVNSMANNLTHQVRQISVVTTAVARGDLTKKVTVNAKGEILELKDTI
FT                   NTMVDQLSTFADEVTRVTREVGTEGKLGGRANVKGVSGIWKDLTDNVNSMSHNLTTQVR
FT                   NISQVTTAVARGDLTKRITVDAQGEMLELKDTINTMVDQLSTFALEVTRVGHEVGIEGK
FT                   LGVQAKVAGVSGVWKDLTDSVNELAKNLTTQVRAIASVASAVARGDLTQSIQVSARGEL
FT                   ATLKDNVNLMVSNLRETTAAQRDEDWLKSNLARLSGLLQGRRDLNELARLIMTEVTPLV
FT                   DAQHGACYLPEDENDTETFRLYAGYGYQPSEERRRITAGQGLAGEAIAQRKELIVHNVP
FT                   GDYVRIESGLGEAPPLSLAIFPIVSEDRVLGVIELGSYGTFREIHLNFLRQLVSLLSAT
FT                   ITTILANSKTEYLLAQSQQLTTALQERSNELQRQQEELRRKNAELHSKAGQLASQNRAI
FT                   ELQNRQIERARRSLEDRAHQLQVSSKYKSEFLANMSHELRTPLNSLLILARLLADNSEK
FT                   NLTPKQVEFAQTIYKAGSDLLQLINEILDLSKVEAGRMELNPSHVSISQLVDYVEASFR
FT                   PLASEKGLAFAVEVSPDVPDQLWTDEQRLQQVLRNLLSNAVKFTSSGEVRLVIEPAWAV
FT                   EDIDVDTFTDPDEVIAFSVIDTGIGIPEDKLQLIFEAFHQGDGGTSRRFGGTGLGLSIS
FT                   RNMAELLGGEIRVSSTVGEGSTFTLLLPVRLPEGTSERMYRSLSDADVVTSFDRPTDTV
FT                   VLPTETPGPKAADTDPLASSEDEPYVPVLTAESVPQAAGGPQQDDVLAGKRVLIVDDDI
FT                   RNVFALASALEAHGLEVLYADNGREGIAKLEANEDIDLVLMDIMMPELDGDATTRMIRE
FT                   MPQFADLPIISLTAKAMRGDRENSLAAGASDYVSKPVDLDHLLNVMRRWLDRGKSDNST
FT                   SREQ"
FT   gene            323675..325906
FT                   /locus_tag="Tfu_0287"
FT   CDS             323675..325906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0287"
FT                   /product="Protein phosphatase 2C-like, withe GAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54325"
FT                   /db_xref="GOA:Q47T92"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T92"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54325.1"
FT                   /translation="MPHSVTKTVRREFSPTPETVGEARTFVKDTLQHWEVQRSADEIVL
FT                   LTSELVTNAVVHAKTTLELTVSLIGSDVEVVVADRVPHQALPKAGPLRVVLSSDEDSRG
FT                   GLGLALAEAIADTWGVSYSRDDKAVWFRISTQERTKETARSSLSPPRSIRSHPRSSPPE
FT                   PWARLDALLSARLSPSELLERIVEHVRVVLGGDAAYIALATADHTEWEMAAAVGLSAGP
FT                   WRPFRSRIEETFPAATPEARPMINDDLMIASAHRGVLAAAGMRSLVTAPLSVDGRITGL
FT                   IGVASRRVRHFGKNAARRLQEAADRIALTVERARLAQVEIHRRAALSFLAEANDLLSGT
FT                   LDEQMTAALAAQLSTSRLGHWCVVHTVDELGTHQLAFAMHRDENVTDILRDLVTALMPE
FT                   ERRDPGPLWPVEKVVAAGLGDELSLELAQGPGISLPLTAYGRILGRITIGRDVGEDFPK
FT                   EDVDLAADLAQRVSSAMENARLYSAQTSMSEALQRSLLPAREKQPVVPGVDYAVFYQPA
FT                   GERTVVGGDFYDLFATDGRWCFAIGDVCGTGPEAAAVTGLARHTLRALAREGFSPAHIM
FT                   HRLNFAILEESLTIRFLTMLYGEMTPIGPNAERGMHIRLVSAGHPLPLRLNRHGEVTTL
FT                   ATSQPLLGAFEDVEFFTETVEVEPGDVLLAVTDGVTERRNGDEMLGDEGLVEIFSRCSG
FT                   LTAQAVISRIGRELEAFAPGGHTDDTAMLVLRFLEPRPAEQQERMLLGG"
FT   gene            complement(325968..326573)
FT                   /locus_tag="Tfu_0288"
FT   CDS             complement(325968..326573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0288"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54326"
FT                   /db_xref="GOA:Q47T91"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T91"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54326.1"
FT                   /translation="MIRVVLADDERLVRGAIATLLNLEDDVEVVAEVGRGDEVVATVVK
FT                   HRADIAVLDVEMPGMTGLEAAAALHQEVPSCGILILTSFGRPGYLRRALAAGARGFLAK
FT                   DAPVDQLAGAIRTVYRGGRFIDSELAADAMMAGENPLTAREIDVLRAASTGASVAAIAR
FT                   TLHLSEGTVRNYLSSAISKLGEANRIAAIRKANAMGWL"
FT   gene            complement(326570..327841)
FT                   /locus_tag="Tfu_0289"
FT   CDS             complement(326570..327841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0289"
FT                   /product="putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54327"
FT                   /db_xref="GOA:Q47T90"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T90"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54327.1"
FT                   /translation="MPRSPSHWSDIPQADERSMRRLRITRWFVLICVALYAVFILVMAL
FT                   VQVELAFTSPEEVQWGPLSWSGMTLPWYAALLLVLAGAVAVLTVLLVRCRINGRRSCPP
FT                   ALLYWSLGVLLALVSVMDVTVFSVAIVATWWSAAILVIPRRTAVLLSTAVVGFLISYTL
FT                   VLSSQPSVVALAFIILNLPMALLNAAGSFSVVWLWEVAREATLAREARARLAVSEERLR
FT                   FARDMHDLLGHSLSGIAVKSELAARLARSDPERAAAEMAEVQRIAREALREVRAAVSGY
FT                   RAVNLADELASVRSVLLAAGVSATVTGNPADIPAQSQSLIAWLVREGATNVLRHSSAQR
FT                   CDITLSRQDRTWVVEVYNDGVRAGKATRFGNGLTGLSERVASAGGTLTASHTCNGGFLL
FT                   RAVLPVPASVEEPVRETQEKKAVA"
FT   sig_peptide     complement(327686..327841)
FT                   /locus_tag="Tfu_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.780) with cleavage site probability 0.613 at
FT                   residue 52"
FT   gene            complement(327914..328771)
FT                   /locus_tag="Tfu_0290"
FT   CDS             complement(327914..328771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0290"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54328"
FT                   /db_xref="GOA:Q47T89"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T89"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54328.1"
FT                   /translation="MTTATAATPPASDSQTPRKPVSVLRQALRLTRTEFTLFYRYQMAL
FT                   YSAALPLIFLLPLSVFEPYDVLPGVDTTVLSLTWFFPIAALTVGLSHVPNVYAIRRERL
FT                   ILKRLRVSGVTPAAIFTSTVLSVFSVVVVQTVLVAALLAALKEVFPTAPVLFLVSLALT
FT                   TVVMVLLGVLIANFARNGESAQIISMVPFFLLIMLSGLFVPVDLLPDGIAMTIGLLPML
FT                   PAVRLAQSAYLGYDLFDGISNAEAATGVDLWLAAGPSLLILVAWMVLLTLLLRIFQWDP
FT                   RVNK"
FT   gene            complement(328804..329778)
FT                   /locus_tag="Tfu_0291"
FT   CDS             complement(328804..329778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0291"
FT                   /product="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54329"
FT                   /db_xref="GOA:Q47T88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54329.1"
FT                   /translation="MNTTSQNRSVAIHVSDLHQSYGSFEAVRGVSFTVAPGELFALLGT
FT                   NGAGKTTTIETLEGFRRPTRGSVRIFGIDPFGQPPELRPRVNAVLQHSGLFEELTVTES
FT                   IELARDLADDPMDTAEVLEAVVLADKARNTVRSLSGGERRRLDLGLAILTRPDVLFLDE
FT                   PTTGMDPEMRRETWKIISSQVARGAAVVLTTHYLEEAERLADRLAIMHRGEIRVSGTVS
FT                   EVVSQWGDRISFRLPSHIRSRELPELPGAELTIDVRGDHQWAVYTVTTGTDPATRTHHA
FT                   LLPLLKWAEERSLDLERLESRPASLEDVFLAVAQGDVTDLVDL"
FT   gene            complement(329916..331067)
FT                   /locus_tag="Tfu_0292"
FT   CDS             complement(329916..331067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0292"
FT                   /product="PAS"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54330"
FT                   /db_xref="GOA:Q47T87"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54330.1"
FT                   /translation="MPEHLAKLEDAIAELRDRIAALRATHAMYPDDGATTAEAALAELG
FT                   FAERLLRECGERLATLVSPATVRRNDNERTLLRAIFHELSIPVVLLDHEGYIRRINAMG
FT                   AKLLDSTPGYLAGKPFSIFVDLRSRAALRSWQAAVSQGGETASFDSRLARRGYVEDVRL
FT                   TISRLDVPSEPNPLLLVAMSPSLHPSSDTGPAPLETEVEDQVVVLAARRLDVLTRMTRL
FT                   LLRSVGSSRTGTPLVLDEAAALLADSYADWVVIDLCEAPGKPDRLRRTAVAGPSGSELN
FT                   GLVRSLEPDAAPLPREVLTTSKTVLRQLIDDETEFGATLDGLPVLSALRARSLLCVPLR
FT                   DHDDVVYGALTLIRCSNRSSFRLADQGLLEEIGEHIGMALAKA"
FT   gene            331295..332044
FT                   /locus_tag="Tfu_0293"
FT   CDS             331295..332044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54331"
FT                   /db_xref="GOA:Q47T86"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T86"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54331.1"
FT                   /translation="MWVERLARGIGELAQIVDGARDRVLDQVSQLMVRHVPECSAALVV
FT                   VWRDTHPEERDPSVDFKGRHVVVDYAASHSDLATAFEYQYETGQGPTVQAVRERHTVVV
FT                   ADILRDERWPEYPSMAVQCGDHSSITYPCDLDGEILTLGVHTCRGNRLSPDTMVLPLAM
FT                   LAEHVVTTLRSLGRDADALREAVHMRRAMSARTVIDQAKGILMHARGLTSQQAFEELRK
FT                   VAQRNGMKVTDVAQQLMAEQALSNGRR"
FT   gene            332307..332678
FT                   /locus_tag="Tfu_0294"
FT   CDS             332307..332678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0294"
FT                   /product="anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54332"
FT                   /db_xref="GOA:Q47T85"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T85"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54332.1"
FT                   /translation="MSAEFDIATRTEGDVVVVAPKGDLDAGTSQVLAETLETVIGAEES
FT                   CRGIVLDFSEVASCDSRCIGVLLASYRHARDRGIGLVVASSQGMVRRLLMIAGIDQVIA
FT                   LEEDVARAVAGMRAAEAPR"
FT   gene            complement(332876..334117)
FT                   /locus_tag="Tfu_0295"
FT   CDS             complement(332876..334117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0295"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54333"
FT                   /db_xref="GOA:Q47T84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T84"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54333.1"
FT                   /translation="MKIALIATHATPIPAHKGDPTDSESLYLCHLARNLAALGHRVTIH
FT                   TRCTDPQTSERTRMGRSVVVAPIVAGPRRPLREQEYIEHTGTFARRLTEQLRADPPDII
FT                   HAFGWSSGLAALAAVRDLERDIPVVQTFHSLNVSEQRVGLPANPQRVRLEAALAHHAKA
FT                   VLVNSADQRFELARMGVPRSRVCIVPFGVDTDQFTVEGAAHGPWQRRRSAAGRPLRIIA
FT                   VTRLDPLGGVDTLIRTMARLPDGELLIVGDPAPEHLAIDPNAQRLERHAKEAGVNDQVT
FT                   LTGAVTRRDLARMLRSADVFVSTAFYDPYGSAVLEAMACGLPVVARAVGGITGAMLDGT
FT                   TGVLLRSAHPSTLAHVLRQLAADTTQRTAYGIAGADRAASRFTWARVAAETERIYQKLL
FT                   PTTPELPLASGNGA"
FT   gene            334783..335232
FT                   /locus_tag="Tfu_0296"
FT   CDS             334783..335232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54334"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T83"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54334.1"
FT                   /translation="MTRRPLCSEGQCREERREGRRHGTRNSSVPPRTSATGGSGTGDRA
FT                   PAETPRVRTRNPRSAPGDAAARLPTSLSCGGSPRKIPPLGVLRHGSGAGRKSCPKRGEP
FT                   PCVDGHHTRRRETSGQQSPLRFPSMRTETHRQRGDSGGRGDGRFV"
FT   gene            335442..336206
FT                   /locus_tag="Tfu_0297"
FT   CDS             335442..336206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0297"
FT                   /product="Protein phosphatase 2C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54335"
FT                   /db_xref="GOA:Q47T82"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T82"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54335.1"
FT                   /translation="MGVARGAVEVTVLTHRGAVRQANEDAVVMGALTVAGAEMNAPVHC
FT                   WLPLADPVVVAVADGLGGHAAGEIAAEHAVHRMAESSAQLTGPEAVGLLLKHIDDEIKE
FT                   HAGQHVEFSGMGTTVAGVLLTPDANYWFNVGDSRTYRLKGSQLIQLSEDDSPVLPPGED
FT                   GRPVTTNYITQSLGGSGNSTIVPHVGQDTEPGPGAWLMCSDGLSDLVPLEEMERIIAEA
FT                   GDDNIAVYNLWQAAMNASGRDNISILLVRRHS"
FT   gene            complement(336271..336903)
FT                   /locus_tag="Tfu_0298"
FT   CDS             complement(336271..336903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0298"
FT                   /product="similar to Cu resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54336"
FT                   /db_xref="GOA:Q47T81"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014755"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T81"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54336.1"
FT                   /translation="MSAFSASSPGGRIIALVTGLLTALALSLGVAPTAHAHNTLVSSSP
FT                   EDGATLDSLPEKVVLTFNAEVLEGGNGIVVTGPDGTNYASGDVVIDGVEASIDLEPLTQ
FT                   PGEYTVEYRIISADGHPLSDTFTFTVDESAIPEPTESPAAEQPEEEEPTPAPAETEGTE
FT                   SEDSTSTTGVGLSGPLGAILGIVLGIGVIAVIAITIIRLRRRPGSGD"
FT   sig_peptide     complement(336793..336903)
FT                   /locus_tag="Tfu_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.799 at
FT                   residue 37"
FT   gene            complement(337112..337378)
FT                   /locus_tag="Tfu_0299"
FT   CDS             complement(337112..337378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0299"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54337"
FT                   /db_xref="GOA:Q47T80"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T80"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54337.1"
FT                   /translation="MNRLYHESEDWVRQGACRNYDPELFFPVSTTGPGRETVELAKAIC
FT                   RSCTVRRDCLRWALRAGEAHGVWGATTPEERRYLRRELSLTVN"
FT   gene            338033..338605
FT                   /locus_tag="Tfu_0300"
FT   CDS             338033..338605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0300"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54338"
FT                   /db_xref="GOA:Q47T79"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T79"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54338.1"
FT                   /translation="MFGQQAPSEDRHSSDTESNHSLKAGEAADVALEPPTLDDGRQLWA
FT                   LARISDLDVNSPYAYVLWCRDFAATSLVARDSTGTIRGFVTGYVRPDAPDTYFLWQVAV
FT                   DPAFRGRRLARRMLDRISSCITERGIRYLEATVTPGNTASRALFASFARARSAALSWTP
FT                   LFDRGHFPAELPEQHEPEDLVRIGPLR"
FT   gene            338679..339944
FT                   /locus_tag="Tfu_0301"
FT   CDS             338679..339944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0301"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54339"
FT                   /db_xref="GOA:Q47T78"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T78"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54339.1"
FT                   /translation="METFSRLESEVRSYCRGWPTLFTRARGSRVYDHTGRGYLDFFAGA
FT                   GALNYGHNNPTLKTALLDYLGSDSIVHSLDAATTAKRDFLDTFEEVILKPRGLDYKVQF
FT                   PGPTGTNAVEAALKLARKVTGRETVISFTNSFHGMTLGALAVTGNSMKRGGAGVPLNHT
FT                   VTMPFDNYMDGQVPDFLWLRSLLEDSGSGLDRPAAVIVETVQGEGGINVARADWLRGLA
FT                   ELCREHELLLIVDDIQMGCGRTGPFFSFEEAGIVPDIVTLSKSISGYGLPMALTLFKRE
FT                   LDVWEPGEHNGTFRGFNPAFLTATVALNTYWRDDSLERETLAKGQLITERLEAIAAEHA
FT                   EAGASVRGRGMACGLVLPGEGDARRVCAEAFERGLLMETSGPEDEVAKLLPPLTTSVAE
FT                   MEEGLDILAESVRAAVRTPQPA"
FT   gene            340103..340507
FT                   /locus_tag="Tfu_0302"
FT   CDS             340103..340507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0302"
FT                   /product="putative condensing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54340"
FT                   /db_xref="GOA:Q47T77"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47T77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54340.1"
FT                   /translation="MIVRSLDDINGTDADVVTENWRSRRIVLARDGVGFSFHETVLYAG
FT                   TETSMWYANHIELVHCIEGEAEVTNDETGETFLITPGTLYLLNGHERHTVRPKTDFRVL
FT                   CVFTPPVTGREVHDENGSYPLLTEDATDTD"
FT   gene            340679..341569
FT                   /locus_tag="Tfu_0303"
FT   CDS             340679..341569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0303"
FT                   /product="bacterial extracellular solute-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54341"
FT                   /db_xref="GOA:Q47T76"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014337"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T76"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54341.1"
FT                   /translation="MTDHGTVSRRGLFRAGGIGLAAIAFGPALAACSRTEDTVTLDSLR
FT                   KQGYIQVAINNEAPFGYIDENGEVTGSSPELLRAIFAELGVPEVRAESVAWDGLIPGLK
FT                   AKRFDAVAAGMYITPERCAEVAFAEPTYRVLQAFLVPAGNPHGLTTFDDIAANPDVTVA
FT                   VLNASVEQGYAKGAGVPEAQIETVDNQTSAYELLSNGRVDAVALSTLSLNRLLNQRGGD
FT                   FEVTEGFIPVVDGEEVTPAGGLAFRQSDTELLAEVNRVLADFKASGRLLEILEPFGFTE
FT                   QELPGDLTTEQLCQA"
FT   sig_peptide     340679..340774
FT                   /locus_tag="Tfu_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.935) with cleavage site probability 0.608 at
FT                   residue 32"
FT   gene            341584..342306
FT                   /locus_tag="Tfu_0304"
FT   CDS             341584..342306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0304"
FT                   /product="amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54342"
FT                   /db_xref="GOA:Q47T75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54342.1"
FT                   /translation="MEFLIDRLPLYLSGAGTTLLITLLGAVLAFALAMVVGVMGTLRNP
FT                   VARAIATGYTETFRGVAALVLMYWMAFAIPQLVPYKIDALFAAVLALGLNVGAYGAEVV
FT                   RAAINAVPKAQVEATIALSMSWWRRMRAVVLPQAWAQMLPTFGNLVIELMKATAIVSLI
FT                   GVSDLTRVAQEQRASTGETVAAFTGALIAYFLIAQLLIVGMRLLERRANRRLGRPVATG
FT                   FLALLRPPPATATGGGRR"
FT   sig_peptide     341584..341679
FT                   /locus_tag="Tfu_0304"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.380 at
FT                   residue 32"
FT   gene            342303..342941
FT                   /locus_tag="Tfu_0305"
FT   CDS             342303..342941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0305"
FT                   /product="amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54343"
FT                   /db_xref="GOA:Q47T74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T74"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54343.1"
FT                   /translation="MTWDWEFTGRIIPDLLNGLAVTVQATVLGYTLALVLGLAVALVRR
FT                   IPVIGTAVFAVMEFIRCTPLLVQLVFVFSLAPNTLSAFTIGVAVLGVHYAAYTAEVYRS
FT                   GIEAVPAGQWEACRALSLPLHRTWGAVILPQAIRRVIPPLGNYLIAMFKDTPLLFAITV
FT                   GELMYQASQIGGVYFRYLEAMTLVGLFFLLVSVPSAILIRQLERRYAAV"
FT   gene            342928..343731
FT                   /locus_tag="Tfu_0306"
FT   CDS             342928..343731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0306"
FT                   /product="ABC-type polar amino acid transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54344"
FT                   /db_xref="GOA:Q47T73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T73"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54344.1"
FT                   /translation="MPQSDPRTSTGTHEPLIRFDQVVKRFGSLTVLDRLDFTVAPGERV
FT                   TLIGPSGSGKTTILRLLMTLEQVTSGVIWVGGEPLSHRYQGDRLVRANEKHQRRVRKQI
FT                   GMVFQQFNLFPNMTVRQNITEGPIHSLGISREEADQRARELLEMVDLSDKIDAHPAHLS
FT                   GGQQQRVAIARALAMRPKILLLDEVTSALDPELVTGVLDVLRTVAETTDITMLLVTHEM
FT                   QFARDVSHRVLMFDHGRIVEEGPPEQIFGDPKEERTKAFLHAVLD"
FT   gene            344525..344725
FT                   /locus_tag="Tfu_0307"
FT   CDS             344525..344725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54345"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T72"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54345.1"
FT                   /translation="MSAVHAPYVEAELGPIPLALTATAVTLLALLVLYLVGFDQGAVSR
FT                   TGMFLHELMHDGRHLMGVPCH"
FT   gene            344716..345510
FT                   /locus_tag="Tfu_0308"
FT   CDS             344716..345510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54346"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T71"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54346.1"
FT                   /translation="MSLTSATPSASVRPLRGTYLRLLVRGLLAGLLAGLAAGVVAFFLG
FT                   EPHIEAAIALEEHASHDHGAHGGHSHGDDALVSRTGQQVGLFLATGFAGMSLGVLYASV
FT                   LYAVRRHSRLSGPALALVAAGLGWAAIAAVPFVKYPANPPAVGVPETIDQRTLLWVAAV
FT                   LLGLVAVTAAVALARALPAETSLTSRIVASLAVFLAVVCVGYLALPHINDVGEDFPATL
FT                   LWEFRMASLATQASLWLVLGLAFAWLTERFDRRFAAQTVGVR"
FT   sig_peptide     344716..344871
FT                   /locus_tag="Tfu_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.781 at
FT                   residue 52"
FT   gene            345507..347012
FT                   /locus_tag="Tfu_0309"
FT   CDS             345507..347012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0309"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54347"
FT                   /db_xref="GOA:Q47T70"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T70"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54347.1"
FT                   /translation="MSKAQGLLVAGTSSDAGKSLVTSALCRALARHGIKVAPFKAQNMS
FT                   NNSMVVPGPDGTGAEISRAQWVQALAARAEPETAMNPVLLKPSSDRGSHVVLRGRPFGR
FT                   LAAGEFAGTRAVLAEAAYAALAELRSRYDVVVCEGAGGVAEINLRAHDYINMGLARAAD
FT                   LPVIVIGDINRGGVFASLYGSLALLDPADQALVAGFVINKFRGDPSLLDPALKTLEDLT
FT                   GRPVLGVLPWQQNLWLESEDSLALTAREDGSAGTPVLRVAVVRLPRIGNTTDVDALGVE
FT                   PGLRVDFVTSPRLLASADIVVLPDTRAVLTDLEWLRSRGLADAIANHARHGGTVLGIGG
FT                   GFQMLGRTIVDAEGVEGPAGRTVAGLSLLDLETVFTRNQTLNYSSGTWQGIPVGGYQSH
FT                   YSRIQTGDGEAFPGGLRNGSVFGTMWHGSLEHDAFRGAWLAAAAENAGYDGSEYGQVCF
FT                   AEVRDAYLDRLGDLAEEHLDMDAVLRLITEGAPKLPTVRGELR"
FT   gene            347009..347755
FT                   /locus_tag="Tfu_0310"
FT   CDS             347009..347755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0310"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54348"
FT                   /db_xref="GOA:Q47T69"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T69"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54348.1"
FT                   /translation="MKVLILGGTAEARALAEAFVAAGIPVLSSLAGRVSHPRLPAGEVR
FT                   IGGFGGAAGLAGFLRSNGITRVVDATHPFAIRVSTNAAEACTQAGVPLLRLVRPGWENE
FT                   PAASRWIWVDDHDEAAWQAARLGRRVLLTTGRQTLHHFIGPLAEHTVLARVVEDVELAL
FT                   PPTWILIRSRGPYTCAGERKLMAEHAVEVLVTKDSGGVHTRAKLDAADELGVSVVVVRR
FT                   PLYRGDVPTVADVPAALEWLGLSQTR"
FT   gene            complement(347981..349405)
FT                   /locus_tag="Tfu_0311"
FT   CDS             complement(347981..349405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0311"
FT                   /product="cobyrinate a,c-diamide synthase /
FT                   hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54349"
FT                   /db_xref="GOA:Q47T68"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47T68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54349.1"
FT                   /translation="MSGDVPAAVLPRLVISAPTSGAGKTTVATGLMAALRAAGYDVSGH
FT                   KAGPDYIDPGYHSLATGRPGRNLDVHLHGENLLGPLLLHGASHPRPADLAVIEGMMGLY
FT                   DGKLGGRGFASTAHVAALLDAPVVLVVDVSHVSRSAAAIVAGMAVFDQRIRIAGVILNR
FT                   VGSRRHAAEVASAVEDVGVPVLGALRHDSGLAVPSRHLGLVPAEERAEAVAAVELLAER
FT                   IAAQVDLTAVVEVARSAPPLHAQAWSAQEALRAAGFHPVSAQRDHPVVAVAGGQAFTFR
FT                   YAEVEELLRAAGCRPVVFDPMSDPALPDGTAGIYLGGGFPEVYAAELAGNTALRTALRD
FT                   AVRSGVPTVAECAGLLYLCRDVDGAPMVGALDAVGRMTSRLALGYYSALAPAETLVAAE
FT                   GDRVPGHTFHRTTVTSTGEQAGPAWLLDGQPDGFSSDPAGIGRPTLHASYLHTHWAGCP
FT                   QAAARFAAAVSTQRPC"
FT   gene            complement(349395..350009)
FT                   /locus_tag="Tfu_0312"
FT   CDS             complement(349395..350009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0312"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54350"
FT                   /db_xref="GOA:Q47T67"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54350.1"
FT                   /translation="MPQGQPSFIPDDGLTTRQRRYRPLLIVHTGDGKGKSTAAFGLALR
FT                   GWNQGWRIAVFQFVKSAKWRVGEQTAFDTLAAVHRAQGVGGPIEWHKMGSGWSWSRKPG
FT                   TEADHAAAAAEGWAEIKRRLAEQRHDLYILDEFTYPITWGWVDVNDVVSTLRERPGRQH
FT                   VVITGRRAHPALLDAADLVTEMVKVRHPMDSGQKGQRGIEW"
FT   gene            complement(350009..352030)
FT                   /locus_tag="Tfu_0313"
FT   CDS             complement(350009..352030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0313"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54351"
FT                   /db_xref="GOA:Q47T66"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54351.1"
FT                   /translation="MEERVHVYPFSAIVGSDDLVLALILTGISPDIGGVLIRGEKGTAK
FT                   STAVRAQAALLPPITVVTDCRFSCDPAAPDPDCPDGPHPPSVASATRPVRLVELPVGAG
FT                   EDRVVGSLHLEKALSGSGVEYEPGLLARANRGILYVDEVNLLHDHLVDLLLDAAAMGRA
FT                   TVERDGVSLSHAARFTLVGTMNPEEGELRPQLLDRFGLSVEVAAPRDPAVRAEIIRRRL
FT                   AFDADPAGFTSAYATAEQQLAERIADARLRLPKVVLGQEALLAIAEVCAAFDVDGMRAD
FT                   LVCARAAVAHAAWCGRTDVTRADVRAAARLALPHRRRRTPFDSPGMDEGLLDEILGEDH
FT                   DPDPGPDGSGGPGGPPSDSGSDTPPPTAGSTPDPPASGLGSPTSSNDDPRPDAPAPVSV
FT                   TAPEEPYRPRLFTVAGTGKGTLGRRSRAITTSGRTVGDVPAGRGTGPIHLAATVRTAAL
FT                   RHATSRSSPDTTRLSIALSDLRRSLCEGKESNLVLLCVDASGSMAARRRMSQVKTAVLA
FT                   LLLDAYRRRDRVGLITFRNHEATLTLPPTGSVDVAAARLRELPAGGRTPLAEGLLKAAE
FT                   TLRRERLRDPDRRALLVVVTDGRATAGPKAVERSLHAADHLAREGVSALVIDSETGRFR
FT                   MGLAAALARRMGAEYVHVGEVSAEAITSAVAGATTRAA"
FT   gene            352324..353541
FT                   /locus_tag="Tfu_0314"
FT   CDS             352324..353541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0314"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54352"
FT                   /db_xref="GOA:Q47T65"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54352.1"
FT                   /translation="MKTPVTVVGIGADGWEGLPPASRDAIREAQVLLGGTRHLALVPDT
FT                   GAVREPWPSPLLSGLPMLLDRYRDRRVVVLASGDPLLSGIGTTLVRLLGADRVRVLPAV
FT                   SSVALARARMGWSAESVDVVTLVGRDVDAVRRYLTPGRRLVVLSSDGTTPAAVAARLVE
FT                   HGLGDSRMTVLSDLGSSREERIEATAAEWRGRDAPPLNVVCVAVTGNGGYPLTPGLPDE
FT                   AFDHDGQLTKREIRIAAVCALRPQPQALLWDVGAGAGSVAVEWLRADPRCRAVAIERHP
FT                   ERVHRITRNAARLGVPSLRVVHGSAPDALSGLEPPDAVFVGGGATDPSVLDRCWAALRP
FT                   GGRIVVHAVTLETEAVLVERWRRHGGELTRLSVERAAPLGSFTGWRPARPVVQWAATKT
FT                   DQGRET"
FT   gene            353538..354308
FT                   /locus_tag="Tfu_0315"
FT   CDS             353538..354308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0315"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54353"
FT                   /db_xref="GOA:Q47T64"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T64"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54353.1"
FT                   /translation="MTVHFVGAGPGAADLLTLRAVELLRTTPVCLYAGTYIDAEILAHC
FT                   PDDAELVDTQHLDLDQIIAHLVDADRRGLDAVRLCSGDPSLYSALTEQTRRLDEAGVAW
FT                   DVTPGVPAYAAAAALLGTELTVPEVAQTVVLTRTRARSTKMPESEALENVAKIHGTLVL
FT                   HLAIRHIRVLAEQLVPEYGADCPVAVVAHATRPNELVLRGTLTDIADHVEAAGLRHTAV
FT                   ILVGRALASREWDVSEIVCSHLYDPARERNREAS"
FT   gene            complement(354564..356099)
FT                   /locus_tag="Tfu_0316"
FT   CDS             complement(354564..356099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0316"
FT                   /product="precorrin-2 C20-methyltransferase / precorrin-3
FT                   methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /EC_number="2.1.1.131"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54354"
FT                   /db_xref="GOA:Q47T63"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54354.1"
FT                   /translation="MSSTPGRLYGVGLGPGDPEFITRKAARLIAEADVIAYYSGTHGRS
FT                   IARSIAADVIPEGVIEEKLVYPVTTGTTDHPGGYEGAITEFYDASAQRLAAHLSQGRDV
FT                   VVLCEGDPLFYGSYMYLHDRLASRFPTEIVPGVTSISAASAAAACPLVRRTDVLTILPG
FT                   TLPPPELARRLADTDAAAVLKLGRRTFAGVREALAQAGRLEDAVYVERASMAEQRILPV
FT                   GDVASDDVPYFSLILSSGDSTPRNRRPRGRVRAPQRTPAPHHPDSPAELLVVGLGPAGE
FT                   QWLTPEAAQALANVDHVVGYGPYVDRVPVRPGQQRHSSGNTVELDRARFALDLALAGER
FT                   VAVVSGGDAGVFGMASAVFEAAQDPRYADVPVRVLPGLTAVQAVAARAGAPIGGDFAVL
FT                   SLSDRLKPWEVIEARLEAAARADLVLAIYNPASRSRRTQVARARDVLLRHRRDNTPVVV
FT                   GRDVGREGESVEVTTLGKLDPEGIDMRCLLIVGSSSTSVTAAGAVWTPRFVAE"
FT   gene            complement(356096..356770)
FT                   /locus_tag="Tfu_0317"
FT   CDS             complement(356096..356770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0317"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54355"
FT                   /db_xref="GOA:Q47T62"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T62"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54355.1"
FT                   /translation="MTPHSDRPTPLSPPPRRYTYETDSATIYAHSFATIRAEADLSGLP
FT                   TDAEKIAVRMIHACGQTDLARDLVIHPNLVPAARDALRGGAPILTDARMVASGVTRSRL
FT                   PADNEVLCLLNDPRVPQLATAWGTTRSAAAVSLWTDRLAGAVIAIGNAPTALFHLLELI
FT                   DSGAPRPAAIIGVPVGFIGAAESKEALMSHPAGIPYLVVRGRRGGSALAASAVNALAQE
FT                   EE"
FT   gene            complement(356767..358086)
FT                   /locus_tag="Tfu_0318"
FT   CDS             complement(356767..358086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0318"
FT                   /product="cobalamin biosynthesis protein CobG, precorrin-3B
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54356"
FT                   /db_xref="GOA:Q47T61"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T61"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54356.1"
FT                   /translation="MAAGWFPQAKLDDSSITVARAAPVLHRSSRSPRRDHHSAGQESVC
FT                   NHVPVFCLQPPDRCPGVLRPHFAADGALLRIRIPGGHISRRGIATLSQITAKFGDGNLH
FT                   LTSRGNVQIRGIPVTDDQQIPNELPHIVAASGFLPSSTHDRVRNIVASPLSGIIGGRMD
FT                   VRPLVSALDRALCTDPRLAELPGRFLFGLDDGRGDLAGMPIDLGIYAIDERSAQIRVGT
FT                   FSGPVISSTEIVDIILDLAHRFLDISEGKWNVVQLPKKGRELLNNVEFSNFLRHTKSGD
FT                   RWSVERFRRNILHGIITISTAESAVAGSVPLGVLTPPMQRALLDAAEHSDSTIILTPWR
FT                   GVIVTPVPTDQASNVAALLQEAGLVLDPASPWSRISACIGSPGCARSRGDTRSQAVKLV
FT                   RRLSSPDTSDDGSPYHIAGCERACGAPHTPHTLVLLGSST"
FT   gene            358269..361898
FT                   /locus_tag="Tfu_0319"
FT   CDS             358269..361898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0319"
FT                   /product="hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54357"
FT                   /db_xref="GOA:Q47T60"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54357.1"
FT                   /translation="MPRIALLSTSDTDLLSARASGANYVWGNPSRLDVTGTDPGSLHAL
FT                   LHGADLVIVRILGSARSWQEGLDQVLTHGVPVVVLGGEQTPDAELMSHSTVPVGIAAEA
FT                   HRYLAHGGPDNLAALHAFLSSTVLLTGGSFDPPTELPEWGLLERSTPPQADRDGLPRIG
FT                   ILYYRAHQASGNTRFVHDLADAVDATGEAVAVPIYCTSLRSASPELLAELGTLDALVVT
FT                   VLAAGGTRPATASAGGDDEAWDVGELARLDIPILQALCLTWGRDQWKASDEGTSPLDSA
FT                   SQIAVPEFDGRIITVPFSFKEFDDEGLPHYVTDAERCRRVADIAVAHARLRHIPPAQRR
FT                   VAIVLSAYPTKHSRVGNAVGLDTPVSAVRLLRAMRDAGYDLGDGFPGVDLADETEAGNT
FT                   LIHALIEAGGQDEEWLTAEQLAGNPVRIPAERYREWIADLPGELIDAVNEHWGEPPGTL
FT                   FVDNGDIVLATLQAGNVVLMIQPPRGFGENPVAIYHDPDLPPSHHYLAAYRWLECGFGA
FT                   HAIVHLGKHGSLEWLPGKNAALSAACATDAALGAVPLIYPFLVNDPGEGAQAKRRAHAT
FT                   IIDHLVPPMARAESYGDIARLEQLLDEHANIAAMDPAKLPAIRAQIWTLIQAAKLDRDL
FT                   GLSERPHDAEFDDFLLHVDGWLCEVKDSQIRDGLHVLGGAPVGEARVNLVLAILRAVQV
FT                   WGGQAGAVPGLRRALGLAGDTGNRAEVDAVEARARALVEAMEEAGWDPEQAQVVADRLG
FT                   ETAPDVVRVLRFAAEHVIPRLADTRQEITAVLHALNGGFVPAGPSGSPLRGLVNVLPTG
FT                   RNFYTVDPRAIPSQLAYETGKALADALIERYRAETGEYPRSVGLSVWGTSAMRTSGDDI
FT                   AEVLALLGVRPEWDEVSRRVRELSVIPLPELGRPRIDVTVRISGFFRDAFPHAVAMLDD
FT                   AVRMVAELDEPDDANYVRAHVRSDLAEHGDRERALRRIFGSAPGAYGAGLLQLIDSGDW
FT                   RSDADLAEVYTAWGGFAYGRNLHGEPSAEDMRANYRRIAVAAKNTDTREHDIADSDDYF
FT                   QYHGGMVATVRALTGVEPKAYIGDSTTPDQVRTRSLREETARVFRARVVNPRWLAAMRN
FT                   HGYKGAFELAATVDYLFGYDATAGVVDDWMYETLAQTYVLDTENQEFLRQANPWALQGI
FT                   VERLTEAADRGLWREPHPQTMEALRRVYLEVEGELEDRGTNRT"
FT   gene            361895..362683
FT                   /locus_tag="Tfu_0320"
FT   CDS             361895..362683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0320"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54358"
FT                   /db_xref="GOA:Q47T59"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T59"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54358.1"
FT                   /translation="MTRKALLIGIGPGGPDQLTVEAVRALNEVDVFLVADKEAAAGREG
FT                   TGDLVALREEICRRHITGNNYRIVTVPDPPRDRAPVADHGYGRQVRDWHAARARAYTDA
FT                   IVKHTRPDEVLGFLVWGDPSLYDSTIRVVERIRSCGVDLDYQVIPGVSSVQLLAARHRI
FT                   VLNRIGGPITVTTGRRLGTDVARGADTLVVFLDGCLSCAELPGAGWDIWWGANLGTASE
FT                   ELVAGRLGEVMDAIRAARKRAKAAQGWVMDVYLLRRAAVS"
FT   gene            362776..363249
FT                   /locus_tag="Tfu_0321"
FT   CDS             362776..363249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54359"
FT                   /db_xref="GOA:Q47T58"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T58"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54359.1"
FT                   /translation="MARLLIVHHTTSPSTQAMLEAVLEGARTDEIDGVEVVTRAALAAT
FT                   AVDVLAADAVILGTPANIGYMSGALKHFFDQVYYPCLSETAGLPYTLYVHGNNDTTGAV
FT                   RSVETIAKGMSWHRHRPPVTVVGELSRADREACWELGAVTALAAAERAASRTA"
FT   gene            complement(363317..363673)
FT                   /locus_tag="Tfu_0322"
FT   CDS             complement(363317..363673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54360"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T57"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54360.1"
FT                   /translation="MNRPAGKRRNAGEARDARSGAAGHGPAAERGFLPLGSGVFSLFHG
FT                   QQRVVPAILGRMRRERVEYIGGPLDGKIVELGPDEDVTVGAYLTIPGHTQRAVYEPVPG
FT                   DIVYRWHFLGWIDR"
FT   gene            363814..365922
FT                   /locus_tag="Tfu_0323"
FT   CDS             363814..365922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0323"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54361"
FT                   /db_xref="GOA:Q47T56"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T56"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54361.1"
FT                   /translation="MVQKKTAAVAVNAAQMLTRDRDLLPPDRFMNREIGWLRFNQRVLE
FT                   LAEDTTLPLLERALFLSIFSSNLDEFFMVRVAGLKRRLATGVPVSSRQDPREQLREISK
FT                   VTHELMERHAACFHTSVAPALAEAGIRIVRWNDLTTEEKQQMHRFFRRTIYPVLTPLAV
FT                   DPAHPFPYISGRSLNLAVRVCDPHTGRQTFARIKVPPALPRFTELGGQRFVPVEDVISA
FT                   HLPQLFEGMEILEHHAFRVTRNADLEVDEDETDDLVKSLERELLRRRFGPLVRLEVEET
FT                   ISDEILTLLREELGADEEETYRVPGPLDLSGLAQLHELDRPELKYPPMVPVEPRVLAHN
FT                   DFFEVLRRSELLVHHPYESFATTTQRFIELAASDPKVRAIKQTLYRTSGDSPIMEALIE
FT                   AARSGKEVIVLVEIKARFDEQNNIRWARKLEMAGCHVVYGVVGLKTHCKLALVVREEDD
FT                   GSLRRYCHIGTGNYNPRTARIYEDFGLFSADPEVGEDLSDLFNHLTGFSRKKHYRRLLV
FT                   APHALREALLRQIQHEIANHEQGLPARIRIKTNSLVDEEIVDALYLASRAGVPIDLWVR
FT                   GSCVLRPGVPGLSETIRVRSILGRFLEHSRIFVFANGGEPQVWIGSADLMPRNLDRRVE
FT                   VLVRIVDPGQRSRLMTLMDLAMADSTSSWHLNPDGSWTRFTHDEEGNPLVDVQSTLRGD
FT                   RYLRVVDD"
FT   gene            365915..366892
FT                   /locus_tag="Tfu_0324"
FT   CDS             365915..366892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0324"
FT                   /product="putative MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54362"
FT                   /db_xref="GOA:Q47T55"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T55"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54362.1"
FT                   /translation="MTEPPPTPDRHPDAVESAAPGGYLEPVRAAGTVLWRDTGRGREIA
FT                   LVHRPRYNDWTLPKGKLDEGEHVLVAAVRETVEETGVTPRLGRRLATQRYWKSGWPKQV
FT                   DWWAATPAPGTTAQFTPTAEVDAVEWLPAAEARARLTYPSDVRVLDDFLHGPAQTVPLV
FT                   LLRHASAGNKNEWHDYDLLRPLDEAGRAHARAVADILAVFGPLRVVSSTAARCLETVVP
FT                   YAAAHGVEIRTEHTFTVGVLRSGAQAYDPQAARQTMRALVEERQPTLVCTHGELVADLM
FT                   AEAAAQTGAPARSRWALRKGAFWVVHRDAKDGSLVAVEHHGLPG"
FT   gene            366920..367363
FT                   /locus_tag="Tfu_0325"
FT   CDS             366920..367363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54363"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T54"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54363.1"
FT                   /translation="MATQKVSRSITVNAPAERIFAILTNPRRHAEIDGSAMVSGCLHGP
FT                   ETLTAGSEFRMDMSMLGVPYRMTNRVVEYEKNRRIAWRHIGPHRWRWQLEPVDDHTTRV
FT                   TETFDYSPAGPFAILYQLAGYPARNARAIEQTLLRLKALAEAE"
FT   gene            complement(367422..368480)
FT                   /locus_tag="Tfu_0326"
FT   CDS             complement(367422..368480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0326"
FT                   /product="ABC-type spermidine/putrescine transport systems
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54364"
FT                   /db_xref="GOA:Q47T53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54364.1"
FT                   /translation="MTAPVPVVDAHLVVHHPGFTVETRFQVASGHVLALLGPNGAGKST
FT                   VLRALAGLLPAQGHLRVDGVDLLSVPAERRPVGFVFQDFLLFPHLTVVENVAFGPRCQG
FT                   MPARQARRLALDLLTDMGVAEYARARPRTLSGGQQQRVALARALATRPRLLLLDEPMAA
FT                   LDADTRMSVRAMLRCRLTAFSGATVLVTHDPLDAMVLADRVLVLEDGVSVQEGTPGDVA
FT                   RRPRTDYVARLVGVNLYRGRAAGTRVQLAGPHGSAVALTVASPHDGEVFAAFPPHAVAL
FT                   YRERPHGSPRNTWLLTVDGVERFGPHVRVRLSGAVEVNADITAAALADLSLRPGDRVWA
FT                   AVKATEVECYPV"
FT   gene            complement(368477..369298)
FT                   /locus_tag="Tfu_0327"
FT   CDS             complement(368477..369298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0327"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54365"
FT                   /db_xref="GOA:Q47T52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54365.1"
FT                   /translation="MPASSSPKPAGAPLTGRVPRLLLVPALLGFGFLVLPLFGLLARTP
FT                   WSTLGAQLFSTGVRDALLLSLATASAATVVSLVLGVPLAWLLARTEFPGRSLVRALVTV
FT                   PLVLPPVVGGVALLMVWGRNGLLGRYVAEWTGYGLPFTPAGVVAAQVFVAMPFLVMSVE
FT                   GALRGMDRRYEEAAATLGANRWTVFRRVTLPMVAPGILAGAVLCWSRALGEFGATIMFA
FT                   GNYPGRTQTMPLAVYLEMQRSPEAAVVLSLVLLAVSVLILVVLRDHWLGAR"
FT   gene            complement(369276..370043)
FT                   /locus_tag="Tfu_0328"
FT   CDS             complement(369276..370043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0328"
FT                   /product="molybdenum ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54366"
FT                   /db_xref="GOA:Q47T51"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T51"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54366.1"
FT                   /translation="MRFARCVVAVCAVLVGSACTPVADGSASGPPERTLTVFAAASLTD
FT                   VFRTWGAQFAEQHPGTTVEFAFAGSSALAEQLAQGAPADVFASADQATMDRVVADVGVA
FT                   DEPVVFARNTLQIAVPPENPAGIGSLDDLAADGTTVALCAEHVPCGAASRAVLDAAGVA
FT                   VDPVTWEEDVRAALTRVRLGEVDAALVYRSDVVAAGGDVHGIDIPEAAAAVNDYPIAVL
FT                   ADAAEPELAQAWTAFVTSPDNAKVLDDAGFLLP"
FT   sig_peptide     complement(369960..370043)
FT                   /locus_tag="Tfu_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.508 at
FT                   residue 28"
FT   gene            370304..371611
FT                   /locus_tag="Tfu_0329"
FT   CDS             370304..371611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0329"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54367"
FT                   /db_xref="GOA:Q47T50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T50"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54367.1"
FT                   /translation="MADSRVGVWRERLVAVLSLLTSFALAPVSLVPAALLAVMVGALSS
FT                   TTVEVVRGTTPADWRLLLLSAATLGSVPVATLLARLGVHIHKRRAGALFGIVETTVPAG
FT                   DGTLRLLRGIGFVVGRDAWAAVGHTTVIGLAGLLFGGLAVLLIAYGAGGVIGGIGALAA
FT                   TLLTSGSVQVTGMALVVAVLVAGPPLVVAGLWVAPWLVRLDLAVMRRTLFDSPQVRVRR
FT                   RLWELSDTRSRMVDAAEAERRRIERDLHDGAQQRLLSLTLTLARARAKFDRDPEQAREL
FT                   VEEAQREARAVMAELREVARGLHPKVLTDHGLDAALPVAAGRCPVPVRLEVHLDERPSP
FT                   RAEGVAYYVVCEALTNVAKHAQASAVTVRAERIRRRRDDLLRITVIDNGRGGADPQSGT
FT                   GLHGLSDRVEAVDGELFIHSPPGEGTVLTADIPWRA"
FT   sig_peptide     370304..370432
FT                   /locus_tag="Tfu_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.699 at
FT                   residue 43"
FT   gene            371614..372273
FT                   /locus_tag="Tfu_0330"
FT   CDS             371614..372273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0330"
FT                   /product="regulatory protein, LuxR:Response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54368"
FT                   /db_xref="GOA:Q47T49"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54368.1"
FT                   /translation="MRVIIAEDSVLLRGGMARLLEDAGIEIVAQVGDADALLAAVARHD
FT                   DVDLCLVDVRMPPTYSEEGMHAAIRIRKEHPDVAVLLLSQHVVGTYASQLLGGSASKVG
FT                   YLLKDRVADIDEFLQTLRRIADGGTAIDPEVVAQLLSRNTDNVLDRLSPRETEVLAAMA
FT                   EGLNNAGIAARLFITERAVEKHIRSIFTKLNLLPDTHEHRRVLAVLQYLRASSRQP"
FT   gene            372308..373231
FT                   /locus_tag="Tfu_0331"
FT   CDS             372308..373231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54369"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54369.1"
FT                   /translation="MTFTARGLYASSSKEPRGRRGRWWLVIGAIVGLAALGTGVLGILT
FT                   TAVSETTTDTTEFPAPSRLEIDNNTEGSVTLVAEDTDTVTVRVDVWSSMMSQPSWDTET
FT                   EGDTLRLAANCSLIFTVFGRCSVDYEVAVPEGTEVSVHTVTGDVDVTGVSARVDASTDT
FT                   GEIRLADVTGEITAESATGRITAAGSGPSAVVTSDTGEINLEDFQAADVQATSAIGAIR
FT                   IGSGFDTARVRSDTGAITVTTDTEFQTLHATTAIGNIELQVPDRVYRVTADTTVGSPKV
FT                   AVDQSRDATSVIEARSDTGDITITPR"
FT   sig_peptide     372308..372457
FT                   /locus_tag="Tfu_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.926 at
FT                   residue 50"
FT   gene            373371..374087
FT                   /locus_tag="Tfu_0332"
FT   CDS             373371..374087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0332"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54370"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T47"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54370.1"
FT                   /translation="MAANSFSQVWQDVFSVQPDPPLWVVIATGAVALLVVVSGGRVWRV
FT                   ARNVVTIAHEGGHALAALLSGRQLSGIRLHSDTSGVTVSRGRPDGIGMIVTILAGYTAP
FT                   AVVGLAGIILLTAGRITGLLWISILLLAAMLLLIRNVYGVVAVVGTGAVVFAVSWWTPS
FT                   AVQSFFAYLFTWFMLFASVRPVFELQSQRRRHPSPHSDADQLARLTGVPGTMWVMVFAV
FT                   FNLAMVGLGVWLLLFT"
FT   gene            complement(374131..374619)
FT                   /locus_tag="Tfu_0333"
FT   CDS             complement(374131..374619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0333"
FT                   /product="anti-sigma factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54371"
FT                   /db_xref="GOA:Q47T46"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T46"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54371.1"
FT                   /translation="MTQISRPVRMPVRRPFRASSQCSGQWKVSTPAPVPDRMPASAYLS
FT                   GVTMSALQITVDERNDATVIVLDGEIDIATENDFRDAVTSALEQRPGGCVVLDCAGLID
FT                   SSGLRVLVQSYKAAQEHRCQLRIAAPPERVAKILRVTAIDTRIPVHPTVEAALAAPAA"
FT   gene            complement(374861..377200)
FT                   /locus_tag="Tfu_0334"
FT   CDS             complement(374861..377200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54372"
FT                   /db_xref="GOA:Q47T45"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54372.1"
FT                   /translation="MAVGRWLAHVLTTLAVLIILVSAAPPPPGTAAAPHTAPRRGPVVL
FT                   VGVPGLRWDEITPQTTPHLWELARRSAIGNLSIRTVTSRTCPVDGWLTVAAGQRAASER
FT                   QTYSICELPRLPEIDGEGAVIPDYSDHVTYNAASRFGARVGLLGDTVRSYGGTTLAVGP
FT                   GAALAAAGSDGRVDRYLGGTSGLTRESWDGVTLGVIDLKDLADLYLDPPAPEPVGDELV
FT                   DGTGTVDGVPRDLQVPLRLPGDTDPFDDEEEVEPEPDLTETSELQERHERLAAIDRDLA
FT                   TIQATLPPDSTLLVAGISVEAGASRLNTALLHGPGPDGTVFTGGYLVSESTRRPGLVAL
FT                   TDITTTLLYTLDFPPQQGMVGRAWRQTPRPAEFDTAVDQLRKFATAAEVVESLVPGFFS
FT                   GLVATQLLLYVCAAYALKRYGGRDLAKRRLVLSATRVVALAGAAFPVSSYLVNLVPWWS
FT                   APFPQAALLGGVLLADAAVVAVALAGPWRRDILAPTTIVAAITTVVLFADLCTGSHLQM
FT                   NSPTGYTPIVAGRFYGLGNIAFATFATGVLMTAAGIAHHLLGHGRRTWAVAVSLVLGTA
FT                   ALFAIGWPGLGTDFGGVLALVPGLAVTMLMIAGLRVTVGRIAVIGVAAVATIGLLSFLD
FT                   YLRPPNERSHFGLFAGQVLDGTAWPVVSRKIDAMLGSLGNWQLTLLAAGALLFLFVVLN
FT                   NPLNWRVGVLSRVYEYAPTLRAGLTGSLVTGLAGFAFNDSGIAIPALALTVAVPLTLAS
FT                   CVWVLQQTVPLSQPPTVSVCGRTATV"
FT   sig_peptide     complement(377099..377200)
FT                   /locus_tag="Tfu_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.629 at
FT                   residue 34"
FT   gene            complement(377287..377895)
FT                   /locus_tag="Tfu_0335"
FT   CDS             complement(377287..377895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54373"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T44"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54373.1"
FT                   /translation="MTCAGRAHPSPRRGLPRGYRFPTEGMYRNDHISAVSGGNGMTEYG
FT                   SDAGRLRRVTAVRLWTGGLATAVVAALVIFVGTLLVNGLLGASVLSPEGSWRFSALGMT
FT                   AYAALAAFGALAATGLLHLLLPNTPRPLHFFSWIVGLAVAGATVAPFAQDGPVVVTVAT
FT                   SLINLAAGGTILSLLSGVGAVAHAELRGRTPARTPLGKS"
FT   gene            complement(377892..378713)
FT                   /locus_tag="Tfu_0336"
FT   CDS             complement(377892..378713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0336"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54374"
FT                   /db_xref="GOA:Q47T43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T43"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54374.1"
FT                   /translation="MSQPTSSRLRGENLTLAYDQRVISRNLEVAIPDHSFTVIVGPNAC
FT                   GKSTLLRALSRMIRPTTGAVYLDGKLIHSYSSKEVARRLGLLPQTSIAPDGITVVDLVS
FT                   RGRYPHQRFLRQWSREDERVVAEAMAATRVSDLADRLVDELSGGQRQRVWLAMVLAQQT
FT                   PLLLLDEPTTFLDIAHQLDMLDLCAELHQERGHTLVAVLHDLNQACRYATHLIAMKDGA
FT                   VVAQGDPQEIVTAELVAEVFGLPCQIIPDPETGTPMVVPSDRRKRAGRKAA"
FT   gene            complement(378730..379770)
FT                   /locus_tag="Tfu_0337"
FT   CDS             complement(378730..379770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0337"
FT                   /product="ABC-type enterobactin transport system inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54375"
FT                   /db_xref="GOA:Q47T42"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T42"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54375.1"
FT                   /translation="MTAIPLRSLRVGPVALRLRPRVLVSCLALAVLVLAALTACLIVGD
FT                   YSIPLRRIPAALFGSGERLDVFFVRDVRLPRALTAALVGAALGTAGAVFQSLSRNPLGS
FT                   PDIIGFTAGASTGAVLTILVVGGGMLSTALGAMLGGVGTAVLVYLLALRRGVQGYRLIL
FT                   VGIGISAMLGAVTHYLITRAELTDALSAQVWLVGTLNSREWPHVAAVGIGCAVLIPFLL
FT                   RLGAQLRLMEMGEDTARALGVATQRTQTLALLAASALTGIAIAVSGPIAFVALAAPQLA
FT                   RRLTRADGTTLVASALMGAALLLCSDLVALRLLAPVQLPVGVVTTVVGGTYLVWLLYAE
FT                   WRSGRA"
FT   sig_peptide     complement(379636..379770)
FT                   /locus_tag="Tfu_0337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.335 at
FT                   residue 45"
FT   gene            complement(379767..380867)
FT                   /locus_tag="Tfu_0338"
FT   CDS             complement(379767..380867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0338"
FT                   /product="ABC-type Fe3+-siderophore transport system inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54376"
FT                   /db_xref="GOA:Q47T41"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54376.1"
FT                   /translation="MSREQLATVVRDHVDLDDASTARAALVRHMSARATTHALRAGGLA
FT                   AALGVLVLAALLSLAVGAKPIPLSVVWDALWHFDGSYDHTVILGLRGPRTVLGVTVGAA
FT                   LGLAGALMQVLVRNPIADPGLLGVNMGATTAVVAAIYLFGLTGIDAYVWFSFAGAALTA
FT                   LLVYFLGTRGRTSATPVRLALAGTAVSAVLLGLTNGVILFHDFVFQEIRFWQVGSLAGR
FT                   DLAIFGTVAPFLAVGALIALALGWSLNALALGEDLAAALGARIGRIRLWTAIAIVLLCG
FT                   AATAATGPIAFVGLAVPHAARLLTGPDQRWLLPFSAVFGAILLVLSDTLGRVVLPNGEL
FT                   EVGIITALVGAPVFIVLVRRARLVQP"
FT   gene            complement(381023..382222)
FT                   /locus_tag="Tfu_0339"
FT   CDS             complement(381023..382222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54377"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T40"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54377.1"
FT                   /translation="MKRRSSSRPARSARPSSQRQRSGPGRRSLGPLLRLALPVLATALT
FT                   LGSLLINVMAGGFTTTQGVTAWALTGVSALACAFAWWTYVAASAAEKKKRAAEPPYPGV
FT                   GEGFDAESAYGYGDGYDDADRAAPEGPAHADEAAYDAPADGAYDGPGGSGETTAVWNPP
FT                   PSGGAAGSTAVFSPGDTGGPALGDTGGFPPPADAAAPPVQDAEHTIVGARWDATPSEPD
FT                   STPPPPPGPAPSSGPAPTPPLADPPAPEAGDTGGFPTIPAPPYSTPYSGGPSSTPPSSF
FT                   ADDPLSGPAPASGPWRPAGEAAPREERTPWASNPTGGVNSASDILGGGPAPGQGAPPAD
FT                   PLGGPPTPPNSGTVPRYPAQGVSHYPGYRGDLFADHERRETGPDRREDGPWPYPPPPQH
FT                   "
FT   sig_peptide     complement(382049..382222)
FT                   /locus_tag="Tfu_0339"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 58"
FT   gene            complement(382274..384604)
FT                   /locus_tag="Tfu_0340"
FT   CDS             complement(382274..384604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0340"
FT                   /product="trimethylamine-N-oxide reductase (cytochrome c)"
FT                   /EC_number="1.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54378"
FT                   /db_xref="GOA:Q47T39"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54378.1"
FT                   /translation="MTNTGPVEAYPTSAHWGTFEVLVRDGRVVGVRPDPADPAPSPLID
FT                   NVPDAQHHPTRIDRPAVRRRWLEHGPGPDAQRGERDDEYVAVDWDTALDLLAAELDRVR
FT                   RTYGNEAIFGGSYGWASAGRFHHAQSQLHRFLNTIGGYTRSVATYSHGAAEVFLPHVVG
FT                   AEGAHALLYRAPTWETIAEHTDLLVSFGGLRVSNTWVASGGRAAHTAEGGMREAARRGT
FT                   EFVSISPLRDDAAAELNARWLSAVPGTDTAILLSLIFTLIAEDRVDTAFLERYTVGWPH
FT                   LRDYVLGKRDGVAKTPEWAAALSGIPAAELRELALRMAQGRTLINVGWSVQRARYGEQP
FT                   LWAGLALAACLGQIGLPGGGFATGYGSMGSYGGGFTPRALPRLPQGRNPVDTLIPVARI
FT                   ADMLLCPGEPFDFNGQRLRYPEIHLVYWAGGNPFHHHQDLARLRRAFARPDTVVVHETH
FT                   WTATARHADVVLPVTTSLEREDFAASRGDLRLRVMRRAVPPHGAARDEYAIFTGLAERL
FT                   GTVEEFTEGRDVRQWLRHLYEEWRERQGPEVELPDFDRFWADGGVDIPHRVMDTTFFGA
FT                   FRADPQAHPLGTPSGRIELYSETIAGFGYPDCPGHPTWLDPPERPGTPRAQQWPLVLVA
FT                   NQPKDRLHSQQDMGAHSRAGKIADRAPVRLHPDDAAARGITDGDVVRLFNDRGSCLAGA
FT                   VLDDGVRPGVVQLSTGAWFDPSSPDTATCVHGNPNAVTIDVGASRLSQGCTGQVTLVEV
FT                   ERFDGAPPPVRAFVPPRIVGHTH"
FT   gene            384732..385688
FT                   /locus_tag="Tfu_0341"
FT   CDS             384732..385688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0341"
FT                   /product="citryl-CoA lyase"
FT                   /EC_number="4.1.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54379"
FT                   /db_xref="GOA:Q47T38"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54379.1"
FT                   /translation="MNAVASRSRRSVLAVPASNPRFIEKARGLAVDAFFLDLEDAVAPS
FT                   EKERAREAAVAALNEGGWDGKVRTVRINDATTAWAYRDVITVVEGAGAALDCLVLPKVT
FT                   GPAPILWLDTLLTQIERAVGLEVGRIGIEAQIEDARGLTRINEIAAASPRVETLVYGPA
FT                   DFMASINMKTLTVGEQPPGYDVGDAYHYVLMRILTAARAHDLQAIDGPYLKIRDVDGFT
FT                   RAARRTAALGFDGKWVLHPGQVDAANEVYAPTQEDYDHAELVLDAYDYATRVQRRGAVM
FT                   LGDEMLDEASRKMALVIAAKGRAAGMKRTKTFVPDTE"
FT   gene            complement(385725..386150)
FT                   /locus_tag="Tfu_0342"
FT   CDS             complement(385725..386150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0342"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54380"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54380.1"
FT                   /translation="MAFRIAHLPIRLAAGAYILNSGLNKREADADTAAYLHSAASRVLP
FT                   TLRDMPPEKFTRMLSNSEIGLGAALLLPLLPSALVGAALTVFGAGLLGHYFTEPGARME
FT                   DGIRPTPQGLALAKDVWLVGMGLTLLIDGMRPPCPVR"
FT   gene            386292..386990
FT                   /locus_tag="Tfu_0343"
FT   CDS             386292..386990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0343"
FT                   /product="response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54381"
FT                   /db_xref="GOA:Q47T36"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T36"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54381.1"
FT                   /translation="MSPARTVLIADDDRAIRESLERALQLEGYQTRTAADGVETLAAVH
FT                   SDPVDLLILDVMMPGVDGLGVCRVLRAEGDRTPILMLTARVETSDRVAGLDAGADDYLP
FT                   KPFELDELLARIRALLRRAAPTTGEGAAEPLIQVGDLRIDPGARRVWRAGREVELSKTE
FT                   FDLLELLARNAGIVLDHSTIYDRIWGYDFGPESKNLAVYISYLRRKLEPEGTTPLIQTV
FT                   RGVGYTLRPK"
FT   gene            386990..388429
FT                   /locus_tag="Tfu_0344"
FT   CDS             386990..388429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0344"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54382"
FT                   /db_xref="GOA:Q47T35"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T35"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54382.1"
FT                   /translation="MGAAAALGEKVRGWVRGLGGASLGTRFAVTFAAVAAAVIVLMGSL
FT                   AYSAAATLIRNSAEQEFNATVSNVAQTLRNSSTGNSRFHEFTLVHSERFSFQLINGAGE
FT                   IMVPLGGGRASAPLPVTEADRAVAGHYAGGLVHLRDDNALGEPLRVATVSFGQGLGAVQ
FT                   IVQRLQPTERLLDTLAAQLVVVGVVALVGAGLAGWLVARRITSRLVRLTEAAEYVTSTG
FT                   RLDRAVSDGGTSTGGRDEVGRLGAAFNEMLGRLAAAKEEQRRLVQNASHELRTPLTSLR
FT                   TNVSVMKQFDRLSPEAQQRLVDDLQGETRELTDLVNELVSLATETYQDEPVQEVVLREV
FT                   AERVAARSRRRTGREIIVDADDSAVLGRPGALERAISNPVENSAKFDPEGTAPIEIHIR
FT                   DGVVEVRDRGPGIAESELAHIFERFYRSPAARGLPGSGLGLSMVHDIAAAHGGTVFAYN
FT                   REGGGAVIGMRLPTIPDEPPQ"
FT   gene            complement(388526..388873)
FT                   /locus_tag="Tfu_0345"
FT   CDS             complement(388526..388873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0345"
FT                   /product="Na+/H+ antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54383"
FT                   /db_xref="GOA:Q47T34"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T34"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54383.1"
FT                   /translation="MTGTEILDWISVILLLLGAALSFAAGVGLVRFPDLLSRMHTAAKP
FT                   QVMGLVLISVGLGLRLFPDPRVGFLFLVVLFQILTVPVASHIAARVAYRTGRVRRDLIG
FT                   VDELEEQLEPR"
FT   sig_peptide     complement(388799..388873)
FT                   /locus_tag="Tfu_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.663) with cleavage site probability 0.638 at
FT                   residue 25"
FT   gene            complement(388870..389160)
FT                   /locus_tag="Tfu_0346"
FT   CDS             complement(388870..389160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0346"
FT                   /product="putative cation antiporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54384"
FT                   /db_xref="GOA:Q47T33"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T33"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54384.1"
FT                   /translation="MIYLWTVIGVLLGAASLLGMARLLLGPTILDRALAVDVLLASAIT
FT                   GIGAYAAFHRDPTVLPTMLVLAVLGFVSSVSVSRFVARRQRGIDESEGVDQ"
FT   sig_peptide     complement(389053..389160)
FT                   /locus_tag="Tfu_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.821) with cleavage site probability 0.638 at
FT                   residue 36"
FT   gene            complement(389157..389732)
FT                   /locus_tag="Tfu_0347"
FT   CDS             complement(389157..389732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0347"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54385"
FT                   /db_xref="GOA:Q47T32"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T32"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54385.1"
FT                   /translation="MTPPSVIPKRSPLDLRIGRRIINLPTLLTLTVVWMLLFGELSLTM
FT                   ALGGVLVGTLIMLVFPLPTVSLGLRLHPVGLAVFLGHFIVDLVVSSARVVAQSFARRPP
FT                   RSSILAIPLRTRSDLLLTITAICVSVIPGSVIVEVRSGTFTLFVHMLGTDVDAAEDARR
FT                   KVFALEERVARAFGTREEIERVEAGGDT"
FT   gene            complement(389729..391372)
FT                   /locus_tag="Tfu_0348"
FT   CDS             complement(389729..391372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0348"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54386"
FT                   /db_xref="GOA:Q47T31"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T31"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54386.1"
FT                   /translation="MEALLPYLVPLPVVVPLLAAGLKFAIGVRSPLLNQMISVVALVVV
FT                   LATGGALLFGVHAYGPQVVQVGGWEFPIGITLVADRLSALMVTVSSAITLGVLVYSIGQ
FT                   GIADQEEATPLAIFYPTFLILVAGVSNAFLTGDLFNLYVGFEILLTSSYVLMTQGGTLA
FT                   RIRAGSTYVVVSLLSSVVFLIAIALIYAATGTVNMAHLALRLAELPTELQLTLQAILLM
FT                   AFAIKAAVFPLSAWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRTQTLLFPEDSVVDTL
FT                   LLWAALATMVIGIFGAMAQTDIKRMLSFILVSHIGYMVFGIGLASVHGMSGAVFYVAHH
FT                   ITVQTTLFLVAGLVERRCGSSSLNNVSGLAKISPVLGVLFFIPAMNLAGIPPLSGFLGK
FT                   LGLIQAGVQDGSPLAYLLVGGAVATSLLTLYSIVRLWNYAFWRAPEEGRPVALGTLLES
FT                   SEDESSDLPNGNAVPIPAGRAPTGIGGKAVVTSDVFPPLMLGATVALVLLGVAFTVFAG
FT                   PLINYSYEAAVELTARTSYLNAVIPGGAAQ"
FT   gene            complement(391372..392184)
FT                   /locus_tag="Tfu_0349"
FT   CDS             complement(391372..392184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0349"
FT                   /product="similar to Multisubunit Na+/H+ antiporter MnhC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54387"
FT                   /db_xref="GOA:Q47T30"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T30"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54387.1"
FT                   /translation="MNDTPTLLLVIVIGVLVTAGVTLLLERSLTRILLGVVLLGNGVNL
FT                   LILSAGGAAGGPPLLSLTPEGEMADPLPQAMILTAIVITLGVTAFLLAMAYRSWQLQGN
FT                   DEVQDDAEDRRIATGGERRRLRQYIRAQKRALRQAIRAQRMELEAQIEAQDELEEAERA
FT                   ILREQIAQARRDLDERLEAADDKDRERIIFQADHAQAAALDEAKRRVREARKELAEHRR
FT                   ADREYERRLRRELRQRIRAQKRQLRASIRAERERLARAEDSDMQGVDY"
FT   gene            complement(392181..395129)
FT                   /locus_tag="Tfu_0350"
FT   CDS             complement(392181..395129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0350"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54388"
FT                   /db_xref="GOA:Q47T29"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54388.1"
FT                   /translation="MIWLLVAHFTAAALAPALVRKWGRQAFFALALVPASAAIWALPRA
FT                   PGVIAGEPELFFLPWAPNYQLALAFRMDALSLVMLLLAAGIGALILLYCARYFSDDEPG
FT                   LGRFAGVLTGFAGAMIGLVLANDLIQLYLYWELTTVFSYLLIGHYPERRDNRRAAAMAI
FT                   NVTTMGGLTMLVGLVILGESAGTYLISGILAEPPSGTAVTVALVLILVGALSKSAIFPF
FT                   SLWLPAAMQAPTPVSAYLHAAAMVKAGVYLIARLTPAFGDIPAWQYTAVILGTATMIGS
FT                   GWRALRQHDLKLLLAHGTVSQLGFLTAIFGIGTRDAALAGLAMLCAHALFKAPLFLVVG
FT                   IIDHSTGTRDLRELSGLRKKMPVVFWTSVVALMSMAGLPPMAGFAAKEAAFGAFEHADT
FT                   LLATLALAGVVVGTLFTVGYSLRFLWGAFFDKENTSPTPLLHPPGPLFVAPAIVLAALS
FT                   LLGGFGASLADPVFASYADTVPGAGHDPAHLALWHGFSLPLLLTALCLAGGLLLFRWRV
FT                   MVAWLGARFALPEAGNVYRRIVYYLSSFATQVTGLTQRGSLPLYLGTILVSLLVVSTAP
FT                   IVWGRLWTLDVPPVRWIDTPPQLIPAAIIIIAALWTLIVRGRLFAVVLVGMTGYGTATL
FT                   FALHGAPDLALTQFLVETVSLVVFVLVLRRLPPQFSTPVLRSRRLVNLAIGIGSGILVA
FT                   VMAYLTLAGRQAESISEGFPAAAEEAGGSNIVSVLLVDVRSWDTMGEISVLAAVAAGVA
FT                   SLLFVRRRTRLPHTHIETGRIVARLPQPPSNGESEWSPLPLTYVGDIITPRVAHKPLWL
FT                   PGVLTLAQERRSIIFEVVARLMFPVIILISVFLLLTGHSHVGGGFAGGIVAGLGLMVRY
FT                   LAGGRHELYLSLRLPPGLLIGLGLSITTGTALAGAIFGTEIFAGGAFDLHLPFLEPIHL
FT                   TSALAFDFGVYVLVIGLIQDILYSLGAGIDEQAEKDSRTGKAPEYESEEVTA"
FT   gene            395304..395693
FT                   /locus_tag="Tfu_0351"
FT   CDS             395304..395693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0351"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54389"
FT                   /db_xref="GOA:Q47T28"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54389.1"
FT                   /translation="MRAVARARGRVPSGAEPRLTLAQALLLESALAVTHPTVGEIAHAA
FT                   GISSPSATRMLQQLERKGMVRRRRSEEDERATVVSVTDEGMRALHAHQTLVRDRLHDLF
FT                   HQVDPRLRPVLVDLLHTMRDLADRL"
FT   gene            395930..396940
FT                   /locus_tag="Tfu_0352"
FT   CDS             395930..396940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54390"
FT                   /db_xref="GOA:Q47T27"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54390.1"
FT                   /translation="MTGAIIAAALGAVAFATGAALQERAILGGVPAEVSGQWELLRCLL
FT                   RSPLWLIGTGLSGIGTGAHVWALTGAPLMIVQPIGVGGLLCAVVVSAVLHRRALTGTEI
FT                   VGCLTVTFGLVALVGTLYGHSGPPVDPPPSTAWILPTATGVVMLGGLLVSRFVSGALRA
FT                   WVLALCGGVGFATLSALVRVIGVAALDDPLSVLRPLTLVTAVIGVCGYLLVQGSYRTDH
FT                   FALAYATLLISDPLTAVLIGVSLLGESLPTGALPLTVIVVSALATVGGTITLARSSVAR
FT                   QRRTRLRAAPSVVSDGPQPSPRPEDAGRRKERPGKSGDVPTRTTTVSCPATGRPA"
FT   sig_peptide     395930..396028
FT                   /locus_tag="Tfu_0352"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.768) with cleavage site probability 0.346 at
FT                   residue 33"
FT   gene            complement(396909..398660)
FT                   /locus_tag="Tfu_0353"
FT   CDS             complement(396909..398660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0353"
FT                   /product="trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54391"
FT                   /db_xref="GOA:Q47T26"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54391.1"
FT                   /translation="MSAIDRGSGSSMEEPERPEGPLADADGRESVTDHQDTTAADTPED
FT                   ATTGSAARSETGAAPDTAQAASAPSAAAAPASEPAASAAEQRDASHEAPAPGSRETPPH
FT                   PAPRPAPFAPQSHAPHPAWGPPAPDQATARHGAQAYPGPEAPQPAPGRPGPPPAGGVPA
FT                   GAAQGAWQERPAQHDQPNSPTGAWAVPPSPGGFFPPTGGFPTLHGSSPFEGAPPPGKPQ
FT                   RSGRVVLIAAVTALITSLIVGPAASVATAYFLSEQVAANPAATSAASGDVTKVAAKALP
FT                   SVVSIATAEGGGSGFIIRDDGLIVTNNHVVSDAQELTVLFHDGSQASATIVGTDPVSDL
FT                   AVIRAQGVSGLTPASLGDSDQVEVGAEVVAIGAPLGLSGTVTSGVVSAVERPVNTGVSG
FT                   QQDSPLLPSPDEEEPQATTSTVIDAIQTDAPINPGNSGGPLVNMNGEVIGINTAIATTS
FT                   GNFMSQSGSIGLGFAIPINQAKPIIEELINTGKATYAAIEASVTVAEDGPGAELVEVNR
FT                   GGAADQAGLRKGDVIIRIEDRMVTDPNVLIAEIRSHRPGDTVTITYQRGGQTAQTTVTL
FT                   AAQSLDN"
FT   gene            complement(398956..399813)
FT                   /locus_tag="Tfu_0354"
FT   CDS             complement(398956..399813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0354"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54392"
FT                   /db_xref="GOA:Q47T25"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T25"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54392.1"
FT                   /translation="MARSESAASPSFPVIVTADWLRAHADEVILADVRWYLDGRSGRQA
FT                   YRDGHLPGAVFVDVDTDLAAPPSPAGGRHPLPDPADFAAALSRLGIGDGSVVVAYDDAG
FT                   GSTAARLVWMLRVLGTRAALLDGGLQAWPGPLETGDVTAEPRTRTPVPWPADRVVDTDT
FT                   VRQELGEPGRLLLDARTFGRFTGEQPAPVDARPGHIPGARSASWQDNLDDTGRFAPPDV
FT                   LQARFRALGVDTATSVTVYCGSGVTACHDLLALEHAGFPDARLYPGSWSAWGADESLPV
FT                   QTGE"
FT   gene            complement(399823..400278)
FT                   /locus_tag="Tfu_0355"
FT   CDS             complement(399823..400278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0355"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54393"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T24"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54393.1"
FT                   /translation="MSETTHTAATTRASGPGRLLVAVYALFAVAATGRSTVQILTRFEE
FT                   APLAYSLSALAAAVYIAATVALARSGHTSRRVALAACTFELVGVVAVGLFTLLVPEAFP
FT                   DDTVWSLFGIGYGFVPLVLPVLGLLWLGRSHPRTPDAASSAPPSHRG"
FT   gene            complement(400271..400636)
FT                   /locus_tag="Tfu_0356"
FT   CDS             complement(400271..400636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0356"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54394"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54394.1"
FT                   /translation="MSDLWTTIVQLASLVLAVWCGISAFRGQPMLVPHLIGLAVLEVLL
FT                   LVQLVLSIVLLVQGPRPPDTVTFVSYLVTLVLVPPACAVWGLMERSKWGPAVIAFAGLV
FT                   LPVLMVRLEQLWNAPVV"
FT   gene            complement(400787..401689)
FT                   /locus_tag="Tfu_0357"
FT   CDS             complement(400787..401689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54395"
FT                   /db_xref="GOA:Q47T22"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T22"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54395.1"
FT                   /translation="MADTPTGWVVVGVDGSASSRYALEWSAHEARLRGLGLRIVTAVEI
FT                   PDPRDPLAGPAIPANVEELPLFQDARALLDYADRWIQRVYPELETRTRVALRRPAEALM
FT                   EAAEEPGTELVVVGSRGRGTLASAFAGSVGVELAAHSPVPVVVLPKEHETAPGVRERVI
FT                   LGVDGSPASRNAIDFAFTEAQRRGTELVVVCAWQPITAFALTMGPLPPEIFDEEPLAEA
FT                   AQQTIEEAIADYRKRYPDVSVTVRTVRAHPAAGLLETATPADLIVVGSRGRGGFRGLLL
FT                   GSVSQAVLHGARGPVAVVR"
FT   gene            401867..402691
FT                   /locus_tag="Tfu_0358"
FT   CDS             401867..402691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54396"
FT                   /db_xref="GOA:Q47T21"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54396.1"
FT                   /translation="MGSDTEEKTMATAETPENLPVLYFGHGAPPLADDELWTSQFAAWS
FT                   AELPRPKAILVISAHWESAPLTIGATTTVPLVYDFWGFPERYYQVTYPAPGAPQLAASV
FT                   RALLSGSGTPVAEAPARGLDHGAYVPLKEMYPEADVPVLQISMPTLDPEELFALGRRLA
FT                   PLRDEGVLIMGSGFLTHNLSCVDMSRGPDYAPPSWSAEFDDWAAQAVHTGDVDALLDWQ
FT                   AKGPAATIAHPRSEHLAPLFVALGASSGTTETARSVIDGFWYGLSKRAFQFD"
FT   gene            complement(402740..404368)
FT                   /locus_tag="Tfu_0359"
FT   CDS             complement(402740..404368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0359"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54397"
FT                   /db_xref="GOA:Q47T20"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54397.1"
FT                   /translation="MVSVAAQTSTGANEVNREAARRRTFAVISHPDAGKSTLTEALALH
FT                   TEAITSAGAVHGKGDRKGVISDWMEIEQDRGISITSAALRLEYNGCVLNLLDTPGHADF
FT                   SEDTYRVLSAVDCAVMLLDSAKGLEPQTLKLFDVARSRGIPVITFVNKWDRPGREPLEL
FT                   LDEIEQRIGLRPTPLNWPVGVAGDFRGLIDRTAGNRYTKLHRTPGGATKAREEPMDAVQ
FT                   AAEVEGAAWEQAMEELALLEEIGADYDEESFLAGKSSPVLFGAALPNFGVSALLRALIN
FT                   LAPAPAARLDVTGAPRPVDAPFSGFVFKMQANMDRAHRDRMAFVRVCSGRFDRGMVLTH
FT                   ATTGRPFATKYAQAVRGAQRQTVDTAFPGDVIALVNAQALRVGDTLYAGPKVEFPPIPS
FT                   FAPEHFAVARAVDSSRYKQFRRGIEQLDSEGVVQVLVSDVRGEQAPVLAAVGPLQFDVV
FT                   THRMEHEFRAPVELTHLDYSVARRTDAASAPVLHGLSGAEVLTRRSDGELLVLVHNKWR
FT                   LKVIQRDHPDLVMEPLLAGGLVEEE"
FT   gene            404503..405498
FT                   /locus_tag="Tfu_0360"
FT   CDS             404503..405498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0360"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54398"
FT                   /db_xref="GOA:Q47T19"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54398.1"
FT                   /translation="MKALRVHNLGEPKDVLKLEEVPVPEPAPGQIVVRVLATAVNFPDA
FT                   LMCRGLYQEKPPLPFTPGVELCGEVVALGEGVTTVTEGDRVIGSPVLPYGSFAEYAPMD
FT                   ISRVFPAPPSLSDTEAAALFIGYQTGWFALHRRAGLQAGETVLVHAAAGGVGSAAVQLA
FT                   KAAGARVIGVVGGAAKAEYARKLGADIVVDRYVDDFVSVVKEATDGRGADVIYDPVGGE
FT                   SYTRSTKCIAFEGRILIIGFASGTIPTPGLNHALVKNYSLLGLHWGLYNKRNPALVAHC
FT                   HEELTALAERGAIKPAVSEVLSLEELPDGVQRLADGTTVGRLVATPHGAQ"
FT   gene            405595..406389
FT                   /locus_tag="Tfu_0361"
FT   CDS             405595..406389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0361"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54399"
FT                   /db_xref="GOA:Q47T18"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54399.1"
FT                   /translation="MGRPFTFPDRTIVVTGGANGIGYALAERFLAEGAARVVLADLDGE
FT                   RAAAAAAELGARAQGYQLDVTDAEAVAALIEEVERDSPIDLWCSNAGVTTGGGLGSDAD
FT                   WDRTWRVHVLAHVYVARLLLPRMVERGGGHLLITASAAGLLTNIDSAPYSVTKHGAVAL
FT                   AEWLAILHGDEGIDISCLCPMGVNTAMTAKDGPDAATRLGGDYLEPEDVAQSVVEALNE
FT                   GRFLILPHPKAAVMEQRRASDRDRWLAGMRRARARLKGGSGR"
FT   gene            407623..409056
FT                   /locus_tag="Tfu_0362"
FT   CDS             407623..409056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54400"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T17"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54400.1"
FT                   /translation="MTNHSTSRSGTDTAVIVIAADDLSAEVFIDGSRHVVHGADAKATR
FT                   RAALDYVTDHAARIGRPVIIEARDVYGVQRLEALPRGVIRSIPQIPPPAPRNSGKQSGS
FT                   RTGVVLALAAAGLAVVVLVVVSVVLVVPRYLPGFGTQAAPSQQAPETPDTIPFEARSAP
FT                   PGFSSEALWRIPVTEGTRPAVSDDGSRVAFIGADGKLAVAGPEGKRLWEADLPIQPAEI
FT                   EGAVRFVKNDDQWEVAIAGTGKLWIWSADGSGPTEYKLPKDGVVTFAGTAPLVTTDKKA
FT                   MVPREGELLEVKVPKGTGGMLVVGDEVLLAAADGPWYWAAPGEEPAKVTAKEPKSADGL
FT                   DRVITASERYVIVRWQSEKEDKVILAAHDARDGSVFAETEITAGELADATWIEGETVAA
FT                   YGPILTDLESGQTQVLPGFTPLNAVAGVVYGELEEGQVAVNAAGEVTPMEPDTARPWGL
FT                   LDGHAVVMADANLYALLPD"
FT   gene            409083..409790
FT                   /locus_tag="Tfu_0363"
FT   CDS             409083..409790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54401"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T16"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54401.1"
FT                   /translation="MSYTARALGVTAAGLLAFGLASAPASALELDLGADLGIATLDAEV
FT                   GILTNGNDGGDDTPGETPGGGNPGGEDPGPGDNPTPEPPGGGEDPGGGDPGGGDPGGGD
FT                   PGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGGGDPGTPEPEPEPEPTPAPGDGEDPDD
FT                   KNPGQQPGDGSGEDGDADDNKGSSDDKKSDKADETLPVTGVDLSGFVLGASLTTAVGAI
FT                   TIVASRRPAQARN"
FT   sig_peptide     409083..409166
FT                   /locus_tag="Tfu_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.773 at
FT                   residue 28"
FT   gene            409972..410595
FT                   /locus_tag="Tfu_0364"
FT   CDS             409972..410595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54402"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T15"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54402.1"
FT                   /translation="MTVRNRTIAVLLGGLAGLLALPSLGHASPQPDDTVPGRSNDITLS
FT                   ITDSRDRIAVGEDTAYTVTVRNEGEEAAPELLVAQIAPAHLDLREADGGGVIEDNTAAW
FT                   LVSLGPGEEQTRTVTATLVEDPGQDTVATTVCAGWQEADSPLVCADDENTVGAQNGSVP
FT                   LRPFFTGAGIAAAAALLVGLVVAVLRRPRKPRGRHARHRAAARR"
FT   sig_peptide     409972..410055
FT                   /locus_tag="Tfu_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(410692..411144)
FT                   /locus_tag="Tfu_0365"
FT   CDS             complement(410692..411144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54403"
FT                   /db_xref="GOA:Q47T14"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T14"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54403.1"
FT                   /translation="MTFHPAESAARPPHPHEGAIREVPTRGNPTVLTYAPEPDGLADAG
FT                   EIVWTWVPFEEDPTQGKDRPLLVVGRKGNVLHALMLSSQEPDPWEADDWLLLGSGPWDR
FT                   AGRVSYIRLDRLFELEEHEIRREGAIVDRATFWRVAAVLRDRYGWT"
FT   gene            complement(411172..411867)
FT                   /locus_tag="Tfu_0366"
FT   CDS             complement(411172..411867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0366"
FT                   /product="methylated-DNA (protein)-cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54404"
FT                   /db_xref="GOA:Q47T13"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T13"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54404.1"
FT                   /translation="MRCRAENSLSPPLPHRRTPDTGTSTPAPRTHQGVIVTAEIPARAR
FT                   VHTVVDSPLGPLTLVAADGALVGLYQEDQRHRPAPDSFGVPDPAPFTEVIAQLTEYFSG
FT                   QRTVFDLPLAFTGTPFQTTVWRALLEIPYGQTVSYGELAARIGKPSASRAVGLANGRNP
FT                   ISIIVPCHRVVGSSGSLTGYGGGLARKQWLLALEQRRAHQPPLLDFADGLDAGEPRSAT
FT                   LPMGSHHSA"
FT   gene            complement(411886..413274)
FT                   /locus_tag="Tfu_0367"
FT   CDS             complement(411886..413274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0367"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54405"
FT                   /db_xref="GOA:Q47T12"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T12"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54405.1"
FT                   /translation="MPESQPVSPSHSRGEHPVPRRLRRARIALYAYFFVTGSVISIWAS
FT                   RIPAIKRQTGVDEGELSIALLALALGGVVTIRLMGGLLDRFNGRIIVPAAALVASIALV
FT                   APGYATNLQQLTLFLLLLGSSQALLNVSANLQAARLQREWGRPIMVSFHAVCSIGGGLG
FT                   AIAGTLCVRAGLDVTTTFIGASSVLTLLSLLGRKWLLDTPALAAQRAPARPRFRRFALP
FT                   RGRILLLGVLALCCMLAEGAANDWSALYTREMVGGSETAASATYAAYATMMAAGRLIGD
FT                   RLVALFGPVNVVRGGSLLASFGLFFALVLPLQIPVIIGFALVGIGLSGIVPQVFNAAAN
FT                   DNPERSGRDLSTVTAIGYFGPLLGPPTIGFLADRAGLSVALLFPASLVLFIALGAGTLR
FT                   TAEHREPRALRRSASSKSLRTGSMRLWVPPLRHLSENINGHRSEQSEETLPNNNHHDSG
FT                   RETR"
FT   gene            complement(413892..413967)
FT                   /locus_tag="Tfu_R0008"
FT   tRNA            complement(413892..413967)
FT                   /locus_tag="Tfu_R0008"
FT                   /product="tRNA-Arg"
FT   gene            414321..415427
FT                   /locus_tag="Tfu_0368"
FT   CDS             414321..415427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54406"
FT                   /db_xref="GOA:Q47T11"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54406.1"
FT                   /translation="MPFVLDAGRSRCRATRNGTPSVSNGRSRSRTVVTAVFTLILMLVN
FT                   LVALPSAYADNEELESLREEAEQAREELEQATEEYTKRQEALEEAQDELVKTLHELQQI
FT                   EGRIADMRVPLVELAITLYKQPDVGVLGFLASDSVESDLRAESHVMKLSYDQEQLLDEA
FT                   NALRDEQIELTGRAQELQSQTQLERVELEDELEKLRKKSEESTEALTKKLEDLGLSVDA
FT                   YMAGVECDPSAAQKAIGAPNGLLPSDSLCELHVEGHYLRADAAVDFLRMNQAYAQEFGT
FT                   DMCVTSSYRDLQNQHRVYAQQPPGYAAVPGTSNHGLGLAVDLCGGVQNQGSPQFNWLEA
FT                   HAGEYNWFHPAWAYSNPFEPWHWEYDPS"
FT   sig_peptide     414321..414485
FT                   /locus_tag="Tfu_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.979 at
FT                   residue 55"
FT   gene            complement(415557..416201)
FT                   /locus_tag="Tfu_0369"
FT   CDS             complement(415557..416201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54407"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T10"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54407.1"
FT                   /translation="MKLFSTTARRPFWARWHRWRRLLAATAAALAAAGALLVLRPPAPP
FT                   AVEVLVAAHDLSGLVPLTDADTVARSIPAAVVPDGALAPGDPVAGRALRSPVRAGEILT
FT                   EVRLADPPAAGYGADLVAAPVRLADPGAAALLRPGSRIDVLAAAGDPPVVDYPGPDTAR
FT                   RIVRDRPVITVVAEDDAAHSLGTLIVLAVTDEEAQALAGHAADRLSIAIRG"
FT   sig_peptide     complement(416040..416201)
FT                   /locus_tag="Tfu_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.488 at
FT                   residue 54"
FT   gene            416469..416753
FT                   /locus_tag="Tfu_0370"
FT   CDS             416469..416753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54408"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54408.1"
FT                   /translation="MKMPVVNSCEAEACAYNTDSTCRALAITVGNQPSAYCDTFLPIQA
FT                   KGGDPSTVGHVGACKMANCQHNVQFECQAPAINIGFDANQADCLTYAPA"
FT   gene            complement(416936..417223)
FT                   /locus_tag="Tfu_0371"
FT   CDS             complement(416936..417223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54409"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T08"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54409.1"
FT                   /translation="MPTYQYACTECGADLEVVQSFSDDPLTTCPKCQGKLRKVYSAVGI
FT                   VFKGSGFYRTDNASSSSSSLSSSSSSAKADSSSSGSASSSSDSSKTTSAA"
FT   gene            complement(417407..418051)
FT                   /locus_tag="Tfu_0372"
FT   CDS             complement(417407..418051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54410"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T07"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54410.1"
FT                   /translation="MSASGCCRCGPVPLADWVSMDTGQSKRELRRRILAARRARSAQER
FT                   AAAGLRIRDAVLELCAATGSPTVAAYYAVGSEPDTRSLVAALAARGHRVLLPIVTPSGD
FT                   LDWAVYTGPESLAPAGHGLLEPTGTRLGADAVAEARVLVCPALAADRAGYRLGRGAGCY
FT                   DRVLAAAGEQTLSLAVVYDDELVDAVPVEPHDRPVRAVVTPGRGIVWTHHR"
FT   gene            418136..419065
FT                   /locus_tag="Tfu_0373"
FT   CDS             418136..419065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0373"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54411"
FT                   /db_xref="GOA:Q47T06"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T06"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54411.1"
FT                   /translation="MTDEQHSVTPVTKAVIPVAGLGTRFLPATKSTPKEMLPIVDKPAI
FT                   QYVVEEAVSAGLNDILMITGRNKRSIEDHFDRAYELEEALRAKGDIERLNAVRHPSDLA
FT                   QLHYVRQGEPRGLGHAVLCGAAHVGNEPFAVLLGDDLIGARETLLQRMIEVRQTYGGSV
FT                   IALMEVEPDQVSLYGCAAIEPTDEPDVVTVTDLVEKPPADQAPSRWAIIGRYICDPEIF
FT                   EVLRKTPPGRGGEIQLTDALRELAQRSSNGGGRVHGVLFRGQRFDTGNKLDYLRTVVEF
FT                   ACESPDLAKEFVPWLRDFLTRYATDSTR"
FT   gene            419102..420334
FT                   /locus_tag="Tfu_0374"
FT   CDS             419102..420334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0374"
FT                   /product="molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54412"
FT                   /db_xref="GOA:Q47T05"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T05"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54412.1"
FT                   /translation="MKSVEQHVSDILAVVSRPDPIELDLLRAHGAVLAEPVTAELSLPP
FT                   FDNSAMDGYAVCAADVATATPQTPVTLPVIADIPAGDVFASAIPVGCCARIMTGAALPK
FT                   GADAVVPVEWTDAGVAEVAVHRAVEAGHAVRQAGSDVKEGTEVLPAGVRIGPAEVAVLA
FT                   AVGRRSVSVYPRPRVVVLGTGEELVEPGRPLSPGQIWESNSFMLTAAAIEAGCEGYRYG
FT                   FVGDDPDQVFEAIQDALVRADIVITSGGVSMGAHDAVKEVLSRLGTVQFDKVAVQPGMP
FT                   QGYGTVGESSIPIIALPGNPVSSYVSFYLFVLPALRKMSGLPQEQLPSVRARLLAPITS
FT                   SPRGRRSYLRAVLDYDIESEEVAYTALPVAQQGSHQLSALAKTNALVVVPEQVTELPEG
FT                   SVVEAIQLPHR"
FT   gene            420378..420866
FT                   /locus_tag="Tfu_0375"
FT   CDS             420378..420866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0375"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54413"
FT                   /db_xref="GOA:Q47T04"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023046"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T04"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54413.1"
FT                   /translation="MSHPSTPGFPHLDASGAARMVDVSGKEVTARSAVATGRVLLSPAA
FT                   VAALREGAVPKGDALAVARIAGIQGAKRTPDLVPLCHPIAIHGVDVALTVVDRGVDIRA
FT                   TVRTADRTGVEMEALTCVMTAALALIDMVKALDPEAVVTDVRVEEKTGGKTGQWRRSG"
FT   gene            420863..421366
FT                   /locus_tag="Tfu_0376"
FT   CDS             420863..421366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0376"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54414"
FT                   /db_xref="GOA:Q47T03"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T03"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54414.1"
FT                   /translation="MTAAAPRAVVITVSDRAAAGEYPDRSGPLLVELAAQAGCVVDGPR
FT                   VVPDGLPVAEALRRALAEGYDVALTTGGTGLAPRDRTPEATRPLLEYEIPGLAEALRAA
FT                   GRDKGVPTAVLSRGLAGVARRGGHRMLVVNLPGSVGGVRDGMAVLGPILGHAVAQLRGG
FT                   DHHA"
FT   gene            421462..422127
FT                   /locus_tag="Tfu_0377"
FT   CDS             421462..422127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0377"
FT                   /product="ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54415"
FT                   /db_xref="GOA:Q47T02"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T02"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54415.1"
FT                   /translation="MRGWPVSLAEGKVVLRPLRLRDAPALRETRARNSEWLRPWEPTHP
FT                   ELPPQSDSLLAYVAMVQSIRREARQGIAMPWAITWEGRFIGQITVGAITWGSARSAQIG
FT                   YWIDRDYAGRGVMPTAVALAVDHAFFTVGLHRVEANIRPENHKSRRVVEKLGFREEGLR
FT                   KRQLHIDGEWRDHLCYALTVEDVPGGLLARWRKVREQRGDTVSEKTRGASPGRPDRPH"
FT   gene            422598..423173
FT                   /locus_tag="Tfu_0378"
FT   CDS             422598..423173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54416"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54416.1"
FT                   /translation="MSSSPLYLAIVAVWILVLVPMLLRRDAADPDAEGLRRDLVDEELS
FT                   EASGGEGEAEDEEDTEPDAEHAARAEPPPVAPRPYRVSRARIIARRRRRTAALALLLVG
FT                   TGIAVAAGLGPWWVLVPPVLLMAGHVVLLREAAKADAERRAAMMARRRARQRARRSAEA
FT                   ARRARVVELKRNQVYDQYTDAQRRAAGD"
FT   sig_peptide     422598..422681
FT                   /locus_tag="Tfu_0378"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.832) with cleavage site probability 0.757 at
FT                   residue 28"
FT   gene            423371..423444
FT                   /locus_tag="Tfu_R0009"
FT   tRNA            423371..423444
FT                   /locus_tag="Tfu_R0009"
FT                   /product="tRNA-Ala"
FT   gene            424045..424260
FT                   /locus_tag="Tfu_0379"
FT   CDS             424045..424260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47T00"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54417.1"
FT                   /translation="MIKKICAVAALTAAVIFGSAGTASADAPGTEFRGWTWWLGTEVVE
FT                   IVDDVADALADGDDGVVTILRGWTWW"
FT   sig_peptide     424045..424122
FT                   /locus_tag="Tfu_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            424610..425116
FT                   /locus_tag="Tfu_0380"
FT   CDS             424610..425116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54418"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54418.1"
FT                   /translation="MTDRPKQYEEGGYYPAEDPSPRAEESSATESTTVPHEPAPEPGQE
FT                   FRRTTPARVKTIRPERPQGRWGLISGTTLYVMCSAGSADYLPVSVRLTGHVLFWLALGI
FT                   ALLITLYRERLYDWDPAPRWPWAAALICGTLAVEVLAAAVSSLTVIIGSAVVLSVVVLI
FT                   LLMVG"
FT   gene            complement(425133..425450)
FT                   /locus_tag="Tfu_0381"
FT   CDS             complement(425133..425450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0381"
FT                   /product="sec-independent protein translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54419"
FT                   /db_xref="GOA:Q47SZ8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54419.1"
FT                   /translation="MFNIGAGEFLVLSVLALLIFGPDQLPKAAAQAGRALRQLRKMADN
FT                   AKRDIREGLGPEYKDFDVADLHPKRFVQKHFWEAVDEEESSLSVSARLNGRRPPFDNEA
FT                   T"
FT   sig_peptide     complement(425358..425450)
FT                   /locus_tag="Tfu_0381"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.598 at
FT                   residue 31"
FT   gene            complement(425495..426295)
FT                   /locus_tag="Tfu_0382"
FT   CDS             complement(425495..426295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0382"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54420"
FT                   /db_xref="GOA:Q47SZ7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54420.1"
FT                   /translation="MTSHRAVLPKAPAPRLLAGWLAVAAGALTAVTWQVIVGGPVTALD
FT                   WPVHAFVDPRQPEGPLLWAAVATARLGQRLITIPLLVGLAIWAMRRGRGWRPLGAVLTG
FT                   LGSLAVLGTLLKVGVGRTPPVLEVDTVSPGAGNIAAWVYALLVPGAPPFDGYVSFPSGH
FT                   AANAALTYPLAAWLLFGANGVFPHARRLRYALGCSLLPVAAVGVLVTVLDYHWLSESVA
FT                   GWLLGAVVLLVALLVLEARTPDRAAPPHQHAMSQVMADEPPGSG"
FT   sig_peptide     complement(426164..426295)
FT                   /locus_tag="Tfu_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.881) with cleavage site probability 0.393 at
FT                   residue 44"
FT   gene            426517..427455
FT                   /locus_tag="Tfu_0383"
FT   CDS             426517..427455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54421"
FT                   /db_xref="GOA:Q47SZ6"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54421.1"
FT                   /translation="MANWAWRDTLARFVDSQWFQNLVVAVILANGVVLGLETYEDRFVW
FT                   LDRNWMLIEGCFLTFFVLELTLRILARGVVFFRDVWNWFDLVVVGISLIPLAGGFAVLR
FT                   LVRVLRLLRLVSVLPSLRYIVDALFRSVPGLGTVIALLFVVMYTAAIMGEQLFGEISPQ
FT                   YFGNLGTTLYTLFMLLTMENWPDISDSVIEDAPYAWIFFVSYIVVSAFIVLNLIIGVIV
FT                   TTMEEEVSAPRWAEDQEIELHQHEQVMLRLEQLSDQVAVLSAQLRALGVAVEEVSNFRV
FT                   LPLESTRHEKRPSAKRGRRTRRKNRRRRRSA"
FT   gene            complement(427452..427655)
FT                   /locus_tag="Tfu_0384"
FT   CDS             complement(427452..427655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0384"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54422"
FT                   /db_xref="GOA:Q47SZ5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54422.1"
FT                   /translation="MAQGTVKWFNSEKGFGFIAVDGGGPDVFVHYSAIAGTGFRNLEEN
FT                   QAVEFEIVPGPKGPQAADVRAL"
FT   gene            complement(427978..429894)
FT                   /locus_tag="Tfu_0385"
FT   CDS             complement(427978..429894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0385"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54423"
FT                   /db_xref="GOA:Q47SZ4"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54423.1"
FT                   /translation="MGGEQYPPPGRRKGVGVFPRRASAAGTYSPTKRMSTTALQDKVSP
FT                   SPESQSLRERLVPALPSPAWLGWVVALVVAAFAGALRFIRLGEPAQIYFDETYYAKDAY
FT                   GLREYGYEHETVENADELLRNGVSHIFAGGGDFVVHPPFGKWLIALGDTVWGLLPFGAT
FT                   FTPTGWRFAAAVFGTLSVLLLVRITQRMTRSIVLGASAGLIMALDGLHFTLSRIAMVDI
FT                   FLTFWILAGFGCLVIDRDRTRARLAEATEAGRATVNAFTAWWWTVVADAARALAPSQTA
FT                   AESDEQTGKHAQPGLRERWAAAAAARAEQARSPEEAAVRWLGVRWWRIAAGVCLGLACG
FT                   TKWTALFYLAAFGLLTVAWDYGARRSVGQRRVWGRWLGYDAIPAFFQMVGTAFVVYLAT
FT                   WSGWLATSGGWGRQWADLTPEVQSYTGFLPGPLREAANALISLGHYHWRMWSFHKDLGE
FT                   PHDFASQPWDWIIMRVPVAFYYDGEGTDCGATACSDAILSIGTPAIWWLSILACGVMLG
FT                   WWVTYRDWRAGAALLGVAAGWLPWFAFPQRTMFLFYALPFLPFLVLAIVLMLGLMLGSP
FT                   GDRPGTSPWSRVVGSVIYGVVMLLIIANFTYLYPVLSAETIPYTEWADRMWFPTWIYGS
FT                   GGN"
FT   gene            430143..431012
FT                   /locus_tag="Tfu_0386"
FT   CDS             430143..431012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0386"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54424"
FT                   /db_xref="GOA:Q47SZ3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54424.1"
FT                   /translation="MADQQSSTRPGTLTLAGLPIGHRDDTTPRLRAALENAEIIAAEDT
FT                   RRLRQFAARIGVRPGGKRGARIVSYYDANERERAAELLADLQAGHDVLLVTDAGMPGVS
FT                   DPGYRLITACVDAGVPMTVIPGPSAVTAALVLSGLPTDRFCFEGFPPRKGLAAYLAGLA
FT                   DERRTMVFFEAPHRLAATLTAMADAFGPDRPAAVCRELTKTYEEVRRGGLAELAEWAAE
FT                   HARGEITLVVRGAERTTPQATPEALVAAVAAREDQGVPRKQAIQQVAQEYGVPKREVYN
FT                   AVHRTPSD"
FT   gene            complement(431084..433819)
FT                   /locus_tag="Tfu_0387"
FT   CDS             complement(431084..433819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0387"
FT                   /product="protein translocase subunit secD / protein
FT                   translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54425"
FT                   /db_xref="GOA:Q47SZ2"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54425.1"
FT                   /translation="MTSSPGSGARWLRALISLLIMAGAFTAGWFLKPKLGLDLSGGTQI
FT                   VLETRDAEDGTKANASNTDLVVEVLRNRIDSLGVSEATLSRSGENRIIVELPGVQDPTE
FT                   AAEVLGQTAQLTIHPVLGVDQSIGTTGGGMFGDFRNAPADNSAEASDSEAQEEESPAED
FT                   EEGSEESTESGEEAEAVDPEDIALTLPDESGTLLQLGKPALTGDQVDRAEATLNELQTE
FT                   WLVNVEFKGAGREAWKKLTGEAACHSPGDPRRRIAIVLDNEIISAPEVDANDVACNVGM
FT                   SGGRTSITGGFDAEEAKELALLIEGGSLPLPVEEVQRQTVGPTLGAEAIKASFIAGLIG
FT                   IALTAIYISISYRFAGFLASVALLCYTVIAYAALVALGATLTLPGLAGFVLSIGMAIDA
FT                   NVLIFERTREEYQRQEKVYQANKSAGMLDATEKEQDEAAAGVVTRRRRRAIPPNLLKSF
FT                   TVGSQRAWSAVLDTNITTLIAAVLLFFLASGTVQGFGVTLGLGTIASMISALLIARVLM
FT                   EWTVSRFTPLRRLWLIGAAAVVVGLVAVLSDGLRVDNVLLLVSGALGVLAVSVAIIPLI
FT                   VRKFPRSSGIAHISAVRKWLVEHNPDLMKRSTLWLGITGVVTVLALLGFAVRSPNLGVE
FT                   FTGGRVMTFSVTEELNADQARELVAGAGYANAVVQEVEGGEISVRTGHISDQEAAKIQD
FT                   ALAEEGGEVERTSDEKIGPSMGSELRNKALIALIVALVLQMAYLAWRFRWSFGLATMLA
FT                   LAFDIILVIGLFVWLGKPIDGVFLAALLSIIGFSVNDSVVVFDRVRDEWAHKPKGDFRE
FT                   IANSSVLHTLPRTVNSGIGGLFILAALAVLGGSSLTDFSIAMLVGLISGIFSTVFVAVP
FT                   LAIWLQRFDRTPPPHEVKERKTKQRKQQRAIRERTDGAVV"
FT   gene            complement(433892..434278)
FT                   /locus_tag="Tfu_0388"
FT   CDS             complement(433892..434278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54426"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54426.1"
FT                   /translation="MVTTVSRVLAVLLAVLLAFGQSLTEQQEPPPRPEPTPSTVVATAK
FT                   PWPHAVVKPATNSTTIALVLAYGQRKQSAPPRDLPDGYVPFPVAVPAPGDAWRFSPRTS
FT                   GPGLLPDTHVDLPWGRAPPFTALS"
FT   sig_peptide     complement(434150..434278)
FT                   /locus_tag="Tfu_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.387 at
FT                   residue 43"
FT   gene            434465..436285
FT                   /locus_tag="Tfu_0389"
FT   CDS             434465..436285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0389"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54427"
FT                   /db_xref="GOA:Q47SZ0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54427.1"
FT                   /translation="MSSKRHILTAVAWPYANGPRHIGHVSGFGVPSDVFARFQRMSGNN
FT                   VLMVSGTDEHGTPIQVLADQEGVSARELADRYNRIIAEDLVALGLSYDLFTRTTTANHY
FT                   AVVQELFTGLYRNGYIFSKTTKGAISPSTGRTLPDRYVEGTCPICGYDGARGDQCDNCG
FT                   KQLDPTDLINPRSKINGETPEFVDTEHFMLDLPAFAEQLSEWLKSKGGEWRPNVLKFSL
FT                   NLLDELQPRAITRDLDWGVPIPLEGWRDQPNKRLYVWFDAVIGYLSASIEWAKRTGDPE
FT                   AWRKWWQNSDAESFYFMGKDNIVFHSEIWPAMLLGYSGKGSKGGEPGSLGALNLPTEVV
FT                   SSEFLTMEGRKFSSSRRVVIYVRDFLERYDADALRYYIIAAGPETQDTDFTWAEFVRRN
FT                   NDELVATWGNLVNRSISMAAKNIGHIPEAGELTDADRAVLDASKAAFATVGERLNRAQF
FT                   KAALQEAMRVVAEANKYFSEQAPWKLKKTDPKRMETVLHVALQLVSDAKTLLTPFLPAS
FT                   SNKVYEMLGGTGTWTGMPRLEEATDSIGGEEGVSTYPVITGDYADNEARWESIPIVPGT
FT                   PLKPPTPLFRKLDQSVVDEELARLEAAAGA"
FT   gene            complement(436528..436962)
FT                   /locus_tag="Tfu_0390"
FT   CDS             complement(436528..436962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54428"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54428.1"
FT                   /translation="MPATFTESNNFDTDRNQDARLAALIRQLAEIRPEILHPAAPTPQP
FT                   ASRPAPQSTARPPRPLRPHPTDPASPHHITYLRALSCGTHKPGQYWPAHATQEYYARKL
FT                   RLWLRRRIAYAGHDAKPAITAALAFTAGCLLTLLGTTVLT"
FT   gene            complement(437128..437538)
FT                   /locus_tag="Tfu_0391"
FT   CDS             complement(437128..437538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54429"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54429.1"
FT                   /translation="MSCTVCSPALNTTHAAHTLRAADLSRFASAGQMRSHLHRDLAGFP
FT                   AELVDDVQLCASELFANAVNHTVSGAPGGQVVRSLSLPAADRLRLEVTDSGLTPHRPRI
FT                   PDLSGTARFTAEHHRGLLLVSALALDWGTAPQ"
FT   gene            437708..438553
FT                   /locus_tag="Tfu_0392"
FT   CDS             437708..438553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0392"
FT                   /product="helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54430"
FT                   /db_xref="GOA:Q47SY7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54430.1"
FT                   /translation="MVARMPVRRRYLVIQLKRLRREAGLSQDEVWKALGWSRAKLQRLE
FT                   AGDFQRLKAGDIMALCQVYKADKAVAEELIQIARDSRAEKPWWIRYKDVLPGAFLGLEA
FT                   EATLIQEYNIALVPGLLQTRDYATALMRTSVDIHGEEEVQRRLEIRAERQRTVLDREEP
FT                   PMVMAVIDEAAIRRQIGGVETMKAQVRHLLELSERPRIDIQILPFSAGAHAAAGVPFTI
FT                   LGFDGTDAAGSVVYLESHKDGYYLDTDEEIARYRLIFSRTQGSAMSVEDSRIFLERLLT
FT                   "
FT   gene            438582..438773
FT                   /locus_tag="Tfu_0393"
FT   CDS             438582..438773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54431"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54431.1"
FT                   /translation="MDLTFAEWKKSSYSNPSSNNCVEVAVVPRLSAVRDSQHRELGRLE
FT                   FPVMEWAAFLSAAKRDAL"
FT   gene            complement(438981..439244)
FT                   /locus_tag="Tfu_0394"
FT   CDS             complement(438981..439244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0394"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54432"
FT                   /db_xref="GOA:Q47SY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54432.1"
FT                   /translation="MRSLPGLYKRVVSGSSDDALLADLFGIDSRYSVQAEEKRQRLAQL
FT                   ESAVPRGAATPEEIDECHGVQQAVASPFTARVDEAARRISRA"
FT   gene            complement(440028..441494)
FT                   /locus_tag="Tfu_0395"
FT   CDS             complement(440028..441494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54433"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54433.1"
FT                   /translation="MLRRVVGFFLIAAVLSLVMQALNLLSVFQIEIPLIIAIAVGGAAI
FT                   AEVAFPTWQARFERESALRDEQARAIREGCFTLPSGKLPQVRQLSDPLAWGVHPTAASS
FT                   GSDVVPFVPRDVDEELRAQLTKNAFVLVVGDSTAGKSRCAFEAVRAVLPRHTLIIPTAV
FT                   GSIAATLKAAERYSRRVLWLDDINRWFASPELTREAISQLLTPGKRRHRVVVATLRAAE
FT                   ADNWSTMPEEATALDTYRKVQDLLKLARLFRLDRLFSPAERERARDYVSDARIADALEH
FT                   ADEYGLAEYLANGPQRWEEWQNAWSVNTNPQAPTHPRGAALVAAAVDLRRAGYVSPIPR
FT                   ALLEEVHGIYLEQRGGERLNPEPLARAWRWATSPREGTTRLLTPYRAERVDVFDYLVDE
FT                   VQRRTPAGNHVPDQVIVTALVYASAADARSIGTTAYAQGRYRLAERAYRQAYNADLTEH
FT                   GLTHPDTLTSRNNLASVLRELGRPDEAEEI"
FT   sig_peptide     complement(441354..441494)
FT                   /locus_tag="Tfu_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.459 at
FT                   residue 47"
FT   gene            complement(441839..442399)
FT                   /locus_tag="Tfu_0396"
FT   CDS             complement(441839..442399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54434"
FT                   /db_xref="GOA:Q47SY3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54434.1"
FT                   /translation="MTQRSTTLYIVVCAAGAAPDVGTLVSLAQEEGWTVQIIATPSAVT
FT                   FIDSSALEKQTGRPVRSTHRKPGQPRSPKAGAVIVAPATFNTINKLAHGIADNYALSVV
FT                   NEAIGLGVPVVVLPFVNSASAARLPFQRSVESLRDEGVAVLIGPGKFEPHPPGSGEKAR
FT                   AIFPWASALHALQEILQKKSVTS"
FT   sig_peptide     complement(442313..442399)
FT                   /locus_tag="Tfu_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.525 at
FT                   residue 29"
FT   gene            complement(442757..443839)
FT                   /locus_tag="Tfu_0397"
FT   CDS             complement(442757..443839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0397"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54435"
FT                   /db_xref="GOA:Q47SY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54435.1"
FT                   /translation="MYVAELAVSGIRGFYGARSVELGFTRPDGAHAGWTVLAGPNGAGK
FT                   TTLLRALALALVGPSVGRALMSDFRGWLSRGESDGWVRARLVPDPQWDRTPRGQDVLRE
FT                   PFEAELYWSDFGGARPQFLIEPDRTVLLENGPWAEHPHGWFVVGYGPFRRLGGQWSRPG
FT                   RPVPVPGALSRLANLFGEDASLAEGLRWLTGVHLGWREGTHIVPRFVLSLLDDGLLPSG
FT                   FRIARLDGEGLWIAHGGEEFLLGELGDGHRLMVALVVDLVRHAFEMYGASALGEQGGMP
FT                   AVVCPGVVLIDEVEAHLHAGWQQTIGGWLRQHFPRIQFVVTTHSPYICRDADEGGLIRL
FT                   SAVDRNEPPQVVSAPKELAS"
FT   gene            443951..444871
FT                   /locus_tag="Tfu_0398"
FT   CDS             443951..444871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0398"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54436"
FT                   /db_xref="GOA:Q47SY1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54436.1"
FT                   /translation="MLSVSKSRRQREKRDRARTEPPPLPEPLRVAVPDCHTHMDMQGGD
FT                   VAEIVAKAASVGVTPIIQVGCDVAGSRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPE
FT                   DEATEWEPARPAGGEAALEEALAEIDALAAHEKVCAIGETGLDCYRTGPEGFDIQERSF
FT                   RAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDAAMAKLCADRGYY
FT                   MSFAGNVTFGSAQQLRDAAAVVPLELLLVETDAPFLTPKPHRGRPNAPYLIPHTLRALA
FT                   ELKGMAEDELAETVAANARRAFALP"
FT   gene            complement(444872..445990)
FT                   /locus_tag="Tfu_0399"
FT   CDS             complement(444872..445990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0399"
FT                   /product="putative fatty acid-CoA racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54437"
FT                   /db_xref="GOA:Q47SY0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54437.1"
FT                   /translation="MGPLSGIRVVEFAGIGPGPMAAMLLADLGASVIRVDRPGSPILAP
FT                   GAQRPQMSAGRPVLEANLKSEKDLARVRAVVAAADVLLEGFRPGVMERLGLGPDECLAA
FT                   NPRLVYARMTGWGQDGPLARRAGHDMNYISLTGALHSVGRRGQAPVPPVNLVGDFGGGS
FT                   MFVVTGILAALLERERSGKGQVVDAAMVDGSAVLMSMMYEDLAQGLWRDERGVNYLDTG
FT                   APFYDVYECADHRYLAVACLEPQFYAVFLDKLGLDPAELPHQWDPSGWPVLRERFADVL
FT                   RTRTRDEWAEVFADTDACVSPVLSMTEAADHPHIKARGSLVRDGDVIYPGPAPRFSRTP
FT                   ARSTRAPHTPTPDVAQVLAEWGVDDNPEPEDS"
FT   gene            446285..447241
FT                   /locus_tag="Tfu_0400"
FT   CDS             446285..447241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54438"
FT                   /db_xref="GOA:Q47SX9"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54438.1"
FT                   /translation="MSGPPAVSPVPDWQLRIRTSQGGTAGAGVLVSPRHVLTCAHVVCT
FT                   ALGLPWAEEDTPRPREPVTVDAPRGGGSWQATATVLDDGWFADRSPWDAAVLLLDRPAP
FT                   ADPPEMRLCGSEPGRAVSMVGFSHEAVPAGVWSRAVLVGHGGGRRFEYVQFDVTSSTTA
FT                   RVVHGFSGSGVREHPGGALIGIVCDAMRDDRGLGASGWLIPIEAVPRVWGDRSAAQPPS
FT                   REPDSPRLVHRLAEALASTPTIADPEARKSWCALLDERIRKRIHVGRAPLFFAFDLVDV
FT                   ARDYGLLGEVLDTLAMVEEGSRQMRQVREAAEALGER"
FT   gene            447298..448740
FT                   /locus_tag="Tfu_0401"
FT   CDS             447298..448740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54439"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54439.1"
FT                   /translation="MYEEDARQRFWLCLPADVRARLSVAGDPYGFALSLVIQCCDQQRL
FT                   GVMLRWLRCLENDSKPAMQVCELAEGLLEAEEWELSGQGRERDTWEQLRKALREVPYDD
FT                   QVDLLCQRVVPLPPEQIEAPSPRNAWEAFLDLKEATLGPRGEDPGERFLQLLAEYTGRA
FT                   ELVRAVAEWGADQRHATVVKRSGWGGGEPFRPLPPPRLIIKIGYDLGNLERLSVAYRLV
FT                   TDPDDDWMDVCEAEALTEVTEEELPRRISELIIWAESQQAADHGKLRLEFIFPFSLLFR
FT                   FVVQNWPLELHEDAPAPSLGSQYEIIIRSEEFARDPRAQRICQRRWQNLHEGRGRVGSS
FT                   STVLEEGWENVANYLGNEAIVAFVAYALPGVDWQRQVYAAVICGVPVVAWRWMGKNGNP
FT                   EAHFLSILRGEEEMASGKQEMNGLERGIKNLTKNLYLSRINRGTAEMRNRSRQSYDLSV
FT                   IYHDYQPKPREQRQVLSGGNIR"
FT   gene            448770..449927
FT                   /locus_tag="Tfu_0402"
FT   CDS             448770..449927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0402"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54440"
FT                   /db_xref="GOA:Q47SX7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54440.1"
FT                   /translation="MAASQTPPSGTFSSPQEEAPRWWIFHGTGTPRPHLDLAAQLPPPP
FT                   PWRTRRTTAPTDALEAPPYDDDEAGWVLGAQPELSVLGSPLTPARRERLATINAALYLR
FT                   RPLLVTGPPGVGKSVLADQIARELGLGRVLRWTVNSRSTLRSGLYDYDPLAQIHDLNLE
FT                   NLHGGTRDTSGPAPAAADLVRSSAQRIGHYLRIGPLGTAFLPHRLPRVLLIDGLDNGDY
FT                   DLLGDLLDLLERGRYTIPELARLSSVEPQISVPIDDPQRTATIVNGEVRCSQLPVVVIT
FT                   AHEDHPFPPEFLRQCIPLRLTHPSKEELAGIVAAHFSGNLPSATPAVVADFVRRIAEGS
FT                   PLAIDQLLNAVYLTTVIDAKTSEPTPEFLQELAEMVWHRLTDTHG"
FT   gene            449924..454495
FT                   /locus_tag="Tfu_0403"
FT   CDS             449924..454495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54441"
FT                   /db_xref="GOA:Q47SX6"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54441.1"
FT                   /translation="MTSRRSHETPQGPDPRSPGAAPAYREAPPALTGRELADAVYLAAW
FT                   QQHTAQHPPARPSGGKDTALYAPSRVRGALLARPSQQRHDPKRRRHRVRGALLARPSGG
FT                   KDTAPAAGPQRPGTDPSAAVLGAAEKTAGTEPPRLPPAPAPPSGALRPHPSPLLHRSAL
FT                   YQALRPFRLAATDPWQHSYDAEETARGYARRLLASPHPGGGHRPVAVTPQWAPFVRPGV
FT                   QLTVLVDESVSMLFHQDQVNDFIGLVRSSGVFRGVRVERFTSDSADPAPVPAAGWGASS
FT                   GKDPGGIHIAVVLSDGIGEGWARGSVQSWLGCLAQRLPVAIIHLLDPRQWSRTGIRPAA
FT                   MELTVAAHLGRAPANRHYTARPFQWPDGLPLPEPEFPHSALSVVLPVLASRPEMIHAWA
FT                   RFVMGTRQRTLNAGALRVVPGDTAANAAGERPTAAPTPEARVRRFRRDSSETAFQIAVD
FT                   LAAVPLTEPVIAAVCQRFAGHPQPSELIEVLFSGLVTEVDSPVVTPERRIRWEYRRGVR
FT                   EALLSLGGRRSRIRRTLADIAAEFAGYDPWFALLRRILDDSPVGELPELDETSLRLAAD
FT                   TLPALESIGLADLHHGLVYRIKEQMLAHQGAGHPDDWSDTLLEIAPTGPLVPGSSGQHG
FT                   TTASERVPHAPHPTETPSNSASDESSMMSQRSVSISDNFPGGSGSTGIGAGRNTSLSAI
FT                   WGGDIPPRNALFTGRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRF
FT                   RDEYDLVWWVRGGQTHQIHEAYTLLAQELDVFRDNTSINSTIHSVREALRRGKPRSRWL
FT                   LIFDDVRQPDDIMRYLPIAGPGHVIITTRNLTWPEGGYFKTLPVEVFSLQESVALLSKC
FT                   GLVGFSKHEAAELAEELGHMPIALRQAAAWMNDSATTIAEYLEFYRDKQAQLAPMFAPA
FT                   DPDYPETVITALNVSLDRLAVTNPAALQLLQVCSFFSTAPIPRSLFRHAQDVAAPPELE
FT                   AALQEPNKLHRAFSDIGRYGLAVLNHRTRTVQVHRLVQQALRVPLTADDQEQRRHCAHL
FT                   LLAKNDPQDTSSPGARIRYAQLLPHVWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDS
FT                   KQLAEATLSVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGP
FT                   DSEEALEASLEFVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALL
FT                   LAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTE
FT                   RIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIAVVAA
FT                   ANHAAALRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEAR
FT                   VIDERALQVLTDRLGEYHTSTLSSALNLASDFFGLDDVAESVRRDTETLARCRRALSER
FT                   HPLTLLARRNLVLGRKAMNEDVAEEIAAVERLYAEVMGDQHPATLSMRRRERGNADLHL
FT                   NNL"
FT   gene            455040..455363
FT                   /locus_tag="Tfu_0404"
FT   CDS             455040..455363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54442"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54442.1"
FT                   /translation="MNQLVALAIDDETEILIEPAGERTGPVNVAFPGTQRVRKQLDQVF
FT                   GQIRQIAETVAEKVQDLPGKPDEVTVELGVGLTATADVFIAQSTADASFKVTLTWKDPA
FT                   ART"
FT   gene            455398..456261
FT                   /locus_tag="Tfu_0405"
FT   CDS             455398..456261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0405"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54443"
FT                   /db_xref="GOA:Q47SX4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54443.1"
FT                   /translation="MTESDSADARLLTPADVRRLAAQLGIRPTKTLGQNFVIDPGTVRR
FT                   IVRAAQVSPDDVVVEVGPGLGSLTLALLPHVRHVTAVEIDPRLAEALPGTVADHAPAYA
FT                   HRLRVVTADALRITELPDPQPTALVANLPYNVAVPVVLHLLNLLPSLEHGLVMVQAEVA
FT                   ERLAARPGDRAYGAPSAKIAWYADVRRAGAIGRTVFWPVPNVDSGLVALRRRPAPPTKA
FT                   SREDVFAVVDAAFAQRRKTLRAALSSWAGSAAAAEAALRSAGVDPRSRGETLGIADFAR
FT                   IAEHRP"
FT   gene            complement(456285..458159)
FT                   /locus_tag="Tfu_0406"
FT   CDS             complement(456285..458159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0406"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54444"
FT                   /db_xref="GOA:Q47SX3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54444.1"
FT                   /translation="MPSDGLPKNLEPLAAGDPATIGPYVLVGRLGSGGMGTVYLGRAPE
FT                   KGTHVAIKVIRPELAFDEATRARFRDEMENARKVASFCTAKVLDHGTFQNRPYMVTEYI
FT                   AGTALAEHIAEHGPLDSGTLHGFALGVAAALAAIHKAGLVHRDLKPANVLLSLSGPRVI
FT                   DFGIARALNTSTSHTQTGIVMGSPGWMAPEQLLEEKVTTKADIFAWGCLVAFAGNGRHP
FT                   FGNGDAMTLGKRMLFAEPDIGNLDPPLDRLVARALAKDPDQRPTAQELLLELAGGTDSN
FT                   DTNDVVSHALHQSWRPNFPPMPPGYPPPSPQAHSGMPGPQAQAQAPGQTTIAPQPYAHP
FT                   QQGGPGPMPPQAAGPQGGPQGGPQSPPMPQRPGPQASHHTGQIPVVPPTTGRQPPRSPA
FT                   AQGSSGGPQARPYVPPNTLPPHRPLRPDSSRSRLLIVFAVLGAVLLAVVLVFGLVFFQD
FT                   WFSSTSDTNPPGQGQEQQSSAPKEDPDDESDKSDTQAADPQAGESLRFDLLDWYCGNQV
FT                   LDRPLIVNGGEYCVAEIEAHNSANYPVKFRHDLQILAHASGEQTKADAPLHGEGADPLW
FT                   AGPIQPGDTVRGYLVFIVHSELTPEVLILRSTVDSPGQQIEIPSGQPA"
FT   gene            458401..459324
FT                   /locus_tag="Tfu_0407"
FT   CDS             458401..459324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0407"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54445"
FT                   /db_xref="GOA:Q47SX2"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54445.1"
FT                   /translation="MNAPTSVTVRVPAKVNLRLAVGPVRGDGYHGLVNVFHAVSLYDEV
FT                   TVSPRSDLAPGQAVLSVDGERPDHVARVPLDDSNLAARAAALLARHVPHATGVHIHVHK
FT                   AIPVAGGMAGGSADAAAALVACDALWEGGTPRERLLELAAELGSDVAFPLIGCTAVGTG
FT                   RGEQLSPLPVQGTFHWVFALVDGGLSTTKVFAEYDRLRPDAPEPTLDDALVAALAAGDA
FT                   RRLGAALTNDLQPAALALRPELGDLLEAGRAAGALGALVSGSGPTCAFLAESADHAREL
FT                   AAALRASGTCADTVTAHGPVPGATVV"
FT   gene            complement(459329..459790)
FT                   /locus_tag="Tfu_0408"
FT   CDS             complement(459329..459790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0408"
FT                   /product="redox-sensitive transcriptional activator SoxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54446"
FT                   /db_xref="GOA:Q47SX1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54446.1"
FT                   /translation="MAQLPVQLTIGQLAERSGMSHSALRFYEAKGLIRAERTAGNQRRY
FT                   HRSTLRRLAFIAAAQRVGLTLARIQEALATLPEERAPTAEDWARLSRMWRDELETRIDA
FT                   LQRLRDRLTSCIGCGCLSLRSCALRNNDDALAAWGPGAPLLRPAREGGL"
FT   gene            459933..461723
FT                   /locus_tag="Tfu_0409"
FT   CDS             459933..461723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0409"
FT                   /product="ABC transporter, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54447"
FT                   /db_xref="GOA:Q47SX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54447.1"
FT                   /translation="MEGMNLVNLQDVSLAYGPLVLLDSVSLGIEEGDRIGIVGRNGGGK
FT                   STLVSVIAGRLQPDSGRVVHSRGLRIGFLHQQDSFPDTTVGQFVLDGRAEHEWAGDARI
FT                   RDVLRGLLSGWDLNARMAHLSGGERRRAGLARMLIDTHDLIILDEPTNHLDIEGIAWLA
FT                   DHLNQRREAVAVVTHDRWFLDAVTQRTWEVVDGRVERYEGGYAAYVLAKAERQRLARAA
FT                   EERRQNLLRKELAWLRRGPPARTSKPKFRIEAANALIANEPPARDTVELVRFASSRLGK
FT                   TVIDVKDVTLRAGDTVLLDRLTWQLGPGDRIGVVGVNGSGKTSLLRLLAKEQAPDAGTV
FT                   RHGATVNLAHLSQNLAELDPEARPLQAVSEIRQRVTVGKREYSASQMLERFGFRGERQW
FT                   TPIGDLSGGERRRLQLLRLLMAEPNVLLLDEPTNDLDIETLTELEDLLDGWPGSLVVVS
FT                   HDRYFLERVCDQVFALLGDGTLRHLPGGVDEYLRLRAERAERGEIPQDGAAAKEDAGPA
FT                   EAAPKLSAAERRAAQKELQRIERRIDRISAREEELHALMAEAAEDYARLAELGAELKAL
FT                   TAEKAELEDAWLREAERLGE"
FT   gene            complement(461805..462710)
FT                   /locus_tag="Tfu_0410"
FT   CDS             complement(461805..462710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54448"
FT                   /db_xref="GOA:Q47SW9"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54448.1"
FT                   /translation="MRRFAWICTAAAVALLAASCSSEDNNAAEMQYYLSLGDGLTVGAQ
FT                   PDDSGDVLETATGYTNLVASALSKEPPGVQHVNLGCIGETTITFLSGGAEGCEYDEGSQ
FT                   LDAAVEFLEQHKGKVRLITISIGGENLFSCARDEDGALTTDIDRECVSENLQKVSEDAP
FT                   IIAQRLREAAGDDVEIIALTAYNPLLAMYLQEEVTEVVATEDDDERTYQDTANYTNGML
FT                   AAINGTLNDAYNAENITVANVATLFDVDNFEENDDGTPANVHNVCQYTWMCDTERGPDI
FT                   HLNQEGAQEVATLVQDVMRE"
FT   sig_peptide     complement(462645..462710)
FT                   /locus_tag="Tfu_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.667 at
FT                   residue 22"
FT   gene            complement(462889..463383)
FT                   /locus_tag="Tfu_0411"
FT   CDS             complement(462889..463383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0411"
FT                   /product="regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54449"
FT                   /db_xref="GOA:Q47SW8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54449.1"
FT                   /translation="MRDEVDGLVEAWRTERPDLDVAPLQVLSRVSRLARHLDRARRSVF
FT                   AAHDLEPWEFDVLAELRRSGHPYELSPGRLMRATLVTSGTMTNRIDRLTEDGLVRRLPD
FT                   PTDRRGVLVRLTDEGRERVDAALADLLRYEESLLAALTTAERDQLATLLRTVLAPLDEP
FT                   D"
FT   gene            complement(463431..464081)
FT                   /locus_tag="Tfu_0412"
FT   CDS             complement(463431..464081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0412"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54450"
FT                   /db_xref="GOA:Q47SW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54450.1"
FT                   /translation="MSEQSPKTRKKQRMTGKERREQLLAIGRELFAERGFAATSVEEIA
FT                   ARAGVSKPVVYEHFGGKEGVYAVVVDREMQRLLGLVSDALVEGSPRQKLERAALALLQY
FT                   IEEHSEGFRILARDSHAASGTGSFASLISDIATQVEHVLAEEFRARGYDPKLAPLYAQA
FT                   LVGMVALTGQWWLEVRRPRREVVAAHLVNLAWNGLSRLDTKPRVEGARSRRRE"
FT   gene            complement(464106..465056)
FT                   /locus_tag="Tfu_0413"
FT   CDS             complement(464106..465056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0413"
FT                   /product="Delta-9 acyl-phospholipid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54451"
FT                   /db_xref="GOA:Q47SW6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54451.1"
FT                   /translation="MSELSANSTQRRAPEPEILDEKRSRTERYTIFTFVFVPLLALAAA
FT                   VPFAWGWGLTWLDVAIGAVFYLIGGLGITVGYHRLFTHGSYRAARPLKIALAIAGSLAI
FT                   EGGVIKWVADHRRHHKYSDHEGDPHSPWRFGDDWRSVAKGMFYAHMGWLFLDEQKTSPK
FT                   RFAPDLLKDKDLVRIDRYFWVFVLISLLTPPLIGGLVTMSWWGACTAFFWGSLVRIALL
FT                   HHVTWSVNSICHTIGEENFTVRDRSRNVWWLAIPSFGESWHNLHHAEPTCARHGVLKGQ
FT                   IDISARVIWIFEKLGWATKVRWPDPERLAAKRVAA"
FT   gene            465582..465653
FT                   /locus_tag="Tfu_R0010"
FT   tRNA            465582..465653
FT                   /locus_tag="Tfu_R0010"
FT                   /product="tRNA-Gln"
FT   gene            466132..467586
FT                   /locus_tag="Tfu_0414"
FT   CDS             466132..467586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0414"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54452"
FT                   /db_xref="GOA:Q47SW5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54452.1"
FT                   /translation="MSASRPAAVMVLAAGEGTRMKSRRPKVLHEICGRSLLGHVLAAVA
FT                   ELEPQRTVVVVGHAREQVTEHLKSIAPHAITALQEEQKGTGHAVRMAIEALRAQNVELT
FT                   GTVVLTCGDTPLLRGATLRDLVAAHEAEGNAVTILSARVPDPTGYGRIVRDAAGAVTGI
FT                   VEHADATEEQRAVDEINSGMYAFDGALLSQVVHRLSADNAKGEEYITDAVALLRGDGHR
FT                   VGAYIAPDRTEVEGVNDRVQLAEARRLLNARLLEQLMRDGVTVVDPASTWVDVDVRVGR
FT                   DAVLEPQTQLQGRTVIGEGAQVGPATVLCDTEVGEDAVVSHTVAREAVIGPEATVGPYA
FT                   YLRPGARLDRGVKIGTFVEVKNSTVGEGSKVPHLTYVGDADIGKGVNIGASSVFVNYDG
FT                   VNKHRTVIGDYARTGSDTMFVAPVRVGDGAYTGAGTVVREDVPPGALAVSAGPQRTIEG
FT                   WVERKRPGTPAAQAAERARARSEEDR"
FT   gene            467669..468637
FT                   /locus_tag="Tfu_0415"
FT   CDS             467669..468637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0415"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54453"
FT                   /db_xref="GOA:Q47SW4"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54453.1"
FT                   /translation="MTGMKAAGQKKLMLFSGRTHPDLAAEVAVELGIETVPTRFQDFAN
FT                   GEIFVRYLESVRGCDAFVIQCHSDPINKSIMEQLIMVDALKRASAKRITVVTPFFGYAR
FT                   QDKKHRGREPISARLITDLFKAAGADRLMAVDLHTDQIQGFFDGPVDHLFALPLLADYV
FT                   AANVDLSNTTVVSPDSGRVRTADRWADRLGTPLAIVHKRRDPDVAHEVRVHEVVGEVRG
FT                   RTCVLVDDMIDTAGTIVKAADALFEQGAAKVIAVATHGVLSGPAVDRLKDSRISEVVIT
FT                   NSLPVSKDRQFDKLTQLSIAPLLARAINEVFSDGSVTSLFE"
FT   gene            468906..469490
FT                   /locus_tag="Tfu_0416"
FT   CDS             468906..469490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0416"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54454"
FT                   /db_xref="GOA:Q47SW3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54454.1"
FT                   /translation="MSEVRIAAEPRTEFGKGAARRARRAGKVPAVLYGHGIAPRHINLP
FT                   GHDLMLALKTPNVLLRLEGVDEKESLVLPKSVQRDPIKGFLEHVDLLVVQRGEKVVVEV
FT                   PLLVKGEVGAGGVLNLEMAQAEVRAEATRIPEGIEVDVDGLPIGTNVTAGDLKLPEGVE
FT                   LAMDPETIVMSVVAEAAPEATEEEEEGEAAE"
FT   gene            469518..470159
FT                   /locus_tag="Tfu_0417"
FT   CDS             469518..470159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0417"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54455"
FT                   /db_xref="GOA:Q47SW2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54455.1"
FT                   /translation="MRGLLARLWGGRASVSREPDARPGESGAVVSGERWLVVGLGNPGP
FT                   KYAGNRHNVGFMVVDELAAQRGERWRLHKAHAQVVETRVGDAPVVLAKPASYMNLSGGP
FT                   VAKLSAFYKVPVDRIIVVHDELDIPFARLKLKRGGGSAGHNGLRSITASLGSPDYVRVR
FT                   VGIGRPPGRMDAASFVLQDFSTAERKELDVHVARAADAVETVVTSGLEKA"
FT   gene            470300..471097
FT                   /locus_tag="Tfu_0418"
FT   CDS             470300..471097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0418"
FT                   /product="3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54456"
FT                   /db_xref="GOA:Q47SW1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54456.1"
FT                   /translation="MLNLVSTIRNDHEVARDLAFEAGQRLLRLRERHGFDEPEVLRTLG
FT                   DRVSHEFLFSALGRLRPSDPVLSEEGVEDPRRFRAHRVWIIDPLDGTREFGEAGRTDWA
FT                   VHVALWENGELVAGAVSLPAQGSTLSTVDPPWLPEERPAGQRLRITTSRTRPPEFVRRL
FT                   ANQLGAELVPMGSAGAKISAVMLGIADIYIHAGGQYEWDSAAPVAVARAAGLHTSRIDG
FT                   SSLTYNRPDPYLPDILVCRSELSGMLLASIRNVADMDNAGPHT"
FT   gene            471151..472080
FT                   /locus_tag="Tfu_0419"
FT   CDS             471151..472080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0419"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54457"
FT                   /db_xref="GOA:Q47SW0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54457.1"
FT                   /translation="MSQVSDAVGRYQLSQLDFLEAEAIFIMREVAAEFERPVLLFSGGK
FT                   DSVVMLRIAEKAFWPAPIPFPVMHVDTGHNFPEVIEFRDKRVAELGVRLIVASVQDLID
FT                   AGKVVEPKGRWASRNRLQTAALLEAIEKYGFDAAFGGARRDEEKARAKERVFSFRDEFG
FT                   QWDPKNQRPELWNLYNTRVHRGENIRVFPLSNWTELDVWHYIRREGLRLPSIYFAHRRR
FT                   VFERDGILLPDSPYVTRDEDEEVFEASVRYRTVGDMTCTGAVLSTATTLDEVIAEIAAT
FT                   RITERGQTRADDRGSEAAMEERKREGYF"
FT   gene            472136..473404
FT                   /locus_tag="Tfu_0420"
FT   CDS             472136..473404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0420"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54458"
FT                   /db_xref="GOA:Q47SV9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54458.1"
FT                   /translation="MATDILRFATAGSVDDGKSTLIGRLLYDTKSILEDQYEAVKRTSL
FT                   ARGEDQANLALLTDGLRAEREQGITIDVAYRYFATPRRTFIIADTPGHIQYTRNMVTGA
FT                   STADLAVILVDARKGVQEQSRRHAFLTTLLQVPHLVLAVNKMDLVGYSQERFEEIKAEF
FT                   TEFAAKLDVRDLAFIPISALHGDNVVERSAAMPWYDGPSLLQHLETVHIASDRNLVDAR
FT                   FPVQYVIRPYRADDPELHDYRGYAGQVTSGVLRPGDEVVHLPSGMATRIQRIVTADGDV
FT                   AEAFPPMSVTLLLEDDIDISRGDMICRPHNQPTVTQDLDAMVCWMSEGPPLAPRTKLLI
FT                   KHTTRVAKVMVRDLLYRIDTTTLERDESATSLALNEIGRVKLRVAQPLFVDEYRRNRLT
FT                   GGFILIDEGTNATVGAGMITQAG"
FT   gene            complement(473392..473883)
FT                   /locus_tag="Tfu_0421"
FT   CDS             complement(473392..473883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54459"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54459.1"
FT                   /translation="MSPVLLVAASSGYPAQLWPPRPWWHRNERFWITLRTADAAARAAD
FT                   PRPSHSRSAFHRAAALTRTTLTALRVFTRYRPVMVVVTETRKTPFLFFARLFGVPTLAV
FT                   EVHDWVTTATRTALLCRPTTARPGLGARRMSAADTAAPQRSLRRPRRGARRRIGRCQPA
FT                   "
FT   gene            474010..474477
FT                   /locus_tag="Tfu_0422"
FT   CDS             474010..474477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0422"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54460"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54460.1"
FT                   /translation="MRLTTFTDLSLRIVMRLAVAGEETLTTRSVAGMLAVPYTHAAKAV
FT                   ARLSEMGLVEARRGRGGGLRLTPAGRAATVGSIVRELEGSKDVVACEDDPPCPLRAACR
FT                   LRGELRRAQEAFFAALDEVTVESLVASPTGPILVQLRAPERPQNSSELEKQ"
FT   gene            474585..475769
FT                   /locus_tag="Tfu_0423"
FT   CDS             474585..475769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0423"
FT                   /product="flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54461"
FT                   /db_xref="GOA:Q47SV6"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54461.1"
FT                   /translation="MLSTQSADIVRATLPVVGAHLDEITSRFYSTMFSERPELLDGLFN
FT                   RGNQANGEQRRALAGSIAGFASALLANPDERPDALLARIAHKHAAVAVTDDQYVIVHKY
FT                   LFGAIADVLGDAATPEVIAAWDEVYWLMGGALIALEARLYAEKNADNGRTWREWTIVDR
FT                   REETPDVFSLVLRPSDGGPLPEARPGQYVSVLHRMPDGIRQIRQYSISGGDEHTRRITI
FT                   KRVRGTEHTPEGEMSALLYATAKAGDTLTVSAPFGDVVLTDSDRPLVFATAGIGCTPIV
FT                   GMLNYLAATGATRRILALHADRSRAEHALWQETSTLIARLPHAQYVVWYEEGDGGLPGQ
FT                   MDLTGLEIPADAEVYLCGPLPFMREIRTQFLAAGVPAKDIHYEVFGPDLWLPAD"
FT   gene            complement(475896..479528)
FT                   /locus_tag="Tfu_0424"
FT   CDS             complement(475896..479528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0424"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54462"
FT                   /db_xref="GOA:Q47SV5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54462.1"
FT                   /translation="MPHVLRPLRAGRPSSHAPPGDMSLNGLLSVVTGDPALKRAIETAR
FT                   NGHDPLLDLVAPPSVRPLIVAGLAADAPVGAGRPVLALTATEREAADLNSALGSLLPAD
FT                   SVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHPDPDDPLTAPLRVVVAPIRSVLQP
FT                   LVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAVRGGILDVFPPTE
FT                   EHPLRLEFWGDTVEEIRYFQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKRARALA
FT                   AEYPALADILTKLADGVAVEGMEAFAPVLADRMELLLDLLPPGTHIVGCDPERIRTRAQ
FT                   ELVATSQEFLEASWINAASGGEAPIDLGASAYQSIAELRSRARELGLPWWTVTPFDPGN
FT                   PAAAEDDHSVVVGASATDAYRGDTERAIADVKSWLHEGWRVVLLTPGQGPAERLASMLR
FT                   DAGLGTQLRDALPEPPEPAVATVTTGLLEHGFVWRSVRTVLLTETDLVGQRSSTRDMRR
FT                   MPSRRRGVDPLQLKPGDYVVHEQHGIGRYVEMVSRTIQGATREYLVIEYAPSKRGQPGD
FT                   RLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWAKAKSRARKAVREIAGDLIRLYSARHAS
FT                   PGHAFSPDTPWQRELEDAFPYVETPDQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEV
FT                   AVRAAFKAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIR
FT                   EGMRTGEVDVVIGTHRLLSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMS
FT                   ATPIPRTLEMGLTGIREMTTILTPPEERHPVLTFVGPYDEKQIAAAIRRELMREGQVFF
FT                   VHNRVASIERAAATVSRLVPEARVAWAHGQMNEHQLERVMVDFWEKKFDVLVCTTIVES
FT                   GLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRERAYAYFLYPPDKPLTETAHERLAT
FT                   VAQHTESGAGMYVAMKDLEIRGAGNILGTEQSGSIAGVGFDLYVRMVGEAVRELKGDQS
FT                   AAQEVETKVELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPP
FT                   QPVDNLLAVARFRVLARSAGLTDVVLQGTQIRFAPVELRESQQLRLRRLYPKAVVKAAT
FT                   RTLMVPVPKSGGLGGKQLRDRELLTWCTELVEAIFEPQRKPPQE"
FT   gene            479816..481297
FT                   /locus_tag="Tfu_0425"
FT   CDS             479816..481297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0425"
FT                   /product="adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54463"
FT                   /db_xref="GOA:Q47SV4"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54463.1"
FT                   /translation="MTQPTGGRAVFTPGPQGLAHLELLLSGVCPLPGFMAQAEAAELDR
FT                   PGPPPAGAAWPVPVTLTVPETLADVRELVLADPEGAPLAELTVTESFRDGTVRLAGPIR
FT                   PAAPPAYGSHRSLRATAADVRSARDERRPLLAVVTDRPLHHRALAQIRAALATLGDADL
FT                   LVLVDTPLDGEGAATVVLAARPCLPEHTRFAVLTLPTAPADGAPEWSAERRGLLAAHVA
FT                   AAYGATHLMLEGVGELPGTAAELPVKPVAATEWVYDTVHERWRPADEVPPAQARPEWDT
FT                   AAVDEALAQGTPLPAWLTPEPVAAALARTRPARTRRGLVLFFTGLSGSGKSTVARGVAE
FT                   QIRQAGRTVTLLDGDVVRRLLSAGLTFSRADRDLNIRRIGYVAAEIARHGGVAVCAPIA
FT                   PYAATRAEVRRMAEETGDFFLVYVATPLEVCEARDRKGLYAKARAGEIPAFTGISDPYE
FT                   PPEDADLVLDTSTESEEESVARVVAALRAGGWLPR"
FT   gene            481345..482085
FT                   /locus_tag="Tfu_0426"
FT   CDS             481345..482085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0426"
FT                   /product="MazG, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54464"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54464.1"
FT                   /translation="MSEHNGTPQGHRLIALVEVMDTLRRECPWDSEQTHESLAKYLIEE
FT                   AYETVETIERGDYDTLAEELGDVLLQVVFHARVAAERGPDGFTIDDVADAIIDKLVRRH
FT                   PHVFSTTKVAGADEVRANWEAIKAAEREAKGEQADVSMLAGVPFGQPAALLAYELQKRA
FT                   ARNGVPEDLIGDDGEPGGALFAAVADERRRSADPEMDLRAAARRFDARVRAVEEAARAD
FT                   GVDPRKLTPDQWRSYWKQSEGASG"
FT   gene            complement(482030..483475)
FT                   /locus_tag="Tfu_0427"
FT   CDS             complement(482030..483475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0427"
FT                   /product="cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54465"
FT                   /db_xref="GOA:Q47SV2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54465.1"
FT                   /translation="MTYTTAPRLRRRHTIELAMLAVALTVFATGLCLTGLQLHAQVPDL
FT                   LWLATAVLGGSALAVHVALRFCAPWADPLILPLAVLLNGIGFIVIWGLHAEAGDPPTAA
FT                   FRQLLWTGLGQLGCLTTVLLVRHPQRLQRYPYLMALAGLVLLASPMLPVIGLDQYGSRR
FT                   WLSFNGFTVQPSEFAKIPLVLFLAAYLGMKRDILALAAAQITVRGVKIFSVPRMRDMGP
FT                   MTAAWGIAILILVGTKDLGTSLLLFTVFLAMLYTATLRKSWVGIGVAMFLAGAYVAYLL
FT                   FWHVRQRVTIWLHAFDPGVYYAPQGSAQVVEGLFALADGGLFGLGFGQGRAATLFASDS
FT                   DLIMVSVGEKFGLAGVAAVLLVTLLLVERAFRVALAARDTFVKLMTTGFAFLWAFQVFV
FT                   VVGGVTLLIPLSGMTTPLLSVGGSSLVTTWIMLGLWLRVSSEVRRAAVSRCHDDTATME
FT                   LPRSAVSPTPPPTASNKSATDQE"
FT   sig_peptide     complement(483353..483475)
FT                   /locus_tag="Tfu_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 41"
FT   gene            483941..485224
FT                   /locus_tag="Tfu_0428"
FT   CDS             483941..485224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0428"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54466"
FT                   /db_xref="GOA:Q47SV1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54466.1"
FT                   /translation="MASIEAVHAREILDSRGNPTVEVEVALDDGTIARAAVPSGASTGQ
FT                   FEAVELRDGGDRYGGKGVEKAVAAVNEEISEQIVGYEAEEQRLVDSALITLDGTPDKSR
FT                   LGANAILGVSLAVAKAAAESADLPLFRYLGGPNAHVLPVPMMNILNGGAHADTNVDIQE
FT                   FMIAPIGAESFREALRWGAEVYHSLKAVLKAHGLATGVGDEGGFAPNLDSNRAALDLIS
FT                   EAITKAGFTLGQDIALALDVAATEFYADGAYQFEGSSRSAEEMAAYYTELVESYPLVSI
FT                   EDPLSEEDWAGWKALTESLGDRLQLVGDDLFVTNPERLQRGIDEGAANSLLVKVNQIGT
FT                   LSETLDAVSLAQRNRYTAMISHRSGETEDTTIADIAVATNSGQIKTGAPARSERVAKYN
FT                   QLLRIEEELDDAAVYAGANAFPRFARQG"
FT   gene            485229..485768
FT                   /locus_tag="Tfu_0429"
FT   CDS             485229..485768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54467"
FT                   /db_xref="GOA:Q47SV0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54467.1"
FT                   /translation="MVKVPDPSSGRRPRTTGGSPSGASKPSKAAGKKSPGGRTRPAAAA
FT                   ASRGRRTAAQASSRPALTSRAAVLALLVCVIALSLAYPLREYIAQRARIAQLKEERARI
FT                   QESVAELTARYEELQDPAYIEREARSRLHYQYPGEQTYIIIGGTPEEEAVPERSPSNPW
FT                   FVELWDSVAEADQPQG"
FT   gene            485831..486397
FT                   /locus_tag="Tfu_0430"
FT   CDS             485831..486397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54468"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54468.1"
FT                   /translation="MNSADQLPARRVSAEDVEIIRQQLGRPPRAVYEVAHRCPCGLPDV
FT                   VRTAPRLADGSPFPTLYYLTCPRAASAIGRLESSGLMREMTERLQHDAELRAAYTRAHE
FT                   SYLAERAALAEKLGLEPLPKGMQSAGGMPKRVKCLHALVAHELAVPGSNPLGREALDQL
FT                   PPWWDRGPCVCSDRSEKTERNGKDQ"
FT   gene            486394..487389
FT                   /locus_tag="Tfu_0431"
FT   CDS             486394..487389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0431"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54469"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54469.1"
FT                   /translation="MRTVAAIDCGTNSLRLLVAGVLDADGEDIQLLDVDRRMEVVRLGQ
FT                   GVDRTGMFAPEALQRTFDVLRDYVDVMRGYGVQLSPDSVRMVATSATRDAANRDEFVSG
FT                   VRKILGVEPEVISGEEEAELSFVGATAELEAMGEGSGLHRPYLVVDVGGGSTEFVLGHT
FT                   GDAGASAVRAQCSVNIGCVRMTERHFHADPPTAEQVAAATADIEAALDQAAAVVPLGEA
FT                   ATVVCVAGTATTLAGIAQGLPAYDPERIHHARVPVERLREITAELLAMPHEQRAAIGVM
FT                   HPGRVDVIGAGSLIVERVLARTGAAEFVASEHDILDGIAWSLAVEAPASA"
FT   gene            487756..489132
FT                   /locus_tag="Tfu_0432"
FT   CDS             487756..489132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0432"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54470"
FT                   /db_xref="GOA:Q47SU7"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54470.1"
FT                   /translation="MTESRNYRLVPGGGDASEIPHVLIVGGGYLGMYTAKRLEKKLGPG
FT                   EARITVVDPNSYMTYQPFLPETAAGSISPRNVVVPLRKVLRRTRVLNGRVVRIEHAQRR
FT                   VECVTNEGERRELTYDYLVMAAGAVSRTLPIPGLAEHGIGIKTVQEAAYLRNHVLEQLN
FT                   IADSTDDPRVRRKALNFVFVGGGFAGAEAIAELEDLARDATRIYPSISIDDLHFYLIEA
FT                   ADRILPEVGPEVGAKALQQLRNRGIDVRLSTFLESAVDQRIKLSDGTEFEAGTLVWTAG
FT                   VKPSPVVQASDLPLGPKGHVDTTEYLTVRGVENAFAGGDNAQVPDGNGGYYPPNAQNAV
FT                   RQAPVLADNIIATLRGKELKPYRHKNLGAVAGLGMYKGAAQVFGAVKLTGLPAWLAHRS
FT                   YHLLAVPTFNRKMRVLADWTLGFFLRRDFASIPEMSQPRQAFTEAARPQVDGSNLRRVS
FT                   "
FT   gene            489279..489352
FT                   /locus_tag="Tfu_R0011"
FT   tRNA            489279..489352
FT                   /locus_tag="Tfu_R0011"
FT                   /product="tRNA-Leu"
FT   gene            489647..491275
FT                   /locus_tag="Tfu_0433"
FT   CDS             489647..491275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0433"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54471"
FT                   /db_xref="GOA:Q47SU6"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54471.1"
FT                   /translation="MDAVTNVPAPVNEPVLSYAPGSPERAELTRYLTALADQPRELPMT
FT                   IGGTRRLGGGARIDVVQPHRHASVLGILGNATHEDARDAIAAALHAAPAWRDTPFDERA
FT                   AILLRAADLLSGPWRQRLNAATMLGQSKTVIQAEIDAVCELADFWRFNVHFARQILAEQ
FT                   PLVHAPGTWNRTDHRPLEGFVYAITPFNFTAIAGNLPTAPALMGNVVVWKPSPTQTLAA
FT                   CLTMELLEAAGLPPGVINLVTGDGVALSEVALTHPDLAGIHFTGSTRTFQYLWRTVGEN
FT                   IARYRSYPRIVGETGGKDFVVAHASADVDVLRTALLRGAFEYQGQKCSAASRAFIARSV
FT                   WERMRDDFLAQVDALPMGDVTDFRNFLGAVIDRRAYDRLARLLDRVRTDPTIDVLVGGT
FT                   ADDSVGYFVRPTVLLGSDPSHEVFTTEYFGPVLAVYVYDDHAYEEVLRLVDRGAPYGLT
FT                   GAIIATDRAAILAATRQLRFAAGNFYINDKPTGSIVGQQPFGGSRASGTNDKAGSMANL
FT                   MRWTSPRVIKETFVPPTDHRYPHQD"
FT   gene            491294..492229
FT                   /locus_tag="Tfu_0434"
FT   CDS             491294..492229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0434"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54472"
FT                   /db_xref="GOA:Q47SU5"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54472.1"
FT                   /translation="MLRTLLLLAARSPRCRDFVTRSPLTRGVVRRFVAGDTLDATLPVL
FT                   RQLTADRHVTVDYLGEDITDAEQASRTVDAYTHLLTALGEHGLAPRAEVSVKLSALGLA
FT                   LPRDGAQLALDHARQICAAAEAVGTTVTVDMEDHTTTDATLDIVHQLRVDFPRTGAVLQ
FT                   AYLRRTEADCRDLAVPGSRVRLCKGAYDEPATVAYRDRAEVDRSYVRCLRILMDGPGYP
FT                   MVATHDPRLLRIAAFLARSAGRSADSYEYQMLYGVRTDLQAALADRGERVRVYVPYGEQ
FT                   WYGYFMRRLAERPANTAFFARALFAGGAVR"
FT   gene            492333..493304
FT                   /locus_tag="Tfu_0435"
FT   CDS             492333..493304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54473"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54473.1"
FT                   /translation="MRKRSSSNPVIKRALASAPGGAGYYAQPGYGQPYASQGYGQPYAQ
FT                   PGYGQPGYGQPGYGQPGYGQPYPPQGYGPAPYPAQPGYGPAVPGTRPVTIDDVVMRTGF
FT                   TLGTVVLGAVLTYFMAMLVNPALSVVMLVIGAIGSLILGLVISFTRSTNPALILIYAGL
FT                   EGLFVGGFSFVLEASLAGSGVAPGGLVVPAVFGTLFVAGIMLALYKFQVIRVTNTFVKV
FT                   VTAALLGFLALVLVNLIVGIFVPGGLGLREAGPLGLLVSAVAIVLAALVLAIDFRDVEE
FT                   AIAYGLPEKVSWQLAFGLTVSLVWLYIEIVRLLWIIQSMFSE"
FT   gene            complement(493716..494939)
FT                   /locus_tag="Tfu_0436"
FT   CDS             complement(493716..494939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0436"
FT                   /product="thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54474"
FT                   /db_xref="GOA:Q47SU3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54474.1"
FT                   /translation="MPEAVIVATARSPIGRAFKGSLKDIRPDDLTAQIISAALAKVPQL
FT                   DPATIDDLLLGCGLPGGEQGFNMARVVAVQLGLDSVPGTTITRYCSSSLQTTRMAFHAI
FT                   KAGEGDVFISAGVEMVSRFTKGNSDTLPDTKNPLFAEAEARTARRAEGGAEPWRDPREE
FT                   GKLPDIYIAMGQTAENVAQLRGVSRQRQDEFAVRSQNLAEKALDNGFWEREITPVTLPD
FT                   GTVVSTDDGPRRGTTYEKVAALDPVFRPDGTVTAGNCCPLNDGAAALIIMSDRKAAELG
FT                   ITPLARIVSTGVSALSPEIMGLGPVEASRQALARANMSIRDIDLVEINEAFAAQVLPSA
FT                   DDLGIDIDSQLNVNGGAIAIGHPFGMTGARITTTLINALQFHDKTFGLETMCVGGGQGM
FT                   AAIFERLS"
FT   gene            complement(495017..496060)
FT                   /locus_tag="Tfu_0437"
FT   CDS             complement(495017..496060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0437"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54475"
FT                   /db_xref="GOA:Q47SU2"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54475.1"
FT                   /translation="MALRAAQARRIMAATMFGGGGLTLLAASTVALLFLQAKIAARTIG
FT                   VTPWQRPRVDGVYGVGGGEPLTLLMMGDSTAAGFAVSDPRQTPPVQLASGLSAVADRPV
FT                   RLRDVSKVGATSQGLLAQLDRVRGERVDLAVIFIGANDVIDRIRPADAVSHLRVVVREL
FT                   VASGAAVVVATCPDLGTVQPIPQPLRAIARRASQQMAAAQTVAVVEEGGSTVALGDLLS
FT                   DEFSLYPEEMFGPDRFHPSARGYGRAVAVVLPALCSALGLLPEPVESEPDAEEVLPVDR
FT                   AAAAAVAAAGSEVRQAGQEEHRRGSLGLWARLLRRDTAPAADTHKLETDSNSVKATPAA
FT                   SVGSRIG"
FT   sig_peptide     complement(495935..496060)
FT                   /locus_tag="Tfu_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.883 at
FT                   residue 42"
FT   gene            496293..497660
FT                   /locus_tag="Tfu_0438"
FT   CDS             496293..497660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0438"
FT                   /product="cystathionine beta-synthase"
FT                   /EC_number="4.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54476"
FT                   /db_xref="GOA:Q47SU1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54476.1"
FT                   /translation="MRVSNSLIELVGNTPLVRLKKVTAGLAPTVLAKVEYFNPGGSVKD
FT                   RIALRMVEDAERRGLLKPGGTIVEPTSGNTGVGLAIVAAEKGYRCVFVCPDKVGADKLA
FT                   VLRAYGAEVVVCPTTVAPDHPESYYSVSDRLAATIPGAWKPDQYSNPNNPESHYYSTGP
FT                   EIWEQTEGRITHFVAGIGTGGTITGTGRYLKEVSNGRVKVIGADPEGSVYSGGTGRPYL
FT                   VEGVGEDIWPATYDTKICDEIIAVSDKDSFLMTRRLAKEEALLVGGSCGLAVVAALKVA
FT                   AQAGPDDVIVVLLPDGGRGYLGKIFNDEWMADYGFLEPETEEATAGQVLAAKDDSLPEF
FT                   VHTHPHETVGTAIAIMREYGVSQLPVMKEEPPVMAAEVVGAIAERDLLDALFNGRAQLG
FT                   DPVEQHMRPPLPVVGSGEPVSRCVELLQSSGAVVVLEDGKPSGILTRQDLLAHLAS"
FT   gene            497915..498589
FT                   /locus_tag="Tfu_0439"
FT   CDS             497915..498589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0439"
FT                   /product="putative sugar acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54477"
FT                   /db_xref="GOA:Q47SU0"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54477.1"
FT                   /translation="MSRLLSWMVRTAWSWARRKADIRYGSRAAARFAAYGEGTSIAFPP
FT                   ATIFGEPWIALGSHTLIGADITLSAGYMPGLDLGPKPLLTIGDGCTIGRGSHVVAHRSI
FT                   VFEDHVFTGPYVYVTDQNHGYADPNTPIGYQWPTEAPVRIGAGSWIGAHAVILPGVNLG
FT                   RNCVVAAGAVVRPGTYPDHCVIAGVPGRIVRRYDPETGWNPPLRTDVIVRRDDADTEPA
FT                   AG"
FT   gene            498682..499827
FT                   /locus_tag="Tfu_0440"
FT   CDS             498682..499827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0440"
FT                   /product="cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54478"
FT                   /db_xref="GOA:Q47ST9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54478.1"
FT                   /translation="MSYEGFETLAIHAGQEADAETGAVVVPIYQTSTYRQDGVGGLRGG
FT                   YEYSRTANPTRTALEECLAALEGGVRGLAFASGMAAEDTLLRTIARPGDHLIIPNDAYG
FT                   GTFRLVSKVFERWGVSWDAVDLSNPEAVRTAIRPETVAIWVETPTNPLLNIADIAALAD
FT                   IAHAADALLVVDNTFASPYLQRPLSLGADVVVHSTTKYLGGHSDVVGGALVVADAELGE
FT                   RLAFHQNSMGAVAGPFDAWLTLRGIKTLGVRMDRHCANAERVVEALVGHPEVAEVLYPG
FT                   LSDHPGHKVAVDQMRAFGGMVSFRMRGGEEAALRVCAKTKVFTLAESLGGVESLIEHPG
FT                   KMTHASTAGSLLEVPSDLVRLSVGIETVDDLVNDLLQALEP"
FT   gene            500121..500861
FT                   /locus_tag="Tfu_0441"
FT   CDS             500121..500861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54479"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54479.1"
FT                   /translation="MRVSARHAALLTLPLLLFTAACEGEEDTAAPQSDAEPTPSASPSP
FT                   ELPTLHELVRAHIADTWEYDVDYAGRCETLSEEEEFSLIRGEGICLSLYADVGDSTVFV
FT                   LGPPATEPFEALRLTTPDGEHWELVENFVIEDPYGPGPDWLDEAIRIKDDPSAWEITAP
FT                   TLAEVGETWLADRYLPLDCEATGEGGPDHEAWCVHVEGSDDEENPTTDRGTVLITRNGE
FT                   PYHRLFAVFTGEEWRLYDEFPATE"
FT   sig_peptide     500121..500228
FT                   /locus_tag="Tfu_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.602 at
FT                   residue 36"
FT   gene            complement(500871..502811)
FT                   /locus_tag="Tfu_0442"
FT   CDS             complement(500871..502811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0442"
FT                   /product="von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54480"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54480.1"
FT                   /translation="MSGFRYRSYVDGPDPLRPPFDVRSAVDALGRAVLAGASPTRALRD
FT                   LLRRGTRGVRGLDELLRHVRERKEQLRSQGRLDGTLAQARRLLDQAVGQERAVLFPDPS
FT                   DEARLRERELDDLPADPAAAIRRLAGYQWRSPDARQTFTQLQELLRREILDAQFRGMRQ
FT                   AMARGTPEELQRVRAMLDALHGMLDADDRGEHTQADFERFMAEFGDFFPDRPRTLDELV
FT                   DVLACRSAAMQRLFDSLTPEQRAELLALSAQVMRDAGLADAVQRLGERLRARRPDLVWS
FT                   GGVAVDGDAELGLGDATTAVAELADLAELEEALGQGYAGARLDDIDTAALQRVLGRSAA
FT                   EDVARLRALERELRDRGYLSGSRDRVQLTPKAVRALGEVALRDVLSGAGRRPGTHDTRE
FT                   GGPAGELTGASRPWRFGDEQPLDAVRTAINAVRRGASSEGRLRLRPEDMEVAETERRDA
FT                   AAVCLLVDLSYSMVQRGLWGVAKQTALALHTLVSTRFPQDAVYVIGFNDHARVLAPREL
FT                   AELSPEPVQGTNLHHALLLAGRHVDRHPEFEPVVLVVTDGEPTAHLEEDGLPYFSYPPS
FT                   PRTTELTLAEVDRMTRRGARMTVFSLADDPRLEEFVTALVARNGGRALRPVADQLGSFV
FT                   VRDLLAQRSRW"
FT   gene            complement(502827..504254)
FT                   /locus_tag="Tfu_0443"
FT   CDS             complement(502827..504254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0443"
FT                   /product="magnesium chelatase subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54481"
FT                   /db_xref="GOA:Q47ST6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54481.1"
FT                   /translation="MNRLEGVPDHVDLPHTLGALRASGHRYRSVKDEIRENLLHRIRSG
FT                   EERFPGIVGFSETVLPQLERALLARHDVVLLGERGQGKTRLIRTLTGLLDEWSPAVAGC
FT                   ALNDHPYAPVSPQARRMVAEYGDDLPIVWRHRDERYSEKLATPDTSVGDLIGDIDPVKL
FT                   AEGRSLGDPETVHYGLVPRSNRGVFCLNELPDLAARVQVALFNVLEERDVQIRGYQLRL
FT                   PLDMLVVASANPEDYTNRGRIITPLKDRFGAEIRTHYPVELDDEIALIEQESRLSPEVR
FT                   VPPHLVEAVARFTRLVRESPSVDERSGVSARFAIAAVETVAASAERRAAMTGEQAVARV
FT                   CDLPCITAVLRGKVEFDLSEEGRENAVLEHLLNRAVYDTFRRVFSGVDLGPLTERFSSG
FT                   AAVESGDLVSAEELLARVGPFTGLAELVKRVAPDSDDDPVSAPGYAAAAVELALEGLYL
FT                   SRRLSKDTLPHGARYRI"
FT   gene            504366..505604
FT                   /locus_tag="Tfu_0444"
FT   CDS             504366..505604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54482"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54482.1"
FT                   /translation="MQGEPATRENGDARERPLTVDGEEATVTRFSDALATGVDLVSAAE
FT                   RATRQALERLDGPADLVCVFVSGIDPEEVALAGERAMALAEGATTIGCSAGGVIGGGRG
FT                   TEGQGAVSVWAAMLPGVTMTPFELAAIAEGDQLAVIGVLEPTPADQAALLLANPYVFPT
FT                   HTFVEHSNTILDGLPIVGGLADGTYGGDSVRLFLQGETVQAGAVGLLFGGNGVLGTVVS
FT                   QGCRPIGPSMVVTKAEDNVLIELAGTPAYAKLESIVSALPPEEQQLVADGLHIGIAIDE
FT                   YADRHESGDFLIRGVLDADPEQSTITIGDVVDVGQTVRFQVRDQATADSDLLERLRLFA
FT                   HDTGGTAEGALLFSCNGRGSGMFPSADHDVRRVQQILGIDAVGGFFAAGEIGPVAGRNH
FT                   LHGFTACMLAFRG"
FT   gene            complement(505647..506105)
FT                   /locus_tag="Tfu_0445"
FT   CDS             complement(505647..506105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0445"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54483"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54483.1"
FT                   /translation="MPLAGFGRRLWARIIDYFLLSVLVFLLGFGILFLVFLAYPGLEET
FT                   SDTFDATFGFLFLFGWGLASFLYDWFFLAATGRTPGKIMTRLRVISATGTPLSQGQSAL
FT                   RSAVFGFPHSLLCLGHLFLCVSCLVIAGDSQAQALHDKMARTVVIHTP"
FT   gene            complement(506300..506884)
FT                   /locus_tag="Tfu_0446"
FT   CDS             complement(506300..506884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54484"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54484.1"
FT                   /translation="MTHPHPSPAQPPSPYLGPPPPPGPFPHGAYPPPPGVFPQPPEVAS
FT                   WGRRVAAFLIDSVLAQVLTFGVILIGALVAALVDNIAYPEYIHSDTMSPAAITIVLTAL
FT                   FAAFATAIAYWSLPHAKWGKTIGKWMLGIRVIAANTGTPPSVGRALGRYFFFALLSFPM
FT                   ITFFVDCLWPLWDSRGQSLHDKVAGTYVIRG"
FT   gene            complement(507062..507565)
FT                   /locus_tag="Tfu_0447"
FT   CDS             complement(507062..507565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0447"
FT                   /product="prokaryotic transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54485"
FT                   /db_xref="GOA:Q47ST2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54485.1"
FT                   /translation="MTETRDDNVTWLTQEAYDRLTAELEYLSGPGRIEIADRIEAAREE
FT                   GDLRENGGYHAAKEEQGKIEARIAHLQSILSNARVGQAPQREGVVGPGMTVTIKFEGDE
FT                   EEMTFLLASREESGAPIDVYSPKSPLGEAINGKKVGEKVTYKLPSGKEATVEILDAVPY
FT                   NGGS"
FT   gene            complement(507772..508206)
FT                   /locus_tag="Tfu_0448"
FT   CDS             complement(507772..508206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54486"
FT                   /db_xref="InterPro:IPR025443"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54486.1"
FT                   /translation="MPPQPDNPLRAAAQPVSGTRRRLGNQPFFFVLGVIAAIIFTIGWG
FT                   AALFSYSGNTLGQVHHQTFAWRIVSDTEARISFQTNSSSGARCLIRAYDEYHVEVGTTE
FT                   VTVEGGLREVEATIDTVRRATTVQVVSCREQAFSNEPVHK"
FT   gene            508364..509236
FT                   /locus_tag="Tfu_0449"
FT   CDS             508364..509236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54487"
FT                   /db_xref="GOA:Q47ST0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54487.1"
FT                   /translation="MSERLRLMAVHAHPDDESSKGAATMARYVNEGAEVLVVTLTGGER
FT                   GSILNPAMDRPEIRENIAEVRRKEMEEARRILGVRQVFVGFIDSGLPEGDPPPPLPEGC
FT                   FALQPLEVAAEPVVRLVREFRPHVMITYDEQGGYPHPDHIMCHKVSVEAFEAAADPERY
FT                   PGTGEPWQTSKLYYHVSFPLERFEAIAKVLSDRGMENPYADWMKRLEKRDTRRWEITTR
FT                   VECGEYFEVRDRALLAHATQIDPNSFWFAVPNDIQREAWPTEDYHLARSFVDTELPEDD
FT                   LFAGIRDKV"
FT   gene            509248..509466
FT                   /locus_tag="Tfu_0450"
FT   CDS             509248..509466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54488"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54488.1"
FT                   /translation="MNLSALQLADSVNDLVTPGLLGFTVIALIGGVLFLLMRSMRRHLD
FT                   IARSRDFTEDSAKEKEAEQTKPEDRED"
FT   gene            509558..511555
FT                   /locus_tag="Tfu_0451"
FT   CDS             509558..511555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54489"
FT                   /db_xref="GOA:Q47SS8"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54489.1"
FT                   /translation="MPNRLAHATSPYLLQHADNPVDWYPWGEEAFAEARRRDVPILLSI
FT                   GYAACHWCHVMARESFADEQTAQIMNANFVNVKVDREERPDVDAVYMEATQAMTGHGGW
FT                   PMTVFATPDGEPFYCGTYFPREHFQRLLLGISHAWRTDRTGVVGQGKRVAEALSAPRTL
FT                   PSGPPPSAQVLEQAVARLAAEYDTVNGGYGTAPKFPPSPVMEFLLRHHARVSDGAETEA
FT                   LRMVRHTAEAMARGGIYDQLAGGFARYAVDATWTVPHFEKMLYDNALLLRCYTHLWRQT
FT                   GDELARRVAVETADWMVAELRTAEGGFASALDADSEGEEGRYYVWTPAQLRDVLGEEDG
FT                   AWAAELFGVTEQGTFERGTSVLQLRADPDDRERYAYVRDRLRKARANRVPPARDDKVVT
FT                   GWNGLAIAGLAEAGALLDRPDLVERAREAARLVVERHYADGRLVRVSRDGVPGTSAGVL
FT                   EDYANLAEGLLALHAVTGEIRWVGVCGELLETVLTRFTDGSGGFYDTADDAEALFNRPR
FT                   EFTDDATPSGWSAAAGALLSYAALTGSFRHREAAEAALGVVSTLAEKTPRFAGWGMAVA
FT                   EALLAGPVEIAVVGPKGDPVAEELHRTALLATTPGTVVSRGDGVNDGGIGLLEGRTLVD
FT                   GRPAAYVCRNFTCRLPATTTEELTAELARA"
FT   gene            511624..512421
FT                   /locus_tag="Tfu_0452"
FT   CDS             511624..512421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54490"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54490.1"
FT                   /translation="MTGAWRSLVNPPLCSLSDEMQETTEWFTGDTVIPFARLVRAGSGG
FT                   QGKEERVRATRAAAFPLAASILAAPACGFGTPSQVMPGLAHPMASSESGFQVSDEATLH
FT                   NYTGINVVLPDGWHTDIADNCLSPPEVGPAPGGNCPSEALRIRINASEEGLIDPEGAEL
FT                   TDPDSWRRPWASCPKRPELNARIRAEHSEIVEHGDFLLVSGEETKYSEWLITCTGGGTF
FT                   RTRAWYVPEADLEFDVPVMVEERAEEYDLIVRSADLSRFKAIS"
FT   gene            512808..513197
FT                   /locus_tag="Tfu_0453"
FT   CDS             512808..513197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54491"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54491.1"
FT                   /translation="MQSFFWVIPALVLAVAVFYSVVAVAIRDEETERTLFDPVFPVSFR
FT                   GLVRGLVNFRVANPPATVHGALRRLREQQGRDIAEPGLDSDVSIAGADHAVTAVSRSAP
FT                   QLRRDDAPAAREDAGPAPETRCSAR"
FT   gene            complement(513283..514677)
FT                   /locus_tag="Tfu_0454"
FT   CDS             complement(513283..514677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0454"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54492"
FT                   /db_xref="GOA:Q47SS5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54492.1"
FT                   /translation="MAQPERFGRYRVLRRLGSGSFATVWLGHDDLLDTPVAIKVLAENW
FT                   AHNLDIHQRFVEEARILRQADSEWLVRVHDIGTLPDDRPYFVMTYADRGSVADRIAQGP
FT                   LPLDEALRLLTEIGQGVTVLHRHGTIHRDIKPSNVLLQSSPVGERVLVADLGFAKSIDG
FT                   ASGFTASAGTPGYMSPEQSVVGGDIDVRADVYSLGAVAYELVTGKRPPSPPVRVPPSRL
FT                   RPGVPPALDELIMSALSPNRSDRPPDAATFTSRIREIRMSPDLELATPWWQRYRATWTR
FT                   LVALVATAVAVLGVAPAASASPHLPMMEIYDASGELHVRVPTPWLRQMQLNGWSPRELG
FT                   LPGGHEPGLLVATDLDAWSDARQSVSGLFAGLFVSDGQSPDLDRLISSGLCSGQPQRQR
FT                   FTNAHWDGELWQWVDCSPDSSEGDVFTAAVLQHRGQERTLYLEIRQTEHQPQTVAEILD
FT                   GLRLIS"
FT   gene            515588..516298
FT                   /locus_tag="Tfu_0455"
FT   CDS             515588..516298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0455"
FT                   /product="sigma subunit sigma24-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54493"
FT                   /db_xref="GOA:Q47SS4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54493.1"
FT                   /translation="MQNLVTTGQQFGKMCQPFCGGMRVIAGRDYRQWGVSVVTKADQSS
FT                   ETVSPNHAPGEEESLEQLALRAKEGDEAALEELLRRIQPDVLRRCARFLPYRQDAEEAC
FT                   QDALMRVAANIQNFRGDSMFTTWLYTVVSNSARQTYRALKRRAAEMPTEADRLPHRTDP
FT                   RTTSVIAGSRIDLLEALDQLEKDRPNLVAPLVLRDLCQMEYGEIAAQLDLALGTVKSRI
FT                   HEGRKRVRQALAVN"
FT   gene            516504..517268
FT                   /locus_tag="Tfu_0456"
FT   CDS             516504..517268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0456"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54494"
FT                   /db_xref="GOA:Q47SS3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SS3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54494.1"
FT                   /translation="MGLLRIPLYRLYERRLERALSNAPKPRHVGVILDGNRRWARLSGL
FT                   SSPKEGHRAGAEKIFELLDWCDEVGVQVVTLWLLSTDNLARPPEELEPLFEIIENTVRR
FT                   LCNEGRRVNPMGALDLLPASTAQVMKEAGTTTERNPGLLVNVAVGYGGRREIADAVRSL
FT                   LLEEAAKGTTLEELAERLDLDDIAKHLYTRGQPDPDLLIRTSGEQRLSGFLLWQSAHSE
FT                   FYFCEVFWPAFRKIDFLRALRSYSVRQRRFGC"
FT   gene            517541..518884
FT                   /locus_tag="Tfu_0457"
FT   CDS             517541..518884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0457"
FT                   /product="Nucleotide binding protein, PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54495"
FT                   /db_xref="GOA:Q47SS2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54495.1"
FT                   /translation="MASSSTVHRDPVRPSPAAGDSSRRTYVLDTSVLLADPLSITRFAE
FT                   HEVVLPIVVISELESKRHHPELGYFAREALRKLDDLRVAYGALDTPVTVNDQGGTLRVE
FT                   LNHSNPEVLPAGFRQDDNDTRILTVARNLAAENNNVVLVSKDLPLRIKASSVGLAADEY
FT                   RAELAIEHGWTGMAELEVPAHKIEELFAHGTTDIEEARDLPCHTGLVLVSERGKALGRV
FT                   LPDKSVKVVRGDRDVFGLHGRSAEQRIALDLLTDPEVGIVSLGGRAGTGKSALALCAGL
FT                   EAVLERQQHRKVVVFRPLYAVGGQDLGYLPGTEYEKMSPWSQAVHDTLSVLTTQDVIDE
FT                   VVDRGMLEVLPLTHIRGRSLHDSFVIVDEAQSLERGVLLTVLSRLGENSRVVLTHDVAQ
FT                   RDNLRVGRYDGVVAVIEKLKGHPLFAHITLTRSERSPIAALVTEMLEG"
FT   gene            519232..519882
FT                   /locus_tag="Tfu_0458"
FT   CDS             519232..519882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0458"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54496"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54496.1"
FT                   /translation="MRPLKGQSLLKNRISLRLATAAGTAALTVAGATFGFSAFAADTGA
FT                   APDQAASAAILPDEADTESFFPDDSQGVPAGQLEQASTEREQALAQSLATASGTLEEEK
FT                   EEEEEPEPVSIPSGDPRAIAQAMLADYGWGSDQFSCLDSLWQRESNWNPQARNPYSGAY
FT                   GIPQALPGEKMASAGSDWQTNPATQIKWGLGYIKDRYGSPCAAWEHSQSVGWY"
FT   sig_peptide     519232..519354
FT                   /locus_tag="Tfu_0458"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.544 at
FT                   residue 41"
FT   gene            complement(519985..521376)
FT                   /locus_tag="Tfu_0459"
FT   CDS             complement(519985..521376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0459"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54497"
FT                   /db_xref="GOA:Q47SS0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54497.1"
FT                   /translation="MTEYRIERDSMGEVKVPVEAKWRAQTQRAVENFPISGQGLEAAHI
FT                   AALGHIKAAAAKVNAELGVIKEDMAEAIREAALEVAAGKWNDQFPVDVFQTGSGTSSNM
FT                   NANEVIATLATERLGQPVHPNDHVNASQSSNDVFPSSIHIAATSALINELIPALKHLEE
FT                   TLSAKASEFATVVKSGRTHLMDATPVTLGQEFDGYAAQVRYGIERIEASLPRVAELPLG
FT                   GTAVGTGINTPEGFSAKVIAEIARATGLPLTKARNHFEAQGARDALVELSGQLRTIAVS
FT                   FCKIANDIRWMGSGPRTGLSEIFLPDLQPGSSIMPGKVNPVLCESMLQVASQVVGNDAA
FT                   VAFGGSTGNFELNVQLPLIARNVLESIRLLANISRVFADRCVAGITANEERCREYAESS
FT                   PSIVTPLNRYIGYEEAAKVAKQALAERKTIRQVVIERGYIAQGKLTEAQLDEALDVLAM
FT                   TNSQK"
FT   gene            complement(521818..522414)
FT                   /locus_tag="Tfu_0460"
FT   CDS             complement(521818..522414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54498"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54498.1"
FT                   /translation="MTGVMEGTSPERLRASDADRERVLAVLREAVADGRLDFEEFQERS
FT                   DRAAAARRLGDLVGLTTDLVPPEAQPLRLDSGPVAALFGAKRRGGRWVVPSQQWVFSLF
FT                   GSAELDLRDALLARDRVAVAASAFFGRVVIRVPEGMEVRIRRRSLFGRRAAVHPSPLRH
FT                   APVLEVDGVSLFGSVRVSTSRKRRLGRGRPRRELR"
FT   gene            522488..523450
FT                   /locus_tag="Tfu_0461"
FT   CDS             522488..523450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0461"
FT                   /product="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54499"
FT                   /db_xref="GOA:Q47SR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54499.1"
FT                   /translation="MTSSSQPARPEPSPDPSADSPPAISLRGVVKRFGDITAVNGLDLD
FT                   VPQGVVLGLLGPNGAGKSTTMRILTAQSTVDEGHVSVLGHPIPQKSKWARSLMGVVPQH
FT                   DNLDEELTVEENLRSFTYLYRVPRRERDAAVERALRIAHLEHRRHEFTEKLSGGMRRRL
FT                   LIARGLVHRPRVLLLDEPTVGLDPQVRQELWGLISALRDEGVTVLMSTHYIEEAERLSD
FT                   EVALMAKGRIVERGEPADLIAKYAGKTVEEYQIGAEGVEELEKVIHHAGFTTRRTGSTL
FT                   SVLRAEELPDSLRDRLGTGMRRASNLEDVFVTLTGETVE"
FT   gene            523447..524253
FT                   /locus_tag="Tfu_0462"
FT   CDS             523447..524253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0462"
FT                   /product="nodulation protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54500"
FT                   /db_xref="GOA:Q47SR7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54500.1"
FT                   /translation="MTATENTTVDRPRPGGFEFAPVLGILAREWALYRRTWAPITFSSI
FT                   VEPVLYLLAFGMGMGALVGSIGGYDYIEFLGTGIVAISALFTSMFPGLINTFVRRRFQH
FT                   TYEGVLAAPVDVRELVTGEALWLGLKAGVYGCAPLLVAFGFGLDPVWPMLFVPVIAAAT
FT                   GFGFALFGILLSAIIPSIRMADYVISGVITPIFLVAGTFFPIDQLPEWAQTAAMANPLY
FT                   HCVELIRGCAFGIEALTALGHVAVLVGFAVVVWVLAVHQMQRRLID"
FT   gene            complement(524336..526009)
FT                   /locus_tag="Tfu_0463"
FT   CDS             complement(524336..526009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54501"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54501.1"
FT                   /translation="MPPGHPAGPPPSHGQPQGPPPGQPQGAPPGQPQGAPPGQPQGVPS
FT                   GQPQGAPSGAALAAPHGPGGPGFPPSGQPMHSGPGGPPPRKKPVWLIPLSIVLAVALIG
FT                   GGVWASVALVNNLFGGAQPESVLPRSSAVFAKLDLKPTGQQWASYAQFYERLPDTLKDE
FT                   FESAEDDFGEELFEELFPNVELDYASEVEPWLGQRFGVAVWAGNEEPLYAIALAVEDEE
FT                   LAEETLTRIQSEDDTLFFEVVDGFAILTDSQDALNDRRFLVENEGTLEDNEDFADDISD
FT                   IGRGIATAWIDYGAIVHNEVLAADADLEDLAELGQVTGRLVAVVRMESKYLEFQANLVN
FT                   AALDGNTIFAESVPTGGITALHDLPDNSVIALGGDGLDAVAQAFWEANQGSIESSEDYE
FT                   EFDSAMRELGVRLPADFHKLLGTKTAFGMTDLEGLDYFGYSDIPFELRLTGADSALWDE
FT                   LVSPMSTGFGPSPSVTTDGDTTVISMGSAGTGRLGDDPVFQETMSGLEKAHLALYMDLR
FT                   AAAEMWEDARPNQWGGLGGALQFQENGSATLNLRWVPSPE"
FT   gene            complement(526269..527294)
FT                   /locus_tag="Tfu_0464"
FT   CDS             complement(526269..527294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0464"
FT                   /product="GlpX"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54502"
FT                   /db_xref="GOA:Q47SR5"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54502.1"
FT                   /translation="MTTANAPVPIPHDAPDRNLALELVRVTEAAALAAARWVGRGDKNG
FT                   ADDAAVRGMRHLISTVSMKGTVVIGEGEKDNAPMLYNGEQVGDGNGAECDVAVDPIDGT
FT                   RLTAMGMPNAISVIAVSPRGSMFDPSAVFYMEKLVTGPDAANVVDINAPVADNIRAVAK
FT                   AKGGDPRDITVVILDRPRHERLVHEVRETGARIKFISDGDVAGAIMAARAGTGVDLLLG
FT                   IGGTPEGIIAACAIKCLGGVIQGKLWPRDDEERRKAEAAGHDLSRVLTTDDLVSSEDVF
FT                   FAATGITGGELLSGVKYVDGGAFTDSLVMRGRSGTIRRISSEHRLRKLSSYRGVDVSGA
FT                   R"
FT   gene            527456..528058
FT                   /locus_tag="Tfu_0465"
FT   CDS             527456..528058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54503"
FT                   /db_xref="GOA:Q47SR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54503.1"
FT                   /translation="MEKVEKPVRASARGAATRSALLEAASYVFRTSGFDKAGVSEVVAQ
FT                   AGASVGSLYHHFTGKADLYLALYQEFQQRQQERTHQAVVDARAEGENDPRKLMTIAARA
FT                   YLEGCIEERELTRIFYSGDSPPGFEALMRQQLREWTGRNAALFRKADEPVDEALLMIVT
FT                   GSISLAATEVIERDPDEARKLADAVVERLSSLTPRKE"
FT   gene            528121..528693
FT                   /locus_tag="Tfu_0466"
FT   CDS             528121..528693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0466"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54504"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54504.1"
FT                   /translation="MSSGSRRSDNTFLGYAIVLGALIALVVLITVVVDSGRSEQIPTVD
FT                   YTPDALTLSEIAPYQAYAPDQDQLPEGWTPTSSRLNDGGALTEEEPTEPVRWSVGFATP
FT                   EDRHAAFHISDADPDAFIAEVTMRGEPDGESTINGQVWERRYNEVEDERSLVLRTDDAT
FT                   LIVSGGASYEELETLAGALEPQTPAQE"
FT   sig_peptide     528121..528237
FT                   /locus_tag="Tfu_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.827) with cleavage site probability 0.630 at
FT                   residue 39"
FT   gene            complement(529019..529264)
FT                   /locus_tag="Tfu_0467"
FT   CDS             complement(529019..529264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0467"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54505"
FT                   /db_xref="GOA:Q47SR2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54505.1"
FT                   /translation="MTAEENPPAEPELSYEEAREELVAVVRRLESGGLTLKESLALWER
FT                   GEELAKTCEAWLEGARAKLAAALAEDTPEPEEGAPF"
FT   gene            complement(529261..530481)
FT                   /locus_tag="Tfu_0468"
FT   CDS             complement(529261..530481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0468"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54506"
FT                   /db_xref="GOA:Q47SR1"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SR1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54506.1"
FT                   /translation="MGMESSPESPQPVRVVLQAVGGWIGRLGRIWIEGQVAELHRRGGM
FT                   AYITLRDPVANVSARVTCSIRVLRAADPPPEQGARVVVYAKPDFYVPRGTFSFQALEIR
FT                   HVGLGELLARLERLRQALAAEGLFAESRKRKLPFLPGVVGLICGRDSAAERDVLENARR
FT                   RWPAVRFEVREVAVQGDRAVPEVMAALEELDAHPEVDVIIIARGGGSLEDLLPFSDEAL
FT                   VRAVAAARTPVVSAIGHEQDTPLLDYVADLRASTPTDAAKKVVPDVGEQWELIRQLRDR
FT                   ARRVLEGGIAREEAWLASMRSRPVLANPVQEVERKIEQVFDLRDRGRRALTAALDRAGD
FT                   NLAHIRARLHALSPATTLARGYAIVRRADGTVVRSAAEVAPGEELRLRFAEDGLVAIAQ
FT                   NREEDEL"
FT   gene            complement(530529..531359)
FT                   /locus_tag="Tfu_0469"
FT   CDS             complement(530529..531359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54507"
FT                   /db_xref="GOA:Q47SR0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54507.1"
FT                   /translation="MGKALVLGGGGIVGLAWEIGVLTGLRDAGVDLRDADVILGTSTGA
FT                   IAAAQIVSGVALDELYERQLAPAGAEAAARPHWWVRARVAGTLLTARSPRLGRARVGLI
FT                   AASSARFSQAVREPLLAAHLPARDWPESTHLVVTAVDARSGAVRAFSRTDGVDLLHAVA
FT                   ASSAVPGLWPPVAVDGRWYIDGGVRSATNADLVAGHERVVVVAPSPRGPLLWRQPVTVP
FT                   FPEGTQCTWVTPSPESRAAFGRDLFNPARRAAAARAGRDQAAEVAVRVARTWGV"
FT   gene            complement(531542..532222)
FT                   /locus_tag="Tfu_0470"
FT   CDS             complement(531542..532222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54508"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54508.1"
FT                   /translation="MSKPSLINRIGDAFKRLFGRSTRPVVSSKPEDMAAADVPAKRAEG
FT                   AVSETIPAQTADADAAAEFATEAVSSDEQRPTEPPEPIKPLETSKAPEAAAAPQQAPEE
FT                   PLAEKKREEEKPAEATAKAESSSTEPSDAQSSPAEEKAAEQPAAASEEKAEPAADAEQA
FT                   PAEAPLPNYDSLTLPSVRARLRKLTVDQVRQLRAYEAAHANRPEFVRMFDNRIKKLEEQ
FT                   QSAE"
FT   gene            532475..533476
FT                   /locus_tag="Tfu_0471"
FT   CDS             532475..533476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0471"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54509"
FT                   /db_xref="GOA:Q47SQ8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54509.1"
FT                   /translation="MTATNRRRVLLAKPRGYCAGVDRAIHTVEKALEQYGPPIYVRKQI
FT                   VHNTHVVRTLEERGVIFVEETSEVPEGATVVFSAHGVSPQVHKEAAERKLRTIDAACPL
FT                   VTKVHKEAQRFAAEDLDIILIGHEGHEEVEGTSGHAPEHIQIVDSPEEVANIKVRDPNR
FT                   VAWLSQTTLSVDETNATVQALRERFPNLIDPPSDDICYATSNRQAAVKAIAPQCDLFIV
FT                   VGSSNSSNSVRLVEVARDAGARASYLVDNATYLKEEWLEGVTTIGVSSGASVPEILVRE
FT                   LLERLATYGFTDVEEVETEREKITFALPRELRTRRSKNDKSLVGKPLPVSPA"
FT   gene            complement(533481..534023)
FT                   /locus_tag="Tfu_0472"
FT   CDS             complement(533481..534023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54510"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54510.1"
FT                   /translation="MTTRRDTWEVRVPRRSAAAPRRSASAPRHRAGASPSPPRGRVRLT
FT                   ARGAVLCIVLASLVSALLATAVAYPPVNGAGFVLACGLAVLTVRPQDLLTLSVSPPLAY
FT                   FCGVLLAECVLSVGADSVLRSVAIGVGLRLTDAAPWLFGGTALLLVIALLRGLPQNVRE
FT                   LRAELTTRHRRGSRRLS"
FT   gene            534199..535293
FT                   /locus_tag="Tfu_0473"
FT   CDS             534199..535293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0473"
FT                   /product="Conserved hypothetical protein 92"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54511"
FT                   /db_xref="GOA:Q47SQ6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54511.1"
FT                   /translation="MSLSIGIVGLPNVGKSTLFNALTKNDALAANYPFATIEPNIGVVG
FT                   VPDPRLDTLAEIFGSARTVPATVTFVDIAGIVRGASEGEGLGNQFLAHIRETDAICQVI
FT                   RVFEDPDVTHVDGVVDAARDIETINTELILADLQTLDKALTRLAREARANAKDKEKQET
FT                   LAAAEKARTVLDSGKTLFSGAAEAGVDVGLLRELNLLTTKPFLYVFNGNLEAFADEAFR
FT                   AKLSGLVAPAEAIFLDAKLEAELSELDEDEAAELLESMGQTESGLAQLARVGFDTLGLQ
FT                   TFLTAGPKEARAWTIRKGATAPEAAGVIHSDFQRGFIKAEVVSFDDLVAAGSLQEARAA
FT                   GKVRMEGKDYVMADGDVVEFRFNV"
FT   gene            535887..536870
FT                   /locus_tag="Tfu_0474"
FT   CDS             535887..536870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54512"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54512.1"
FT                   /translation="MAGRSAAGRGSVIDEDAPAEADETFDAAPQPGGGRRPRAGAGGRW
FT                   WLWVGRAVLWAFIIVVIVNGVWLPIRENFFPQSTQQPVGEDTVEFPETAAASLAVRFAD
FT                   AYLNADPEKASERAEALAQFVPEGRVTAFDLPGAQLSATGIEVITVEVKDEHNALVRLA
FT                   VNVNGEPMTLDVPVYAADSEGTALVVSGRPALLAAPEKASLPDTSFATDSEARAELEPI
FT                   LKGFFEAYAHNHEHLDRYLEPGAEVTALPGDFLRFGKITDTKVPPAVPGATQDVRVAQV
FT                   TVVWLIPDGSGGDTTAELTQSYDVTVVGDDGSWYVRDIRGALNSFD"
FT   gene            536968..537279
FT                   /locus_tag="Tfu_0475"
FT   CDS             536968..537279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54513"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54513.1"
FT                   /translation="MLSLLTGFAADLAAAASTTLHLAAEVTDSPNTTGLADWLRGFFGP
FT                   LFLVIVSIVAIFFLFTREITRFAQFIILAIFIGIVFYVPGIIEVLAVAIARAMGVSTE"
FT   gene            537292..540774
FT                   /locus_tag="Tfu_0476"
FT   CDS             537292..540774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0476"
FT                   /product="similar to ATPases involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54514"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54514.1"
FT                   /translation="MDLPTYTRIWRIEKRLYKLYDFRLPVPVSLVTIGVFVGTSVVWCL
FT                   LMGLLGVPFHTPWHVVWLVPPGVITFLATRPVIEGKSLTELLRSQLVYATEARVYTRLV
FT                   PQYEPDRIIVTARVWRRDPAAGPLPGLGRTTIRHTEPETEVLEASAREDHSEPAATPDG
FT                   APAASPTPTPAHHEPEERRSAQPPLFRRVLNYFGFALPENPPARQEEPAPAPLTSSTAA
FT                   ARRAELAPRKNRDDAPAFRTGRDTGDTATGNDDHPSTAAETVAVPAGDTQPEPQDTDAH
FT                   AREPDAAATRDEEERRAAEERAATRRRAEEIMAAPEPEPTLAAESAPAPNTEPDAEPTS
FT                   TADVPTQPSRADDFADDAAEKAHRKAKRRLRGRAQSHVIARRMQRARARAEAHEAQAAA
FT                   HPTPTEEPQTRSEDIRAAAEPVVRGTAEPALQTGQGTALPAPAEEPRPQRRSNRPRPHA
FT                   APWDLPPVARTSDTGVPAPKPSPAPSPWEEPRDTADVSAAEDAAVVPAEPAVPAEPDPQ
FT                   ADSGTPEDTGPEPAPAAPSPTAADSDEPAAWEEDVSATLPSLAEQIRAAGSGKPRLEID
FT                   HGTGELDSFVDAVRPRRGEEESAASRGGEQPESVQQAGERSAGRSASGKPRLEIDHGTG
FT                   ELDSFVDAVRPRRGEEESAASRGGEQPEPVQQAGERSAGRSASGKPRLEIDHGTGELDS
FT                   FVDAVRPRRTEEELAAIEQAALRSRGFTDPAERTTPADGDNRDPLPRRHSNRLARGVRS
FT                   AGQAPQRTPDTEPEPTTTGSDTDRGLFTRFVDNARKVGGILTPARGTSTPDQHTDEAEK
FT                   RPAPSKPDLQLDHGTGEQQHFTGATPPRGGTSAGTKPASLKDASGTRGWRRLARVVTGG
FT                   HSANAKPQLSPAEMERLRKPLAGSRGVVVLGCTGGAGQTITTLMLGHTLAAYRDDHVVA
FT                   VDINPGPESLSRRIRTETPETLTSLLANTDALHAYSTLRDYTSRTPSGLEVVATLDDPY
FT                   VQTLDDRDYVTLTGTLRRHYQIILLDPAATGVARALPVVDGLVLVAPASADAARSVALT
FT                   FEWLDGHGYTDLRSRSIVVINGVSRRSLTDVDAAEQVARGNCRAIVRIPWDDHIASAQS
FT                   VIEVRSLRHTTRRAYAALAAVVADHLSHTGHQRSETAAPTPLRRPTSAQEESR"
FT   gene            540771..543254
FT                   /locus_tag="Tfu_0477"
FT   CDS             540771..543254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0477"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54515"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54515.1"
FT                   /translation="MKFSRRASRLAVRYFDDRVLLSDTEAWAYFRLPTFSYEFSTPEER
FT                   EAFATNITIALAAIRMNDAEVHLRIAHRTYPAVEWATRLDETSDSGPGWYEYLDEMYRH
FT                   VWAKDFWTKEVYLGVRLGQRGVRAQLSQGVFAQLLGIYQRTERTLGLEDDAVDDREIAR
FT                   WTAQAERLGRALAASSLHARHARASELAWLLRHSVTATIEEPRESAAGRRRWGRGEIEA
FT                   LVDGVIHNGRSYLRLEQPGGEAYVSYLSFSRFPDLMPFPDGEPWLHYADALPFPVEASL
FT                   RMKLVPPAKASKDVSRRLAHARDMQAHMSEAGAEPDIALVEQINAARMLEHGITKERLP
FT                   FVYGWYRLIVAAPTYDLLVQRVEAVTEHYRDIGIDLTQSTGDQFSLFCESLPGDRLRLE
FT                   AYVQRQPLRTIAGGMPTATVELGDRKDSSGAGWIGPYIGETIGRARSIVHFDPLVAAAR
FT                   NRPTAIAITGEPGGGKTTLALLLIYQLALRGVTVAAIDPKGDAASLVKLLQRRGRKARI
FT                   MALESAQAGLLDPFGFGDDLPTKKTMATETLRLLLPRMSEERESAMIQAVAAVADQPQP
FT                   SLGKVVTYLESADDAASRNLGAVLRSMSEMRLARLCFHPQGDTQVDTEGWTTVFTLGGL
FT                   TLPDSTVHRDDYSYEQRLSVALLYLVSQFARRLMNGLDWRVPKAIFLDEAWAVTSTPEG
FT                   AKLVPEVSRMGRSRNTALILVSQNAGDLLNEQVTNCISSVFAFRSTERVEVRNVMSLLG
FT                   IEPSEEHIAALRNLGNGECIFRDLDGRAGRIAVDLVSEELLRWLDTNPTRRKPQVEEDG
FT                   ALVGNTTRDIREPLP"
FT   gene            543992..545614
FT                   /locus_tag="Tfu_0478"
FT   CDS             543992..545614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54516"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54516.1"
FT                   /translation="MEKAEWESANDFAVRQNSQMLWSGLVCRPWIAGEFGTGPVANVAA
FT                   RYHAMDLLEAQGVSRLEQYQIANGEIDAAELYSEKQASYEEISANIKNAYPEVYPIFEG
FT                   SQQGIRLGVASLALFASIFAGGVILVGSVALIVLKIGFLLLLLLAPIFLLIGVHPGYGR
FT                   TVLVRWFELLLGLLLKQIFVVLLIALLVMCYGLVMATDLGWGLQMILLALFTVALFIYR
FT                   KPFANLFASVNANTFTSRMVNDALNSRVLAASANVLPPVAYMKAQKWGLDRAPQLAAGA
FT                   AALPAGAAATAGAAAGADAAEAEGVATATEGDNEGATATESGGRARARGVAGYGRTPGK
FT                   AAPPPLNLDGSSKSGGASRAGVAPQRDSSQAPRLSTASSASSSLFEGTGGGGAIPPRPA
FT                   GGYTGVGDTGWSSVFGTGSSGNAHRAEAAPRASKDAAPPRADSSASGTGLFGGRTETPP
FT                   QGSTLPRPSRWAGPGTRGEKRTPPPARPAPAPSSSEQSSGEGGTWLSGSRKDKDAPISP
FT                   FWAEGAGRRDRTREVPFWLDSDD"
FT   gene            545701..546351
FT                   /locus_tag="Tfu_0479"
FT   CDS             545701..546351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54517"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54517.1"
FT                   /translation="MSKPLSDGAQRLVFGVLIVALVSFGIYWSLGGGSDTSDPEQQEQV
FT                   AEGGRTETLEEGGEDQPVEPLPTVAAEDMALADWLPFSEEEFIAAAAVAQEFATDYGTI
FT                   DYSKSPQEYYDRLGEHATKEYARTLAQSSGAEALWGERAEQKATSTGRAVVKSIRGFDD
FT                   ESIVFILKVQSITESDDGKAQNLGDFAVTMVKEGGSWRVYDFQPADAGNLGGG"
FT   gene            546351..547523
FT                   /locus_tag="Tfu_0480"
FT   CDS             546351..547523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0480"
FT                   /product="similar to Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54518"
FT                   /db_xref="GOA:Q47SP9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54518.1"
FT                   /translation="MLRLFVRVPPSDDGNCATQFAIGVGLFIAGVVTIAMVVIPLATVN
FT                   QSVANLTSGALKCTSETEQVEASGYAENSIPENYLEIYQRVGEEKGIPWNVLAGIGQVE
FT                   SHHGRWDGPGITEGHNDWGAAGPMQFGALDGSAAGNSWGGEPIMPVEDRPEEGYGQDGN
FT                   GDGIVNVYDPEDAIPAAADYLLDHGAKEDIRQAIYAYNHAWWYVDEVLEWAEKYAEGSY
FT                   TASASIATAVNCTLTADGNFIGSAPDDLVQAVVDWALAQRGKPYVWGGTGPNGFDCSGL
FT                   VMRAYESIGVTIPRISQDQWNFGPRIPKGQEQPGDLVFFDVQRPGEPPGPGHVGMVIGD
FT                   GLMVEAWCTNCGPIAVREYDSPNRAPIMGFTRPLEAPEAKAQLAQLENRG"
FT   gene            complement(548778..549227)
FT                   /locus_tag="Tfu_0481"
FT   CDS             complement(548778..549227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54519"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54519.1"
FT                   /translation="MVSLLLNWLGVGFRLLRPVTGVHAAPKSVVATLEAPSVRSRKARE
FT                   PHSHPAPTAKQNTTASRRGPVPVVDPDNVNPQAALIRPYFVAHERQAALGRFLMSDLAK
FT                   ADAIYDRLSEAVRERLDDPELADAFEHLDDWLRAGRALPTPWKRE"
FT   gene            549423..549740
FT                   /locus_tag="Tfu_0482"
FT   CDS             549423..549740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0482"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54520"
FT                   /db_xref="GOA:Q47SP7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54520.1"
FT                   /translation="MVTQAMDMEDLGPLSREYGPDSEIDPVCIDPVWKQIAAILLSRIR
FT                   AGWYQPGKPIPSVKQLHQEFGIAKGTAERAVNWLKEQGLVRSVVGRGVFVLPEHMRPKN
FT                   E"
FT   gene            complement(550441..550815)
FT                   /locus_tag="Tfu_0483"
FT   CDS             complement(550441..550815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54521"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54521.1"
FT                   /translation="MRSVSAAVVDAAVVVLFVLIGRSSHGEPNTLIDVVTTLWPFAASL
FT                   ALGWIVARAWQMPVAPLRTGVGVWAITVAAGMALRALSGGGIAVSFIVVASLFLAAGLI
FT                   GWRVVATLVLSRRTTTPTPH"
FT   sig_peptide     complement(550735..550815)
FT                   /locus_tag="Tfu_0483"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.980 at
FT                   residue 27"
FT   gene            complement(550918..552024)
FT                   /locus_tag="Tfu_0484"
FT   CDS             complement(550918..552024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0484"
FT                   /product="streptogrisin C. Serine peptidase. MEROPS family
FT                   S01A"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54522"
FT                   /db_xref="GOA:Q47SP5"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR004236"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="PDB:2PFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54522.1"
FT                   /translation="MNHSSRRTTSLLFTAALAATALVAATTPASAQELALKRDLGLSDA
FT                   EVAELRAAKAEAVELEEELRDSLGSDFGGVYLDADTTEITVAVTDPAAVSRVDADDVTV
FT                   DVVDFGETALNDFVASLNAIADTADPKVTGWYTDLESDAVVITTLRGGTPAAEELAERA
FT                   GLDERAVRIVEEDEEPQSLAAIIGGNPYYFGNYRCSIGFSVRQGSQTGFATAGHCGSTG
FT                   TRVSSPSGTVAGSYFPGRDMGWVRITSADTVTPLVNRYNGGTVTVTGSQEAATGSSVCR
FT                   SGATTGWRCGTIQSKNQTVRYAEGTVTGLTRTTACAEGGDSGGPWLTGSQAQGVTSGGT
FT                   GDCRSGGITFFQPINPLLSYFGLQLVTG"
FT   sig_peptide     complement(551929..552024)
FT                   /locus_tag="Tfu_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(552260..554395)
FT                   /locus_tag="Tfu_0485"
FT   CDS             complement(552260..554395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0485"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54523"
FT                   /db_xref="GOA:Q47SP4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54523.1"
FT                   /translation="MSFPRQYARTQRFSIGVPRSFQISPDGQRVAFLRSRDGTDTATCL
FT                   WVAEPDGTERIIADPRTIGDTGEDLPPEERARRERLRESGSGIVSYSVDKAFTRAVFSL
FT                   SGRLYSVELDGSGTPRELPAASPAIDPVLDPTGRLVAYVHKGAIHVLDLADGLDRVVAA
FT                   PDGKNITWGLAEFIAAEEMGRHRGMWWSPDGTFLLATRVDTTPVRRWHISDPGNPEAVP
FT                   QTVAYPAAGTDNAEVRLAVLRADNTGEPVWVEWDRDAFPYLVTAGWTQRLKGTSTIVFT
FT                   VQDRAQRTLRACTADPLTGHLHELWTETSDTWVEIMPGVPEFDASGAALRFGVDSSGER
FT                   ALYLGDRMVNSPGQYVRAVLDVDGCCVLYSASPLGEPHIVRLWLYDSRTDTRTEMSFPG
FT                   ADGPSGVHSGLLRGDTLVIQRRDLSSPGVRTAIVRGVHEEQSVTEVESRAERPDLPGVH
FT                   VQLQRLGEREIPAALVLPSWYTPDSDPLPVLLDPYGGPHAQRVLCAQSAYLTAQWFAEQ
FT                   GFAVLIADGRGTPGIGLAWEQAIHRNMAETVLEDQVAALHAAPEAFGVRLDLTKVGIRG
FT                   WSFGGYLAALAVLRRPDVFHAAVAGAPVTDWRLYDTHYTERYLGHPDDDPECYERESLL
FT                   VDAPKLQRPLLLIHGLADDNVVFAHTQRLSSALLAAGRPHTVLPLSGATHMANDPTVSE
FT                   NLLLVQVEFLRDALHLT"
FT   gene            554504..555364
FT                   /locus_tag="Tfu_0486"
FT   CDS             554504..555364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54524"
FT                   /db_xref="GOA:Q47SP3"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017810"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54524.1"
FT                   /translation="MNDRRLLLVHAHPDDETIVTGATMARYAAEGAHITLVTCTLGEEG
FT                   EVIPPELAHLASDREGGLGEYRVTELERACAALGVHDQRFLGGKGRYRDSGMMGAPTNS
FT                   HPACFWQADVDTAAHELAAIIREVRPQVIVTYDDNGGYGHPDHIQAHRVTMRAFAQAAD
FT                   PSLPGTPWQARKLYAIAQPRKLLEESVARMQADPGPFTAPTAVEDIAPGTPDDLVTTRI
FT                   DGSAYWEKKRDALQAHATQVAVAGTRFALSNGIAQEIHAVEYFTLLHGPEPRRGPDGYE
FT                   TDLFA"
FT   gene            555449..555973
FT                   /locus_tag="Tfu_0487"
FT   CDS             555449..555973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54525"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54525.1"
FT                   /translation="MTSSAEHTGERAEPGAEATAGLDRRLMGMLAALNIVFLAALGLVG
FT                   GIVAGLCAGWASWLWLTGTIGQLLSVATVLLFLLVLFSGARVIGWAVGAKWGPGAFAAG
FT                   WILAGVLLTGYVAGGDVVMTSTVPTYLFLYGGVGAVIVATVLTPETGDKVTTDGGTSAP
FT                   TRGTATPPQSD"
FT   gene            complement(555909..556760)
FT                   /locus_tag="Tfu_0488"
FT   CDS             complement(555909..556760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0488"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54526"
FT                   /db_xref="GOA:Q47SP1"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54526.1"
FT                   /translation="MSTSDPAPRSAAEEPPTGPSTTAKTESASPGWLDFLPSPMFLLLV
FT                   GVTALAGWLSWTRAEETVLGWRTAYAPFLLLLGGWLICLTLHQYVRSLLAYRGGDRALR
FT                   GSGYLKLNPFAFRELGAQVVLPVAFLLLGTFGLNGPAVHVDRSAVTRPFRVLAALGGLA
FT                   TNVVLAAVLAVTVALLVPAGQVTNNWAIGAVMFLCFLNVSAALLALLPVPGTVGYDILT
FT                   EAVNRWRPSRNAAIFGTVLLFAAVWCPPIHAVFLERLFSLFSLIGVESLYLEWGQTFLR
FT                   PW"
FT   gene            complement(556860..558194)
FT                   /locus_tag="Tfu_0489"
FT   CDS             complement(556860..558194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54527"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SP0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54527.1"
FT                   /translation="MQETVAAALAHLTRTDPVAAHVAQSALDTLLSGRRLETLTQHAVQ
FT                   EFCWHVLPVRFSSEPSEWQFVTDSLSSLFRLLDLDRYADICVSERTREVLRAYATSHDQ
FT                   GLAAYERSMRSSGVIPPDLPELTWGTALGNAEIEAYRETSAVLELAIAAGEVRPGTRGW
FT                   RAAQEERARSFLTQPDHHGLSYLDKIRQERVAEWLASRSHPHREHLLPLRGQLTAGVDM
FT                   PRNAADALAPVQRLLDYAADGIALTQIGYISPAVVRALCDEFGWWTSPSPPRSETDVMQ
FT                   LIVLHKLLRAMRAVRRSGRRLVLTRHGRQLHSDLNELWRAVAESVLATDGFEQAAIETL
FT                   LGVLLLRSPQSASAPYGDADIDVADEACRLLIQSGWEDDVIGGRPRTDQVRSVLISVVW
FT                   LLEILGCITGPDLLGDGPTPQLTKVGRAFALTALHLSATAPAASL"
FT   gene            complement(558248..558499)
FT                   /locus_tag="Tfu_0490"
FT   CDS             complement(558248..558499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54528"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54528.1"
FT                   /translation="MGYVARFTHAITKDDVGQRVTVRFRLPDGRFRDIVGVLESWHDDV
FT                   LVLRRRDGSLAHVTAAEIVASKVVPPQPPRRSGAPGSA"
FT   gene            558732..559052
FT                   /locus_tag="Tfu_0491"
FT   CDS             558732..559052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0491"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54529"
FT                   /db_xref="GOA:Q47SN8"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54529.1"
FT                   /translation="MTYVIAQPCVDVLDKACIEECPVDCIYEGGRMLYIHPDECVDCGA
FT                   CEPVCPVEAIYYEDDLPSEWSDFYKVNVEFFEELGSPGGASKVGKIDRDHPLVAALPPQ
FT                   GE"
FT   gene            559260..560372
FT                   /locus_tag="Tfu_0492"
FT   CDS             559260..560372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0492"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54530"
FT                   /db_xref="GOA:Q47SN7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019880"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54530.1"
FT                   /translation="MAERRPVADRLPTFPWDRLAPYKETAAQHPDGIVDLSVGTPVDPV
FT                   PPRLRAALAEAADTPGYPQTYGTRALRESISGWLARRHQVQVDPDATLPTIGSKELVAW
FT                   LPTLLGLGPGDTVVFPELAYPTYDVGARIAGATPVAADSLTQLGPVRPGLLWINSPANP
FT                   TGRVLGLEHLRKVVSWARERGVVVASDECYLELGWEGERPLSILHPEVCGGSHEGLLAV
FT                   HSLSKRSNLAGYRAGFVAGDPALVQQLLQARKHAGMMVPAPVQAAMRAALDDDEHAEEQ
FT                   KQRYAARRTQLRDALEKAGWQITHSEAGLYLWASHPDYDAWGSVRVLAEQGILVAPGEF
FT                   YGPAGARHVRVAFTATDERVAAAVKRLAEL"
FT   gene            complement(560405..561250)
FT                   /locus_tag="Tfu_0493"
FT   CDS             complement(560405..561250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54531"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54531.1"
FT                   /translation="MPRKRRRISAFVKILFALTLACGLLVAAGIYAIRSIKPLDLTPPP
FT                   PKDGCRLATEEDTDTLEVEQAANAATIAGVAFAMDLPPRSVVISYATVWQESQFFNIEY
FT                   GDRDSLGLFQQRPSMDWGTPEEIIDPVYASTKFYEELVKVENYLEIPVYEAAQAVQRSA
FT                   DGFAYDQHTERAQVMANAFTGVEGAVVTCWFPDEEAGPTDVAAAVEEMRRVFGVGPEEL
FT                   GTVERQTGDLGWAMAQWAVAHAAAYGLTSVTYLDQQWTAESGLAGWQSLPTTTQQLVLE
FT                   "
FT   sig_peptide     complement(561152..561250)
FT                   /locus_tag="Tfu_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.854 at
FT                   residue 33"
FT   gene            561494..562330
FT                   /locus_tag="Tfu_0494"
FT   CDS             561494..562330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0494"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54532"
FT                   /db_xref="GOA:Q47SN5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54532.1"
FT                   /translation="MTTSYTSPLPESIDELWERRSELTPDDAEAREIIVGAVDQIDAGK
FT                   ARVAHVDPETDEVVVDQRAKRAILLSFRVLGMEESTVGGFHYHDRIPLKTRLDGVRVVP
FT                   GAIARWGSYIAPGTVLMPSFTNIGAYVDSGTMVDTWATVGSCAQVGKNVHLSGGVGVGG
FT                   VLEPPQASPVIIEDDAFLGSRSMVVEGARVRRGAKLGAGTILTASTRVFDAETGEELKR
FT                   GEAPAWSVCVTANRVKSFPGGDFGLPCLLVLKRLEEGQEHDKLALNELLREHGVNG"
FT   gene            562424..563488
FT                   /locus_tag="Tfu_0495"
FT   CDS             562424..563488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0495"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54533"
FT                   /db_xref="GOA:Q47SN4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010174"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54533.1"
FT                   /translation="MLDLTADVRDLTARLIDIASVSGEEEPLADAVEQALRSYAHLTVL
FT                   RDGNAVVARTDLGRERRVILAGHLDTVPIADNVPSRVVDGRLYGCGASDMKSGVAVQLK
FT                   LAATLTDPVYDLTFVFYDCEEVEAERNGLRRLVARHPDWLRGDFAVLLEPTGGQIEGGC
FT                   QGTMRVEVTAQGVRAHSARSWMGRNAIHEAGRILDVLRAYTPRQPEVDGLRYHEGLNAV
FT                   GITGGVAGNVIPDQCVVTVNYRFAPDRTPQEAEAHLREVFDGFDVRVTDVAAGARPGLD
FT                   HPTAAAFVASVGGGQARAKLGWTDVARMAELGIPAVNYGPGDPTLAHTKDEWVDLAEIA
FT                   TAEQRMAAWLTGAG"
FT   gene            563593..564402
FT                   /locus_tag="Tfu_0496"
FT   CDS             563593..564402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0496"
FT                   /product="Conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54534"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54534.1"
FT                   /translation="MTDSRSIERQAGPLTYRGREIPKSTTDQRLLDRRGPTDWVHTDPW
FT                   RVLRIQSEFVEGFGMLSEVGRAVCVFGSARIKPETPYYELGEEIGRKLVEAGYTVITGG
FT                   GPGLMEAANKGAADVGGTSIGLGIELPFEQSLNDYVNLGVVFRYFFVRKTMFVKYSQAF
FT                   VVLPGGFGTLDELFEALTLVQTGKITRFPVILVGTDFWGGLVEWINDRLLAEGLISPSD
FT                   PDLIHLTDDPDDVIETIQRAHAEWERALEEEEAVTELEEALREAEHS"
FT   gene            564413..564937
FT                   /locus_tag="Tfu_0497"
FT   CDS             564413..564937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54535"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54535.1"
FT                   /translation="MPRHILWRGCGTIDSVIAILILTALAAFAVLVTVAVLVMGHGGQL
FT                   ARFEADHPPLDLPVDRLVTGRDVARIRLPLALWGYHVRAVDEVLDRMAADIEERDARIA
FT                   QLEARLHSPASSAARPQVWYPRSPRETSAEGGEQHAPESEGSDTDPWPDAAAPPGVEYA
FT                   NQHSGIGDRRE"
FT   sig_peptide     564413..564502
FT                   /locus_tag="Tfu_0497"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.616 at
FT                   residue 30"
FT   gene            564934..565590
FT                   /locus_tag="Tfu_0498"
FT   CDS             564934..565590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0498"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54536"
FT                   /db_xref="GOA:Q47SN1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54536.1"
FT                   /translation="MSVESPPQESSGADFPSQGARRGADGRFRCPWALGAADLMRYHDL
FT                   EWGVVVRDDRGLFERVSLEAFQAGLSWLTVLRKRAALREVFCGFDMARVAAFTERDVQR
FT                   LLADARIIRSRAKIEAVISNARAALALPEGLAEFVWRYAPESPPPAPKTAADVPASTPE
FT                   SAALARALKQRGFRFVGPTTVYAMMQAVGMVDDHLVDCHCRGSGTARGYPAESPA"
FT   gene            565929..566507
FT                   /locus_tag="Tfu_0499"
FT   CDS             565929..566507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54537"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54537.1"
FT                   /translation="MTAPPESERSARPSAASPIRAMSLWPPPRSARHNNRRPKLPLILG
FT                   VGVGVVVLAVMVGSLLWGEEEPEPEEPPAVVTDGIPEEYAGSWSGEMSQHDEEGNLVAD
FT                   WVVQLKLDAGTDRGSAELLPFHCRGSIVLTEQTAESLVFDYAETYDPEDRCIDTSMLTL
FT                   TQRVPGTLEATWEGISREGTVMTSTGTLK"
FT   gene            566517..567989
FT                   /locus_tag="Tfu_0500"
FT   CDS             566517..567989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0500"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54538"
FT                   /db_xref="GOA:Q47SM9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54538.1"
FT                   /translation="MPAASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQG
FT                   GQGVVYLGSAPDGARVAVKTLHRDALDLPGLREQLAEEVEMARRVARFCTAQVLAADLD
FT                   ADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPAN
FT                   VLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATL
FT                   VYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETLM
FT                   LVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHS
FT                   NVAAQPSPTPPPHPQTASGPQPSLPSTGAQHSGYGYATGPHQSGYGYATGPQQGGYAPP
FT                   PGPHQHAYPTPHSGNAAIPPHGGPSGPYAPAQPWMPSTGGYPQTSQPYSGQQYQQQAEG
FT                   TSTAFVLGVVSIAVIAGVLLFILLFLLIGSLG"
FT   gene            complement(568007..568798)
FT                   /locus_tag="Tfu_0501"
FT   CDS             complement(568007..568798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0501"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54539"
FT                   /db_xref="GOA:Q47SM8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54539.1"
FT                   /translation="MSDKESVRYEAADGVATITLNRPEMRNTLTVETQQLLLEALERAR
FT                   GDAAVRAVLLTGAGEAFCAGWDMVEHGRRLSEGKGFGDTVRAYTNPIVLTMARMPKPVV
FT                   AAVNGVAAGAGAGLAFAADLRIAAAGASFVLAFASLGLGADSGVSWTLPRLVGQARAME
FT                   MLLLAEPVTAERALDIGLVARVVAPEELAHAARSLALRLASGPTVAYSAIKAEVGCGAA
FT                   LDLAGALEIEASLQDQCVETADHLQAALAFLEQRQPAFRGC"
FT   gene            569137..569304
FT                   /locus_tag="Tfu_0502"
FT   CDS             569137..569304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54540"
FT                   /db_xref="InterPro:IPR021465"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54540.1"
FT                   /translation="MAAMKPRTGDGPLEVTKEGRGIIMRVPLEGGGRLVVELTPAEAGE
FT                   LANALNEVVS"
FT   gene            569432..570937
FT                   /locus_tag="Tfu_0503"
FT   CDS             569432..570937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0503"
FT                   /product="leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54541"
FT                   /db_xref="GOA:Q47SM6"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54541.1"
FT                   /translation="MPVPLATEIHPTDGVLAESTADRLAIIVRAGTDGPQPVADGVGLS
FT                   LTNLDARLPASVAQLFDTYEFRGKAGQIVEFPVDLGRGLIRLSFLGVGDATPEEMRKAG
FT                   AAFARSVRGSSRAAVNAAVSGHDPEALTAFVEGALLASYTFTLTETAEGTAPAAAIDLV
FT                   GSAASEAAEPTRRGTVLARATAMARDLINTPAAEKSPAWLASRAEAIGAEAGLSVRVWD
FT                   EEALYHDGFGAILTVGQGSPRPPRLVELSYRPAGATEHIVLVGKGITFDTGGLSLKPND
FT                   NMKLMKTDMSGAGIILAVLSAVQELGVRVSVTGLLAIAENAFSGSAMRLGDVLTTYSGR
FT                   TVEVLNSDAEGRLVLADAIGYAVTKLAPDTLVDVATLTGAARVALGSGIGALFATDDTL
FT                   AAALVDAGKRSGETLWRMPLHEEYRDALDSPVADLANTSVKDDYGHPGAIEAALFLREF
FT                   VGSVPWAHLDIAGPGRSMSDEGILSKGGTAFGTRLLLRWLAER"
FT   gene            571138..571713
FT                   /locus_tag="Tfu_0504"
FT   CDS             571138..571713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0504"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54542"
FT                   /db_xref="GOA:Q47SM5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54542.1"
FT                   /translation="MADPAPAADFGHWEPPSWEEVVRTHSARVYRLAYRLTGNQHDAED
FT                   LTQEVFIRVFRSLANYTPGTFEGWLHRITTNLFLDMARRRSRIRFEGLAETANDRLEGR
FT                   EPSPAQAYDDRHFDADVQAALDALSPEFRAAVVLCDIEGLSYEEIAATLGVKLGTVRSR
FT                   IHRGRAQLRAALQHRRQAAERVGEVTEA"
FT   gene            571710..572348
FT                   /locus_tag="Tfu_0505"
FT   CDS             571710..572348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0505"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54543"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54543.1"
FT                   /translation="MSHLEEQLSAFIDGELGHSERERVLSHLARCEPCRFEAAMLRQLK
FT                   QRLCTLRPPEPASEFLTRLLALPEATTGDPPAPPSGFGASPPLGAGQPLGGLPLPRPER
FT                   RPAPARGLFRFRGEWGRARYAVAGVSMLAAALGTAFLAGGDPAEPPVVTPALTDYAIEH
FT                   AAVSGQSPLGDPATVPVVTRPLSPHDAPTVQVVQTVNRGVMRSDTPEHR"
FT   gene            572345..573418
FT                   /locus_tag="Tfu_0506"
FT   CDS             572345..573418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54544"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54544.1"
FT                   /translation="MSGGRDTAGPRWRAPATAAVLCLLLCLVSVAVVGDSADRPAGRRG
FT                   GDGMAVLRRAAETSVRLSYQGVRVVSWVDSTGRTETARLNILHQPGVGTLVSPLHDTGE
FT                   GTNLLVGSTPWGRVGKDVLDVLETNFWVRTEGETQIGQRSAVGVVAQRDNGQVAARFWT
FT                   DEHTGLLLRREVYDISGEVAQTSVFESIQFGVDAAALAEETRQPDVVSRPWGDELDPQE
FT                   LRQLRDEGWVLPERLLWGFELVEARATGEGDERITHLTYSDGISVISVFTQRGSLGGAA
FT                   VTGLRRTEEDGALVHVADEGGQHQRIWEADGFVHTVLADAPAGLVADVLHALPPPDRHG
FT                   FWERVGRGFERVGTWLD"
FT   sig_peptide     572345..572449
FT                   /locus_tag="Tfu_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.509 at
FT                   residue 35"
FT   gene            573537..575006
FT                   /locus_tag="Tfu_0507"
FT   CDS             573537..575006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0507"
FT                   /product="trypsin-like serine proteases typically
FT                   periplasmic contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54545"
FT                   /db_xref="GOA:Q47SM2"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54545.1"
FT                   /translation="MTDETGRRDIHGEAEDPVTGPAKPPSGPYTGSASGPATAPPASPG
FT                   GMSPGPAWSPIGEQPAASGWNPSAGPGPVRQTPSSHTQTWAVPPGLRNPGPPPDAVHST
FT                   GQWPVFTPGIPAEEPQQRPRRNGMPLWAVLLLVMVVAAGSAGVGGMVGASLVAPEESPP
FT                   PQSSGALNNEVPSDVPSRAPDTIAGVAQRVSPSVVSIRSTSPQLSGNGSGFVIEGNYVV
FT                   TNNHVVDAVRRGGIEVVYSDGHVSRAEVVGAAASSDLAVLKLADPLDVEPLEFGDSDEV
FT                   AVGDTVIAIGAPLGLDGTVTSGIVSALNRPVTVGEDGQEAYLSAIQTDAAINPGNSGGP
FT                   LVNEQGLVIGVNSAIATMSGSSGEQSGSIGLGFAIPSNQASRVVEQLIETGEAPHAVIG
FT                   AILDLRYPEQGALIMEAGRGAETVMRGGPADQAGLRPGDVIVEFDGTTVRDATQLITLI
FT                   HTKAPGDRVEVRYLRNGREHTTTLVLGSSND"
FT   gene            complement(575089..576261)
FT                   /locus_tag="Tfu_0508"
FT   CDS             complement(575089..576261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0508"
FT                   /product="ATP-binding protein involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54546"
FT                   /db_xref="GOA:Q47SM1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54546.1"
FT                   /translation="MGHLGFRTIDDMSTTPTTEQVNAALATVKDPEIHRPITELDMVKS
FT                   VEIHDDGTVSVGIYLTVAGCPMRGRIEKDVADAVSKVPGVTGVKVTLDVMSDEQRKALQ
FT                   AKLRGGHAEKEIPFAKPNSLTKVFAVASGKGGVGKSSITVNLAAAMAAQGHKVGVVDAD
FT                   IYGHSVPRMLGVSDRPTKVEDMILPPTAHGIKVISIGMFTQGNQAVVWRGPMLHRALQQ
FT                   FLADVYWGDLDVLLMDLPPGTGDVAISVAQLLPNAEILVVTTPQQAAAEVAERAGSISA
FT                   QTHQRVAGVIENMSYYQAPGSDERVYIFGEGGGQAVCDGLSRTLGTKVPLLGQVPLDVA
FT                   LREGGDRGVPLVLDAPDSEAGKVLRSIAEELLGKPRGLAGMMLGLSPTRR"
FT   gene            576351..577511
FT                   /locus_tag="Tfu_0509"
FT   CDS             576351..577511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54547"
FT                   /db_xref="GOA:Q47SM0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54547.1"
FT                   /translation="MGNVPPPWPSGPDPRERAVPQHSQVWASPGQAAHPGGPDAVWAWP
FT                   PPVKPPRPRVDTPPPGVPYHRMGRTERHRWWKPPLAIGCAIPLSFGLGLFFVLVLELVK
FT                   AIRHIPADVAELGHPVADLAVELVLVIVLLPAVLIAVRVVQRRRAGTLSSVEGRLRWRW
FT                   LLRCTAVAVGCVVVSFGGLMALLVITKPGEPLFGEFAGMETFLAALAVIFLLVPFQAAA
FT                   EEYALRGFLMQLVGGYGDPTRPGRSAPGRLFHRFLASPVPAILVSGLIFTLLHDYYDWA
FT                   LLDVAVFGLGMAWLTWYTGGLEAAIALHVVHNLVAFVLAAYEGDFDSSGDTGSWQSLLA
FT                   TIVEVSVFCLVVAWMRRKQAIRHTTPEAEATPPARPQSPPPSPQWS"
FT   gene            577555..578211
FT                   /locus_tag="Tfu_0510"
FT   CDS             577555..578211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54548"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54548.1"
FT                   /translation="MKTAPTCPRCGRAVHEPDLWSSAWRCDAHGPVTPLRAVRDPSPTS
FT                   LEVVLDEAKVPVWLPWPLPDNWVITGFADVGEERTGTLAAAVALSGPAPLGGLGELVIV
FT                   SEEPGIGLAARIARLDGPDPGNSFDRNPPAAKVRNDGHEIALWSLDGGPERAIYVGEAM
FT                   AQWLWFIFSPADSGVLMCEIDAIHDLRDARDVGPFPTLPFGAPSPFLTESLKPAG"
FT   gene            578230..579102
FT                   /locus_tag="Tfu_0511"
FT   CDS             578230..579102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0511"
FT                   /product="phosphoesterase PHP, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54549"
FT                   /db_xref="GOA:Q47SL8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54549.1"
FT                   /translation="MIGAMRIDLHSHSSVSDGTGTPAEVVAHAAAAGLDVLALTDHDTT
FT                   AGILEAAQHLPRGLTLVPGIELSCAYQGSSVHLLGYLFDPDHPELTAELQRIRDDRVIR
FT                   AKTMVERLQAHGVPVTWERVRALAGEEDGRNVVGRPHVAQALVEAGAAEDVQDAFDRWI
FT                   GSGKPAHVTRYALDPVRAVRLIRAAGGVCVLAHPARSEGALTHAVPDDLVERMAEAGLN
FT                   GIEADHPSHDDEERASWRRRAEELGLVVTGSSDDHGELTGRRLGCCTTEPDAYAALAAQ
FT                   ASGAEPYVG"
FT   gene            579301..580128
FT                   /locus_tag="Tfu_0512"
FT   CDS             579301..580128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0512"
FT                   /product="similar to Zn-dependent hydrolases including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54550"
FT                   /db_xref="GOA:Q47SL7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54550.1"
FT                   /translation="MFWKRKAKKKSEAEADAAVTTVEDAEEAADASSDEESAQADTGSS
FT                   ADASDGAEKASEAGDGSSDSSDLSIERVEMAGTLEVDGEEYEVVTNTWIVQIDEDGVVV
FT                   VNPGEDAKAILEKVGDREIYLVACTNGYRPHIAGAVEVAERDEAPIALHPKELRRWRKV
FT                   HGVEHSPEIEAEGGGKLTIGDVEVEILPTPGTAPGSLSYYFPHIKAVCSGDTLLAGKLG
FT                   TVGDGYMDYTSQLASVGEVLLALPEETRVLPSTGEETTIAEESKNFDSWVLGE"
FT   gene            complement(580192..581064)
FT                   /locus_tag="Tfu_0513"
FT   CDS             complement(580192..581064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0513"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54551"
FT                   /db_xref="GOA:Q47SL6"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54551.1"
FT                   /translation="MSTPRILTLPPGAHRTTIPTPSGPIAALAAGPVGGAPDRHTAVLV
FT                   PGFTGSKEDFIALLGPLAQAGRRVYAIDLPGQYQSPGSDTLDAYSCAALGRAVAEVIAA
FT                   LEQGPVHLLGHSFGGLVTRETVLSTAVPLLSHALLGSGPSGVEGSRREDALRLIAALGP
FT                   SPTREIVHRIWWEHLEDQYRASGLPEEIHVFMRERMLANHPLGLLRMAQEVTSAPDRTA
FT                   ELAAAGLPTLVLYGEDDDAWSPATQSAMAAVLNARCVVISGAAHSPNVEAPEATAAALT
FT                   AFWDQAESR"
FT   gene            complement(581156..582667)
FT                   /locus_tag="Tfu_0514"
FT   CDS             complement(581156..582667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0514"
FT                   /product="helicase, C-terminal:DEAD/DEAH box helicase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54552"
FT                   /db_xref="GOA:Q47SL5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54552.1"
FT                   /translation="MEASTLTTVRSTHSSDQTTFRDLGVIDDIADALEAEGIVAPFPIQ
FT                   SMALPLALTGADIIGQARTGTGKTFAFGLPLLQRVHTQPGSAKRPRALVVVPTRELAIQ
FT                   VAADLATASKRIDVRIATVYGGRAYEPQISALRKGVDIVVGTPGRLLDLVKQRHLILSE
FT                   VTALVLDEADKMLDLGFLPDIERILAKTPDQRQTMLFSATMPSEIVALSRKYLRRPTHI
FT                   RAEDDPLDTGSGQVTQHVFRTHPLDKLEMLARLLQARNRGLTMVFCQTKRECHHVSTEL
FT                   CRRGFAAAAVHGDLGQGQRERALRAFRNGKVDVLVATDVAARGIDVDDVTHVVNYECPD
FT                   DEKTYTHRIGRTGRAGRSGTAVTFIDWQELLRWKLINRALGLPFADPPETYSTSPHFFD
FT                   ALDIPRDAKGVLAKEEQDRAGLAAEEVEDIGETGRASRTKDRERSRQRRSRPRKRTRRG
FT                   VPTTRSAAEPTGETAAKSDADSSARTRRRTRRRSRRNAGTNSDRA"
FT   gene            583177..583878
FT                   /locus_tag="Tfu_0515"
FT   CDS             583177..583878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54553"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54553.1"
FT                   /translation="MSSAVAPDPSRVTTPVDRGVIDLLGLLAYAELVSFFRLASDAELA
FT                   PTLTDKAELAAFAATEQAHHQVLRRKLVELGVDPEEAMQPFIAPLDAWHAHTTPQTWLE
FT                   SLVKAYVGDGIAADFYRQVAEVTDPEIRELVVDVLSEEGRAEFIAAKVKQAVAEEPTLA
FT                   GRLALWARRLVGEALSQAQRVALDRPQLAELLAKGDSSEERNGDLAAVSRIFARLTESH
FT                   NARLQAMGLAG"
FT   gene            584219..584461
FT                   /locus_tag="Tfu_0516"
FT   CDS             584219..584461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54554"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54554.1"
FT                   /translation="MGSGRHGAARPPIGVLIHRDRVDFSIYGLQAAVTLVIMVLTGPAS
FT                   PVFWLCFLLLFGGVVLFFRRIDRLAREELAESDLL"
FT   gene            complement(584559..585386)
FT                   /locus_tag="Tfu_0517"
FT   CDS             complement(584559..585386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54555"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54555.1"
FT                   /translation="MFTPLAVTDIGQGIGSVWGSLVAFIPRLAVFLVVLILGWLLAKLI
FT                   GRLVAKALAKVGLDRALERGGLGSYFQRSRFNASDIAGKFVYYAGVLIVLQLAFSVFGP
FT                   NNPITQMLNSVVAWLPHLAVALIIVVVAALIARAVRELASEALGGLSYGKVLANTAGVF
FT                   IVGLGIIAALNQIGVAAAVTLPILIAVLAAVAGILIVGVGGGLIRPMQQRWEGWLDRAE
FT                   SETKNFRAQGAGDRGPATAGSRSTETVAPPRQESAPGEPLASSGERRRRHRRP"
FT   gene            complement(585534..586154)
FT                   /locus_tag="Tfu_0518"
FT   CDS             complement(585534..586154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0518"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54556"
FT                   /db_xref="GOA:Q47SL1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54556.1"
FT                   /translation="MTAPSEAQPRGTRLPRIARRRQLLAAAQQVFVERGYHAAAMDEIA
FT                   ERAGVSKPVLYQHFPGKLELYLALLEQHSEALVEKQRAALQSTDDNWQRVVASFKAYFD
FT                   FVSGEGGAFRLVFESDLRNLPAVREITEQTTLRCAELIGEVIRQDTSVSDEEAHLLSIG
FT                   LVGMAETSARYWLSRGTIPKDAAEQLIARLAWRGISGWDLTRH"
FT   gene            complement(586326..586574)
FT                   /locus_tag="Tfu_0519"
FT   CDS             complement(586326..586574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54557"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54557.1"
FT                   /translation="MRRRTAPPTGGPMAPEPKRPHVAPDDDDHPLEAPEADVADQRISD
FT                   DEEETPLELELDRGWEVPEADAVEQALEVPEDEDDYR"
FT   gene            586794..587954
FT                   /locus_tag="Tfu_0520"
FT   CDS             586794..587954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0520"
FT                   /product="Rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54558"
FT                   /db_xref="GOA:Q47SK9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54558.1"
FT                   /translation="MSLPPLVEPADELTIDEVQRYSRHLIIPDVGMDGQKRLKNAKVLV
FT                   VGAGGLGSPTLMYLAAAGVGTLGIIDFDVVDESNLQRQVIHGQSDIGKPKAESARETIE
FT                   EINPFVKVVLHKERLDSSNALEIFADYDLILDGTDNFATRYLVNDAAVLLNKPYVWGSI
FT                   FRFDGQVSVFWNEYGPNYRDLYPEPPPPGMVPSCAEGGVLGVLCATIGSVMANEAIKLI
FT                   TGIGDPLVGRLLIYDALEMTWRTVKIRKDPNAEPITELIDYEAFCGTIPEEAQEAARGS
FT                   TITAKELKEKMDRGEDFFLVDVREKNEYEIVNIPGAVLIPKGEFLTGEAFAKLPQDKQI
FT                   ILHCKSGGRSAEALAAVKKAGFSDAVHVGGGILSWIETVDPSLPKY"
FT   gene            588077..588472
FT                   /locus_tag="Tfu_0521"
FT   CDS             588077..588472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54559"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54559.1"
FT                   /translation="MGGQWDNWVALAAGIVVGLSWVWHGLFGLGMVVLFLLGLATVLTA
FT                   VLSLTRPGMLSSEAVLIGIGVLLVLTPWLFGFTGNLAAAWTAWVAGVVIAVTGAVGLVR
FT                   SWRSHGTQEPRGPSGSATRSPTMRALT"
FT   gene            588524..588850
FT                   /locus_tag="Tfu_0522"
FT   CDS             588524..588850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54560"
FT                   /db_xref="GOA:Q47SK7"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54560.1"
FT                   /translation="MPLPDDYVERVLHVVESIPPGKVMSYGDVAEYLGEGGPRQVGSVL
FT                   ATWGGAVPWWRVVRADGSPPKGHEVAALAHYAAEGTPLRRGVARVDMAQARWDGKHAAE
FT                   QVDP"
FT   gene            589304..592438
FT                   /locus_tag="Tfu_0523"
FT   CDS             589304..592438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0523"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54561"
FT                   /db_xref="GOA:Q47SK6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54561.1"
FT                   /translation="MDNPPYRLVRRIRHRAPAPELDDDQRRVVDHEGGPLLVLAGPGTG
FT                   KTTTIVEAIVDRVENRGVDPAHVLVLTFSRKAAQELRERITARLRRTVREPLALTFHSY
FT                   AYALIRREFQRVGDHAPRLLSGPEQLMEVRELLKGELADGAPGWPEQLRPMLHTRGFAE
FT                   ELRDFLMRVQERGLHADDVRELGRRHGREDWVAAGGFLERYTGRFDIAPVPTFNYAELV
FT                   RVAANLLNDPDIQARERAARKVVFVDEYQDTDPAQEELLHALAGDGRDLVVVGDPDQSI
FT                   YGFRGAEVRNILNFPDRFRTPTGDPAPVVALHTCRRSGAELLRVSRALAQRLPAVPGPG
FT                   GEGVNAHRNLVPAEGTPPGRARMLLAESPVHEAAVIADLLRRAHLIDGVPWSRMAVLVR
FT                   SVTRHVPVLRRALIAADVPVTVDGDDLPLASEPLVRSMLLLLRCAFHPERLDEEAAHNL
FT                   LTSAFGEADALGLRRLGRALRQLELDAGGRRPAAALLAEILHDPRDLVMVDPEVRAPAE
FT                   RIATLLRLVRDSIAEGANAEEVLWRMWHHSGLADTLLRASQAGGRHGAAADRELDSVMA
FT                   LFERAARYCDRLPPGSPEGFLEDLEAQEIPGDTLAEQAPQGETVRILTAHRSKGLEWDL
FT                   VVVAGVQEGTWPDLRLRGSLLGVEQLLDTVGGFAETSPAAVVSKQLDEERRLFYVALTR
FT                   ARRELVVTAVGGEDVEERPSRFLTELGLGEPERLATGYRWLSLPALVADLRATLLDPHT
FT                   DEPVRRAAAAHLARLADAGVRGADPAEWYALTELSDSSPLVLEGEQIRISPSQVEKFTT
FT                   CELRWLLETAAGAEKRRAASGIGSIVHALARIAAENPDLPELLRRMDQIWSDLDFGGPW
FT                   YAEKQRERAEEMLQRFLDWQKENPRELVATEKKFRVEVGNIEISGQVDRLERDAEGRGV
FT                   IVDIKTGTAVPDREISRHPQLGVYQLALLMAAFEHYGLVEPGGAALLQIGDRKTAKEQT
FT                   QPALADDADPEWPQRLVQKVAAGMAGARFRAKATPSCRHCSVRASCPVQSEGDHV"
FT   gene            592553..595879
FT                   /locus_tag="Tfu_0524"
FT   CDS             592553..595879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0524"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54562"
FT                   /db_xref="GOA:Q47SK5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54562.1"
FT                   /translation="MTDVYGPAQLARLLGLPEPTPEQAAVIAAPLRPGLVVAGAGSGKS
FT                   ETMAARVVWLVANGHVRPEQVLGLTFTRKAAAELAERVRKRLDQLRGAGVVPDDVLDGE
FT                   PTVATYNAYATRLVGDHALREAIEPTTRIITPAIAWQFVHRVVSTYDGPMDAVTSAPAT
FT                   VVHDVLALAQELAEHLCTPDDVRAYGDWLRERAAQLKKTPALVRDLLAVQRHREQLLPL
FT                   LEQFAQLKAEREVMDYSDQVALAARIAQRHPEVGRIERERYAVVLLDEYQDTSHAQLVL
FT                   LQSLFGNGHPVTAVGDPCQSIYGWRGASAGNLSRFPVDFPEKPDRPAPVRQLSTSFRNG
FT                   ERILEVAKRIAEPLRAAARDVPVLYPGPARAGRGRVTCALLRTETEEAEWIAEQIDRAL
FT                   RESAEHHTAPDGLPWPEQEHRGPLSYGDIAVLCRKRAQFPVIRRALEERGIPVEVVGLG
FT                   GLIEVPEVRDIVATLRVLHDPTAANELARILTGPRWRLGPRDLVALNQRAKELAEEARR
FT                   DLRGEAAEARVDEEDPLRQTVLDLTAEAGSLLDALDDLGPPERYSATGYQRLQALSEEL
FT                   RTLRTRISQPLPDLIMEVERVLGLDIEVGARPGRDQSAARADLDAFVDAAVRFSGSTDT
FT                   PTLSAFLAYLTSAEDTEHGLEPGERVGSSNTVKLMTVHAAKGLQWPMVVIPGLSRGQFP
FT                   GVPKTVKGWTGKAASLPFALRGDRDSLPELADVTVQEIKQFTAAERARELMEQRRLAYV
FT                   AVTRAAFSLVCTGHWWGQETQRSRGPSEFLEEIREVCETGVGQVALWTDPPDEGEPNPQ
FT                   LVADNSVVWPPQTDERRDAAERAAALVARYRNGEWERELALMNRALLRPAANRRIRDWA
FT                   RDVELLLRHRDQEEGAPRVIEVELPDHLTVSALVSLARDPAALAQQIRRPLPRPPAPHA
FT                   RRGTAFHTWLERRFGQETLIDPHELPGAADETATGDADLDELQRQFEQSVWADRVPLEV
FT                   EVPFETIIGDRLVRGRMDAVFHDPEDDVYEVVDWKTGRLPATERERRAAAVQLAAYRVA
FT                   WARIADIPLERVRAAFHYVRANVTVYPEDLLDADGLAALIAAVPQPSVPGEAAEGATGD
FT                   R"
FT   gene            596490..597242
FT                   /locus_tag="Tfu_0525"
FT   CDS             596490..597242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54563"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54563.1"
FT                   /translation="MKGTVQLDERPDTAQRTSDRKIRSGGLAQRLNALRAGVLGANDGI
FT                   VSTAAVVVGVAGATTDAGPILMAGLAAAVGGAVSMALGEYVSVSSQRDSERHLIEQQSQ
FT                   ALRNDPEGELLALARSYEERGISAATARRAAEELFASNALEAQMRERHNIDPDEVTSPW
FT                   HAAIASFLAFAVGALLPLLAILLPSPELRVPVAFGATLLSLALTGAIAAGIGGGSQLRA
FT                   AARVTLGGALALAVTYAIGSLIGTTGLV"
FT   gene            597347..598741
FT                   /locus_tag="Tfu_0526"
FT   CDS             597347..598741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0526"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54564"
FT                   /db_xref="GOA:Q47SK3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54564.1"
FT                   /translation="MDVRAHIEAHRDEFVATLSQWLAIPSISADPAHHDDVRRSAQWLA
FT                   DHFTQTGFPTVEIWETPGMPAVFAEWPAADPEAPTVLVYGHHDVQPVDPVDAWHTDPFT
FT                   PTVRGDQLVGRGASDDKGQILFHTLGLRANLAVSGADAPPVTLKFLIEGEEESGSPHFA
FT                   DLLTRHRARLACDVIVISDTTMWSADTPSMCMGMRGLTDCQIDVYGPRTDLHSGSFGGA
FT                   VPNPARALAALLAGLHDAHGRVAIPGFYDDVVEASQAERDTIAQLPFDEAAWLANAGSD
FT                   ATVGEAGYSILERVWLRPTAEINGMWSGYTGEGSKTIVPRSAHAKLSFRLVPNQEPARI
FT                   QELVRRYVHDNLPPGVRADVRFSGAGVRPCASDLDSVAVRAARDAMAKAFGTKVYSTRE
FT                   GGSGPEADLADILGAPLVFVAVGLNSDRIHAPNEKVEIPLLLKGAETVAYLWDSYATVL
FT                   RSGDRA"
FT   gene            598738..599718
FT                   /locus_tag="Tfu_0527"
FT   CDS             598738..599718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54565"
FT                   /db_xref="GOA:Q47SK2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54565.1"
FT                   /translation="MTGRPFTPALARSTLDRAADRRRDERWLADAWADARTRVLLLDHG
FT                   DPQRHGRRNPGGIPLRFLVTASTPTPELVFCSPEQAPEGERYLLGEDSDGTVYFAVRLK
FT                   PGKELPAAPGTQPVSLRRVGALLNARDAGLATHAAALAHWHAEHGFCPRCGSPTRIESA
FT                   GHVRVCDNDGSEHFPRIDPAVIMLVHRETDAGEQCLLAHNPAWPEGRYSVLAGFVEPGE
FT                   SLEHAVVREVAEEVGILVTDPVYLGSQPWPFPRSLMVGYLARAVGSAPRTDHEEIADIR
FT                   WLTRHELGEAVTRGEILLPGPVSIAHQLIEHWYGQPLPPGRWASR"
FT   gene            complement(599745..600239)
FT                   /locus_tag="Tfu_0528"
FT   CDS             complement(599745..600239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54566"
FT                   /db_xref="GOA:Q47SK1"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54566.1"
FT                   /translation="MGVHTSVRRGHDCEGHNRGTLIRRAPQGWRVDGTEEQLPDLLNAM
FT                   ILADLLAGGTPPTDLPTPPRATPDSSETERLRVTVQQLEHALRTRVVVEQAIGVLAERH
FT                   RIAPRTAFERLRRAARCRGKKVAALAHEVVESTRNPLVALPEELAREGSAVQAWPPKRA
FT                   S"
FT   gene            complement(600309..600569)
FT                   /locus_tag="Tfu_0529"
FT   CDS             complement(600309..600569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0529"
FT                   /product="Glutaredoxin-like protein GlrX"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54567"
FT                   /db_xref="GOA:Q47SK0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011915"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54567.1"
FT                   /translation="MATSTGAQITMYTTPWCGFCKRLKSQLDREGIPVVEVDIERDPKA
FT                   AEFVMQVNGGNQTVPTVVFADGTALTNPSLAEVKQKLAAQS"
FT   gene            600855..602993
FT                   /locus_tag="Tfu_0530"
FT   CDS             600855..602993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0530"
FT                   /product="superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54568"
FT                   /db_xref="GOA:Q47SJ9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54568.1"
FT                   /translation="MGPAESGEPWGRMPSAEEILRGLDPEQEEAVRAVRGPVCILAGAG
FT                   TGKTRAITHRIAYAVATGVVPEQQILAVTFTTRAAGEMRGRLRALGAPRVQARTFHAAA
FT                   LRQLSYFWADAVGGPKPTLIDSKIKTVAAAAHSCGFQVDRTELRDLAAEIEWAKVTQTR
FT                   PTDYETAVAKEGRTPPMPPRDVARVYEAYEELRSEHNLLDFESMLELTVAMIHERPDIA
FT                   ERIRSQYRYFVVDEFQDVNPLQKLLLDAWLGDRDDICVVGDPNQTIYTFAGATPSYLTG
FT                   FPEVYPHATVVRLVRDYRSTPQVVRVANAVLRSGGAAALSPDYRMELVAQRPDGPEPTY
FT                   TEYDDDLAEATAVAEKITGLINAGTPAREIAVLFRTNSQSATYEQALADAGVPYTVRGA
FT                   AQFFDRPEIRAALHTLRGASRADDGESLVTTVRHLLQPLGLTEQPPEGRQAREKWESLA
FT                   ALAQLAETIAAQRPEARLADFVAELHTRAATEHAPGFDGVTLASLHAAKGLEWDAVFLV
FT                   GLTEGLLPIIYAETPEQVEEERRLFYVGVTRAREHLHLSWALARSPGGRRTRTPSHFLD
FT                   GLRPAAAAPARQHRERHRKKDRMVRCRVCGATLLEAVERTLGRCQDCPASVNEELLERL
FT                   RHWRREAAALQKVPAFVIFTDATLQAIAEQEPSTAAQLARISGVGERKLRRYGEAILTL
FT                   CAGGTPEQAISGLREETP"
FT   gene            602990..603889
FT                   /locus_tag="Tfu_0531"
FT   CDS             602990..603889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0531"
FT                   /product="acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54569"
FT                   /db_xref="GOA:Q47SJ8"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54569.1"
FT                   /translation="MSGPPDHEGSPAIGAGEEGLRELLDILDLEQIEVNIFRGRSPAEG
FT                   PQRIFGGQVAGQALVAAGRTVAEDRFVHSLHAYFIRPGDPSVPVIYEVDRVRDGKSFTT
FT                   RRVTAIQHGKAIFTLSASFHRTEPGLSHQVPMPQVPPPEELPTMQERLIHVLGRVPRSA
FT                   EWHPFERRPVGPLSYEVQQDPSLIRTENPIWIKVNGKVPDDPLLQVCLMTYASDMTLLD
FT                   TVLLAHGRTFSGVFMASLDHAMWFHRPFRTDEWLLYAQETPVASGARGLARGLVFTRTG
FT                   ELVCSVVQEGLIRIVDDA"
FT   gene            604501..604782
FT                   /locus_tag="Tfu_0532"
FT   CDS             604501..604782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0532"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54570"
FT                   /db_xref="GOA:Q47SJ7"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54570.1"
FT                   /translation="MLASVLGSPWLEGVEIPCRSQPDLFFAESPAEVEAAKALCVDCPV
FT                   REQCLAGALERREPWGVWGGQLLVSGKVVARKRPRGRPRKNQTEPIAA"
FT   gene            605184..605816
FT                   /locus_tag="Tfu_0533"
FT   CDS             605184..605816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0533"
FT                   /product="similar to metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54571"
FT                   /db_xref="GOA:Q47SJ6"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54571.1"
FT                   /translation="MQSTSPRGQLDLPCDVRHCWATVATVPREPQIEVRRSSRRRRIVS
FT                   AYRSGNRTVVLLPTGLSHTEEQKWVDLILQRLRSREAYRHPSNLALHTRAVELAERYLD
FT                   GKVRPSSVRWADDPRIRWGACKPAEKTIRIAHRLAGMPGWVLDYVLMHELVHLIVPGHG
FT                   PEFWRLVNRYPHSERARGYLEGFTDAPRLLTAEHSHTTEPDEHPAHD"
FT   gene            complement(606046..607305)
FT                   /locus_tag="Tfu_0534"
FT   CDS             complement(606046..607305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0534"
FT                   /product="Deoxyribodipyrimidine photo-lyase type I"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54572"
FT                   /db_xref="GOA:Q47SJ5"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54572.1"
FT                   /translation="MSTTVVLFTRDLRVSDHPALHAAVTEADRVVPLFVVDPALVRVSA
FT                   RNRIAYLLEALAELRGLLRERGGELVVRQGDTVAETVRIVAEAGAQAVYLSADVSAAAV
FT                   RRARQLTEAVRAAGAHVRTFPGVTVVPPGALRPAHGDHYQIFTPYLNAWRAAQWRSPRP
FT                   APERVRLPEGLVPGPLPGAELIRLGTGVLAPQREQGGPRTARERIRAWLAQPNQDSRFG
FT                   CHLHFGCLSPLEVALVAREHPRGALLLRQLALRDFHHQVLQAFPRLPRADYRPRPIQWR
FT                   DDDSAFAAWCSGRTGVPIVDAGMRQLLWEGYVPGRIRMLTATYLTQVLRIHWKRGADHF
FT                   YSLLVDGDVANNYGNWQQIAGTGGVPRPARRINLYRQAERYDPSGDYVRRFVPELRSIS
FT                   GSAVHHPPVPRPGGYPPPLR"
FT   gene            complement(607424..607981)
FT                   /locus_tag="Tfu_0535"
FT   CDS             complement(607424..607981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54573"
FT                   /db_xref="GOA:Q47SJ4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54573.1"
FT                   /translation="MSLHADARAVLASWTAPDADQERLRRAYLDHLDRYPDAMWRSCLP
FT                   GHLTASAAVVDATGQRVLLTLHRKIRLWLQLGGHCEPGDSSLAAAALREATEESGIAGL
FT                   RLLPTPVRLDRHAVPCGGGSWHLDVQYAAVAPPGAEPVVDPAESDGLAWFEVTALPEPS
FT                   DDACRALVAAAVQRVRAAAAAG"
FT   gene            complement(607978..609381)
FT                   /locus_tag="Tfu_0536"
FT   CDS             complement(607978..609381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54574"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54574.1"
FT                   /translation="MNDLPFGFSMSNGPDDESGRGPNDSGSGAGQGGSGGGFPHMPPGG
FT                   FPFGDPQQFAQMLRQFADMMSAAQPTSGSGQDSGASGINWAAATNIARHVVSQHGDPSI
FT                   GPVDYARVQEALRLADLWLNEVTALPSGLHTMEAWSRSEWVEKTVPTWTKLCEPLTGRV
FT                   VETMGQNLPQEMAAVAGPLLGMFRQIGGALVGQQVGQAIGELAREVVGSTDVGLPLAGE
FT                   GRAVLLPEGVREFGEGLGVPLDEVRLYLAAREAAHHRLFRHVPWLRSHLFALVEEYAAG
FT                   MSFDISGFEKQLGHIDLTNPESLQEALSSLEGQGLFQTEDTPRQKASLARLETALALIE
FT                   GWVSTVVDAAVSQRLPQAAALGEALRRRRASGGPAEHTFATLVGLELRPRRLRDAAKLW
FT                   QALTEARGIDGRDAVWEHPDLMPSGEDLDAPDDFVRGSASSPDLDLSQLTEEPSEERRD
FT                   GDDEDKGER"
FT   gene            609443..610564
FT                   /locus_tag="Tfu_0537"
FT   CDS             609443..610564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54575"
FT                   /db_xref="GOA:Q47SJ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54575.1"
FT                   /translation="MNTQSGQVRPQHSQMSEGLVVAVTGAASGVGRLLVERLLTGEGSR
FT                   KISRIIGIDSRRGDIPGVSWHVADVCDPRLATLLAGVDVLVHTADDRSLETPRRQRRTH
FT                   NIRSAQTVLTAAAAQRVPRVILITSTMVYGADPNNEVPLDETLPFRSEVDTGLVGDFVE
FT                   IEELAALARRAHPGLSVTVLRPAPLVGPGMDTLLSRHFSAPRLLTVKGCTPKWQFCHIE
FT                   DLASALDFVVRAETEGKGGALAVGCDGYLDHAEVEEIAQLRSFELPANLAFGTTQRLHR
FT                   LGITPAPASELKFLVYPCVVDCATLRNAGWRPAYDNVAALRALLESRSGTPALVGRNLG
FT                   RKEVTITAAGAAGAVAAIGTAVAAHHLRKRRKN"
FT   gene            610631..611062
FT                   /locus_tag="Tfu_0538"
FT   CDS             610631..611062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0538"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54576"
FT                   /db_xref="GOA:Q47SJ1"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54576.1"
FT                   /translation="MEAIALAEIRTTPLSVDEVLAAVKDDRAGGTAFFVGTVRNHDHGR
FT                   DVAALSYSAHPTAEQRMRDVMEKIVADTADGTVHRVAAVHRVGDLTVGDLAVVVAAAAS
FT                   HREEAFTVCRRLIDDIKAEVPIWKHQTFTEGDSEWVGAY"
FT   gene            611119..612162
FT                   /locus_tag="Tfu_0539"
FT   CDS             611119..612162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0539"
FT                   /product="secreted protein containing a PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54577"
FT                   /db_xref="GOA:Q47SJ0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54577.1"
FT                   /translation="MVRRAMTLLTSAVLLVGLTVAALAIPVPYVVASPGLALNTLGEID
FT                   GEQVIRIEGQPVYEHDGALSMVTVQYSGGPDSRMNLFTTLSAWLSPTQAVLPEEAIFPP
FT                   NTSAEEVSQTQAAQMDNSQDAAVAAALNELGIDYETTATVHAVNEGYPAEGVLQSGDVI
FT                   VEVDGKPVADKNEVVAAVKDRSPGDTVRFLIERDGQREEVEVGTVASDSGDPIVGITVE
FT                   DTMVFPFEVQISVGRVGGPSAGMMFALGVMDRLDPEGLTGGHRIAGTGTIDPEGNVGGV
FT                   SGVQQKMISAKREGAEYFLVAAESCDQTFDSPVTGQIEVVKVETLKDAVAALENIREGN
FT                   LDDLPRC"
FT   sig_peptide     611119..611193
FT                   /locus_tag="Tfu_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.851 at
FT                   residue 25"
FT   gene            complement(612208..612732)
FT                   /locus_tag="Tfu_0540"
FT   CDS             complement(612208..612732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54578"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54578.1"
FT                   /translation="MSFNLREAVLGLERHAAKQGWDQPVRMYALVPTAELVQREPHLAE
FT                   LLGISEEADPSGLTPVEQEPLPSDMPLEEVLGRIMWPETVAGCALVMERLVVRGSDETL
FT                   DPPRDGDTAAWAQAQPGAEEVRMVAGVLRDGSRYSALRMRSYDSDDQVLNGEDLIPGLT
FT                   SALTLTFEEDH"
FT   gene            613064..616120
FT                   /locus_tag="Tfu_0541"
FT   CDS             613064..616120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54579"
FT                   /db_xref="GOA:Q47SI8"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54579.1"
FT                   /translation="MSFRSPGAPTARMPRRSRLLAPVGAAVVVIIAGIMFAANFWTEYR
FT                   WFGSVGYTTVFWTELRTRALLFAGGALLMALAVGLSVYFAYRTRPAYRPFSLEQQGLDR
FT                   YRSSIDPHRKVFFWGLVGGLALLTGASATAEWQTFLQFANATKFGAQDAQFGLDISFYT
FT                   FTYPFLQVIIGYLYTAVVIAFIAGVVVHYLYGGVRLQAQGQRVTPAARVHLSVLLGVFL
FT                   LLRAADYWLEQYGLVFSNRGYTFGASYTDVNAVLYAKIILFFIALVCAVLFFANIYFKN
FT                   ARVPLVSLGLMVLSAILIGGVYPAIVQQVTVSPNEQRLERPYIQRNIEATRAAYGIDGA
FT                   EVIDYDAQTELTTAELAAEAETIPSVRLVDPAVVSQTFQQLQQVRGFYQFPQVLEVDRY
FT                   TTSDGETVDTIVAARELDGPPSQEDRWLTRHLVYTHGFGMVAAAGNQVDSEGRPVFLEY
FT                   NIPPTGELSQVGEGYEPRIYFGREGAEYVIVNAEAEYDYPVDPDTPEVPTTEDAVVPTP
FT                   SPSPEADEAPAPADSREEGSAQEQQDQEGQDGGEDAQGTEEEQSGQGSGQANNYYDGKG
FT                   GVQLKSFFDKLMYALKYQEINILLNNAISNESQIIYVRDPAERVEKVAPFLTVDGKAYP
FT                   AVVDGRIVWIVDAYTTSDRYPYSTPIDLAQATTDTFTESTTAVNALPGNRVNYIRNSVK
FT                   ATVDAYDGTVTLYGWDEEDPVLQTWSKAFPGVVTSKDEISDTLLSHLRYPDDLYKVQRE
FT                   ILERYHITNADAFYGGQDFWTVPNDPKPQAGNNPEPPYRQTIRFPGDDTPTYSLTSTFV
FT                   PRGRENLAAFMAVNSDASSEDYGQMRILELPRSTAVQGPGQIQNTFQSSAEVREVLLPL
FT                   EQSSAQVTYGNLLTLPFAGGLLYVEPLYVQAGGSDASYPLLQQVLVGFGDQVAIGSNLQ
FT                   EALNNLFDGDEAPLEEPTTDGEAREEEEQPQASSDLAQALEDAAEAYEEGQAALREGDF
FT                   AAYGEANERLKEALDRAKAASGSNEEKDE"
FT   gene            616275..616351
FT                   /locus_tag="Tfu_R0012"
FT   tRNA            616275..616351
FT                   /locus_tag="Tfu_R0012"
FT                   /product="tRNA-Met"
FT   gene            616612..616688
FT                   /locus_tag="Tfu_R0013"
FT   tRNA            616612..616688
FT                   /locus_tag="Tfu_R0013"
FT                   /product="tRNA-Met"
FT   gene            complement(616786..617592)
FT                   /locus_tag="Tfu_0542"
FT   CDS             complement(616786..617592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0542"
FT                   /product="histidinol-phosphate phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54580"
FT                   /db_xref="GOA:Q47SI7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54580.1"
FT                   /translation="MAAFDDDLRLAHVLADAADDISLRLFRSLDLKVDTKPDLTPVTEA
FT                   DRAVEETVRSILSRARPRDAVVGEEYGTSGNSARRWVVDPIDGTKNYVRGVPVWATLIA
FT                   LLEGDQPVVGVVSAPALNRRWWASKGGGAWSGRSLAKATRCRVSAVSRLEDASLSFSSL
FT                   TGWEEQGRLDYFLDLTRSVWRTRAYGDFWSHVMVAEGAVDLSMEPELSLWDAAPLPLIL
FT                   EEAGGRATSLNGGPFTDGGALVCSNGLLHDAVLTQLNGGPIPLRRT"
FT   gene            complement(617659..618720)
FT                   /locus_tag="Tfu_0543"
FT   CDS             complement(617659..618720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54581"
FT                   /db_xref="GOA:Q47SI6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54581.1"
FT                   /translation="MRDGRYLDIDEDDVRVRARGGSRPRTRKRPKHENARLGFVTAVNR
FT                   GRYQCLVGDLSVVAMKARELGRGSIVVGDIVALVGDLSGRPGTLARIVRVEKRSSVLRR
FT                   TADDTDPVERVIVANADQMVIVTALADPDPQPRFIDRCLVAAYEAGLDPLLCLTKSDLA
FT                   SPDALLDIYAPLGLRWVVTRRDGDLSALREQLMGRISVLVGPSGVGKSTLVNLLVPEAR
FT                   RAVGDVNVVTGRGRHTSTSAVALPIGAPASAESVERLHAAREGRIDRSELDYGWIIDTP
FT                   GVRSFGLAHVTPDDLLAAFPDLDDAVADCPDHCSHLGDGCALDEWLARGELNPARVTSF
FT                   RRLLASREGELER"
FT   gene            complement(618717..619991)
FT                   /locus_tag="Tfu_0544"
FT   CDS             complement(618717..619991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0544"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54582"
FT                   /db_xref="GOA:Q47SI5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54582.1"
FT                   /translation="MAETASHWPAPTVSRPVDATVSLPGSKSMTNRALILAALSETPSV
FT                   VRAPLYSRDTTLMVGALRALGIGVHEADGDWEVTPTPPQGPAAIDVGNAGTVMRFVPPL
FT                   AAMARGEVSFDGDPRARERPVGPLLAALRTLGAEIDDGGRGALPMVIRGRGELPGGTVT
FT                   LDASGSSQFVSALLLSGARFSKGVEVRHVGPPVPSQPHLNMTVQMLRDAGVEVDTDTPD
FT                   VWRVAPGPIRVTEITVEPDLSNAAPFLAAALVTGGRVTVRGWPRHTTQPGDALRTLFAE
FT                   MGGRVEFTDEGLTLHGTGEIRGLTADLRDVGELTPTIAAVAALASTPSRLTGIAHLRRH
FT                   ETDRIAALVREINRLGGDAEELPDGLVIRPRPLHGGVFHSYDDHRMATSGAVIGLVVPG
FT                   VEVENIATTGKTLPDFPRLWSEVLS"
FT   gene            complement(620223..620750)
FT                   /locus_tag="Tfu_0545"
FT   CDS             complement(620223..620750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54583"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54583.1"
FT                   /translation="MGILRTQARRLLGVPFIMDGVSVLRDPTPRAQQLAPLIRNLALRY
FT                   PSVPNAPEALARLHGIIGVLGGALLCFGRAPRTACALLAVQSVPTVLTELRTFREGRPD
FT                   DLGGHRAATAKDLSLLGALVLSATEPKRKRCSRKHRQQTTGMVQHLRAMPQRPRGRRQA
FT                   SPLPVPIPRPRR"
FT   gene            620917..621774
FT                   /locus_tag="Tfu_0546"
FT   CDS             620917..621774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54584"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54584.1"
FT                   /translation="MCGRYALGRKKEEIRRVFGLPESEVDAPGADEARRWPPREELAPD
FT                   YNIAPGKHAYAVLGRAPGEPVSGAAGPRHLVTLRWGLVPSWAKDSNVGYRMINARAETV
FT                   TDRPAFRAAFARRRCLLPADAYYEWQLLHTSGEAQPGTSPVTDPEHRSRKAKTRKRPFA
FT                   VRYADDRPLALAGIFERWRDPAVPEEDPAAWLWSFAIITTEAAPELAHIHERMPVVVGE
FT                   EDWATWLDPEADRDDLLSVLDATPVEDFTVYPVGTEVNAVRNNGPHLLVPVSAESEGTS
FT                   ETLF"
FT   gene            complement(622034..622897)
FT                   /locus_tag="Tfu_0547"
FT   CDS             complement(622034..622897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54585"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54585.1"
FT                   /translation="MCVRLTGSAPQPATSPLPADSPADRSISRLTASHLVTAGSPSAYW
FT                   RFYWAVAAAQLSRWLPREPGRLLDLSGPGYRATSRAVAAGHDVLVLLPTADSTPKRTLS
FT                   LVNGHAPVRSERRPGRLSQVVGDTALLSGVASAVFDGVIADNRMLSHQLATEACLAEIA
FT                   RVLRPGGRVLLCVDSVVLGMSVLAEQDCWPELSYAPNADVLLVPWPDGTITRCFTSEQL
FT                   RELLTEAGLDVEWIRPRTVLSASTVEKVLAERPRALNRLVEMELKAAESGEDVSMHLVA
FT                   SARKPE"
FT   gene            623197..623967
FT                   /locus_tag="Tfu_0548"
FT   CDS             623197..623967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0548"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54586"
FT                   /db_xref="GOA:Q47SI1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54586.1"
FT                   /translation="MPASVGTLLRERSVTATGMARVRFEPLQPYGEVAVATGENRARRP
FT                   TGLSQSQETIEDRAARFERDAMPLLDQLYSAALRMTRNPTDAEDLVQETFTKAFGSFHQ
FT                   FKEGTNLKAWLYRILTNTFINSYRKKQREPRQAGTEDIEDWQLARAASHTSSGLKSAEA
FT                   EALEHLPDTDVKRALQELPEDFRIAVYLVDVEGFAYKEAAEIMDTPIGTVMSRLHRGRR
FT                   QLRSLLEEYALERGFLSVAERESVGAVNGGKDQR"
FT   gene            623964..624248
FT                   /locus_tag="Tfu_0549"
FT   CDS             623964..624248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0549"
FT                   /product="anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54587"
FT                   /db_xref="InterPro:IPR014295"
FT                   /db_xref="InterPro:IPR024020"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SI0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54587.1"
FT                   /translation="MSGEEPYATPCSEVLDKVYAYLDGELEEANCAEIRRHLDECAPCL
FT                   REYGLEEAVKKIVAKCCGCDPAPAQLRARLMEQLAQARAAMRGREAVAE"
FT   gene            624859..626388
FT                   /locus_tag="Tfu_0550"
FT   CDS             624859..626388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0550"
FT                   /product="metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54588"
FT                   /db_xref="GOA:Q47SH9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54588.1"
FT                   /translation="MLPRLPDGPGGRSGSLQPWRNGRLQNDEKERELRALPVAARLYVG
FT                   LVALGAATAILLGVFLGPITEVDLGTLLLLAILFVIAESIATMVDSGKTGISPASAASL
FT                   AAVVLVGPVGAAIVGIASGLVIRRQNLVKRLFNGAQFVIAGYASGTVFQLLGGRMGVPE
FT                   PEMFPWILLPFTGAVLTFSLCNTLLMAGLMWSLGELRLKRPRHMRWRPLATLELSSIGY
FT                   AMLGLFIAAIWGAVGPFAVLLVLLPLFIARWAFDQYVFQQRAHEATLATLCQAVETKDY
FT                   YTRGHCMRVAKAAAMIAEELGMSAERVQTMRYAGMLHDIGKLGVPTKILQKAGKLTEEE
FT                   YAAIQLHPMRGYEIVREIDFLDEALAGILHHHERIDGGGYPKGLAGEDIPEAARLVSVA
FT                   DVFDCLTSTRSYRKAWSTEAAIAELRRCAGTQFDPRMVEALVRAVEREGWEVPDLVEPV
FT                   EDACEPCTAQPVGASEAAPETVPTGAAQTAADGDTQTDTNLTVGVVEETTG"
FT   gene            626385..627707
FT                   /locus_tag="Tfu_0551"
FT   CDS             626385..627707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0551"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54589"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54589.1"
FT                   /translation="MMNSAPTVASHIPQRARHGRQWRAVGWTRPLLIGAALVSTAVSLL
FT                   WTAVSGFEQPRVALAFGVLVALGEFARITLPGGREAAPIATASAMSYAFLFTIIGDPVS
FT                   LPSPQVVAVVAVGMGLGELPHILVGRHPQWGDLARRFLNIAVTTLLFRPLIGHIDLDGP
FT                   LWWLSLLLMAAIVVVVWLADSVAAAAIRADRMRTRFGVTLRDEMRAQVAIGMAVGASAI
FT                   LMALSVHVMGLTTLLVFTAPLLVTQVAFRRFAQIRRTYLQTVRALSRVTEVGGYVEAGH
FT                   SRRVSRLAQGIGRELGMSESTLLELEYAALMHDIGQLSLRDPIPSGATVLASPREQRSI
FT                   AELGAAIIRETGVLDGVAELVRRQCEPYLGDGEAGPPPLGSRIIKVANAFDDLVGGSTD
FT                   QERVDAVLQRLRMDTGHEYDPVVVEALATVLQRPDFDWRSG"
FT   gene            627868..628254
FT                   /locus_tag="Tfu_0552"
FT   CDS             627868..628254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0552"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54590"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54590.1"
FT                   /translation="MAIDPGLTGTAELTVTTADTAEALGSGDVPVLGTPRVLALAEAAT
FT                   VAALDGRLEAGHTSVGAEVHLKHTAPTPVGAQVVATARLVRAEGRRLVFEVSVTQEGRQ
FT                   VAVGTVERVVVPRERFLSGLRPGE"
FT   gene            complement(628267..629928)
FT                   /locus_tag="Tfu_0553"
FT   CDS             complement(628267..629928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0553"
FT                   /product="acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54591"
FT                   /db_xref="GOA:Q47SH6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54591.1"
FT                   /translation="MGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGA
FT                   VKADPPMRLLDVRHEQTAVFAAEAVGKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSP
FT                   LVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWTVHDTAQIGPALDEAFTLANTAHR
FT                   GPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAERPVLVYGSDVWL
FT                   DHAEQAALEAAEELGVPVVTNGQGRGVLPAGHPLLATRARGLALGRADLVIVVGTPLDF
FT                   RLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREV
FT                   AQWRTEVAEAAAATAAKDREVLDSDASPIHPARIYGELNRILDDDAVVIGDGGDFVSYA
FT                   GKYIQPRRPGNWLDPGPFGCLGTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTL
FT                   VRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDVLADLAPQTRYDQVVTALGGGGELVTDP
FT                   AEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGV"
FT   gene            complement(630064..630810)
FT                   /locus_tag="Tfu_0554"
FT   CDS             complement(630064..630810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0554"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54592"
FT                   /db_xref="GOA:Q47SH5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54592.1"
FT                   /translation="MTGQRTVEDSPRVPKYYQVKKQLLQLIETMPAGNPVPPERTLATQ
FT                   FGTSRTTVRQALSEMVVEGRLLRIQGKGTFVAKPKVTQVLQLTSYTQEMRSHGLQPDTR
FT                   ILDVGYINADEELAGLLAIRLGGRVLRIERLRLANGEPMAVETAHLPARRFPGLRRRLD
FT                   RHASLYEALATVYNVHLAEAEATIETVLATPKEAQLLGVDVGLPLVLHCQHSFDDEGNP
FT                   VEWVRSLYRGDRYKFVTRLRPPKERT"
FT   gene            630975..632540
FT                   /locus_tag="Tfu_0555"
FT   CDS             630975..632540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0555"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54593"
FT                   /db_xref="GOA:Q47SH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54593.1"
FT                   /translation="MPHLSDLIRRYTALSTADLEWLHALVSDWQLLADLSFADLLLWTR
FT                   LREDNGWIAVAQMRPTTGPTAYQDDLVETILYDAPATPGEEDPVPPPMRSKRALIDRAW
FT                   REGRVCREGDPDWSGGVPVREETIPVRREGTMVAVIQRSTNLSAARTPSRLELTYLQSA
FT                   SDLAQMIAEGSFPFSDQGPLMVRSPRVGDGLLRLDREGRVIYASPNALSAYRRLGLATD
FT                   LVGTSLARTTVELADDPDPRDESLSWTAGGRVPLEAEVEARGTTVQLRAIPLIVGGERI
FT                   GALVMVRDVTELRRRERELMTKDATIREIHHRVKNNLQTVAALLRLQARRLQNPEGRAA
FT                   LEEAVRRVGSIAIVHEMLSHTPDETVDFDDIADRVIEMAAEVSSTDKAVVGLRRVGNFG
FT                   MLSALVATPLSMVLAELVQNAVEHGLEYGPGTIEVRVRRQAPAPGPDDGRRSTGRLIIE
FT                   VVDNGTGLPADFDLETSSSLGLQIVRTLVTGELAGRMEMTPQEGGGTKVLLDLPVDHEV
FT                   QYYN"
FT   gene            complement(632555..632818)
FT                   /locus_tag="Tfu_0556"
FT   CDS             complement(632555..632818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0556"
FT                   /product="putative WhiB-family transcriptional regulator;
FT                   putative role in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54594"
FT                   /db_xref="GOA:Q47SH3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54594.1"
FT                   /translation="MDWRHHAACRDEDPELFFPIGNSGPALIQIEEAKEVCRRCSVSTA
FT                   CLEWALETGQDGGVWGGMSEDERRALKRRRALRPAARLSTAV"
FT   gene            complement(633163..634098)
FT                   /locus_tag="Tfu_0557"
FT   CDS             complement(633163..634098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0557"
FT                   /product="diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54595"
FT                   /db_xref="GOA:Q47SH2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54595.1"
FT                   /translation="MRALFIGNPQATTATPRSRDVIVRALASDMAVDTVLTEYRGHARE
FT                   LVQRAAEEGYDLVVSFGGDGTVNEVVNGILALPAKQRPLYAALPGGSANVFVRALGLPA
FT                   NPVEATGAVLEALHSGSRRTVNLGHIDGPDGGRYFTFCAGFGWDAEVVHEVERQRQRGR
FT                   RATPALYTAIALSLFLRGGMGGDPSLSVEVPGRPPVRNLFFVLVTNTTPWTYAGPSPVQ
FT                   PTPRSRFELDLDVFALTRVDTITTANVLRMMFSAKGVPPRGRGYRTWHNCAEFTIRSQH
FT                   PRPFQIDGEYLGHRQQVNFRSVPKALRIVA"
FT   gene            634150..634611
FT                   /locus_tag="Tfu_0558"
FT   CDS             634150..634611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0558"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54596"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54596.1"
FT                   /translation="MLRAEGPAEQGTKEAGYSEAVSRRPITLLLAAVCEGLLGVLLFIL
FT                   GGYVLVNTLLGNATDVNFALPLAVFAFGGSAALCYVAWGLFHLKEWARTPIVLTQLFAL
FT                   VIAYYLWTSDQVHLSLGLGAFAVLTLLFVLAPPTTATLFPPEGAAKKQR"
FT   gene            complement(634656..635459)
FT                   /locus_tag="Tfu_0559"
FT   CDS             complement(634656..635459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0559"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54597"
FT                   /db_xref="GOA:Q47SH0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54597.1"
FT                   /translation="MSERGPALTAQTEHSTPDRARARELFERLGELDPDSPERQRIRDE
FT                   LVELHLPLVEYLARRFRNRGEWLDDLTQVATIGLIKSIDRFDLSRGVEFSTYATPTIVG
FT                   EIKRHFRDKGWAVRVPRRLQELKLSLTKAVSELSQRHGRAPTVAELAEYLKMSEEEVLE
FT                   GLESANAYSTVSLDAPDNGDEDAPAVADSLGIMDESLEGVEYRESLKPLLERLPPREKK
FT                   ILLLRFFGNMTQSQIAAELGISQMHVSRLLARTLAQLRQALTADD"
FT   gene            complement(635456..635881)
FT                   /locus_tag="Tfu_0560"
FT   CDS             complement(635456..635881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0560"
FT                   /product="putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54598"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54598.1"
FT                   /translation="MTNDTAVPTADAMGVRDTVTVRMPADSAYLSVLRTATAGLAARLD
FT                   FTLDEIEDLRIGVDEACAMLLTQALPGTDLTTEFELTGDGMRISVSVLTSDGRLPARDT
FT                   FAWTVLSALAGDVDAVVGSDDRVSIVLYKRRNPVESV"
FT   gene            complement(636147..636632)
FT                   /locus_tag="Tfu_0561"
FT   CDS             complement(636147..636632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0561"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54599"
FT                   /db_xref="GOA:Q47SG8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54599.1"
FT                   /translation="MIRPARPDDVPVITALVRELAEYEKEPQSATATEEDFAAALFGPN
FT                   PAVFAHVAEHTAEDGSPMVVGMALWFLNFSTWTGRHGIYLEDLYVRPEFRGRGYGKALL
FT                   TELARICVARGYRRLEWSVLDWNTPAIEFYKSLGAVPMDGWTVYRLTGEALTALGQQ"
FT   gene            637038..638324
FT                   /locus_tag="Tfu_0562"
FT   CDS             637038..638324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0562"
FT                   /product="malate dehydrogenase (oxaloacetate
FT                   decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54600"
FT                   /db_xref="GOA:Q47SG7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54600.1"
FT                   /translation="MSHKPHLRPSPLAASHRTLSPSTWMGTRTDSLRGFYVTSDRSSRL
FT                   DDDPAFALHRGGKLEVRSTVEVNDQKSLSLAYTPGVARVCTAIADTPELADTYTWKNNV
FT                   VAVVTDGTAVLGLGDIGPEASLPVMEGKSLLFKQFAGIDSVPIALACTDVDEIVETVVR
FT                   MAPSFGGINLEDISAPRCFEIEQRLRERLDIPVFHDDQHGTAIVALAAIRNAARVTGRE
FT                   LSDLRAVVSGAGASGIAVSRMLIRGGIGDIAVADSKGLIYEGRPGLNKYKAELAAISNK
FT                   AGLQGSIESALAGADVFVGLSAGEVPEEVVATMADNAIICAMANPNPEVHPDVARKYAA
FT                   VVATGRSDFPNQINNVLAFPGVFRGALDVRATQITENMKLAAATALADLVGDDLAPDYI
FT                   IPKPFDERVVPAVAAAVADQARKDGVARA"
FT   gene            complement(638395..639201)
FT                   /locus_tag="Tfu_0563"
FT   CDS             complement(638395..639201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0563"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54601"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54601.1"
FT                   /translation="MTTIFGHGRLRLYLLKLLDESPRHGYEIISLLRDRFLGIYSPSPG
FT                   TIYPRLARLEEEGLVTHEEVNGRKVYRLTDKGRAELRERERDLEDLERQITESVRDIAQ
FT                   AVQRDVRDTISHLREELKATAQHTRRSRSERQESAKTGADDVWSRAADEQEERRDRERE
FT                   HGFAWNREWEKFAHTFGWVWPKGPKDRAAGSGFERILHDFTHRVRDIIRETGGISEAAI
FT                   ADLRRILDETLDIIRRDAARWGPPPTDSASRATDNADKEQTPRSTE"
FT   gene            complement(639198..640052)
FT                   /locus_tag="Tfu_0564"
FT   CDS             complement(639198..640052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54602"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54602.1"
FT                   /translation="MARWTIDRPTTHTLDGIVALRVRVVGGHVNILPTDDPATFEISEI
FT                   SGEPLLVSHEAGILTITYADLTRDGLLERLRPIQLGSYRGLPRRSATINLRIPRDCPVE
FT                   VTAATASIVVAQLTAKTQIRNGSGDITLDGVGGDTEINTVSGDVEARNLTGRLGYKSVS
FT                   GDLEIAGGQLSELSAKTASGELLADIDLAPAARVTLGSISGEIALRVPADTSATVELRS
FT                   ATGRLDSAFGLDRQSTRGFTRLSGTIGPGIDPATITTTTVSGATSLLRRAADTPAAIPK
FT                   GDA"
FT   gene            complement(640256..640432)
FT                   /locus_tag="Tfu_0565"
FT   CDS             complement(640256..640432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0565"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54603"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54603.1"
FT                   /translation="MYFTDRGIEELEKRRGEEEVTLAWLAEQLRIFTDLNPEFETAVDR
FT                   LATWLARSDEDDE"
FT   gene            complement(640446..644090)
FT                   /locus_tag="Tfu_0566"
FT   CDS             complement(640446..644090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0566"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54604"
FT                   /db_xref="GOA:Q47SG3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54604.1"
FT                   /translation="MSSEASQPLTDFGPNEWLVDELHRKYLADPNSVDKAWWNFFADYK
FT                   SGTAADGSTSPAKSTVAGNGAGGAVRAAASKAAARPATATTPDGSDDALAVSQERLRGA
FT                   SARTAANMESSLTLPTATSVRAVPVKLLFDNRIVINNHLRRARGGKVSFTHLIGYAMVK
FT                   ALESVPVMNYSYTEIDGKPAVAKPKHVNFGLAIDLAKPDGSRQLVVPNIKAADTMNFKE
FT                   FWSACEELVRKARSNKLTVADFQGTTITLTNPGGIGTVHSVPRLMPGQGTILGVGAMEY
FT                   PAEFQGASPATLNELAVSKVMTLTSTYDHRIIQGAESGEFLRRIHQLLLGEDGFYDEIF
FT                   ESLRIPYEPVRWVQDISVNRDNQLDKATRVQELIHAYRVRGHLMADTDPLEYKQRRHPD
FT                   LDVLEHGLTLWDLDREFPTGGFGGKPVMKLREILGILRDSYCRTVGIEYMHIQSPEERE
FT                   WIQARVEREPEKLSREEQLHILKLLNSAEAFETFLQTKYVGQKRFSLEGGESLIPLLDG
FT                   VITKAARAQLDEVVIGMAHRGRLNVLANICGKSYAQIFGEFEGNLDPRSAHGSGDVKYH
FT                   LGTEGTFTTITGEKIAISLAANPSHLETVNPVAEGIVRAKQDILNKGATGFTVLPILIH
FT                   GDAAFAGQGVVAETLNLSQLRGYRTGGTIHIIVNNQVGFTTSPKDSRSSVYATDVARMV
FT                   QAPIFHVNGDDPEAVVRVARLAFAYRQEFNKDVVIDLVCYRRRGHNEADNPSFTQPLMY
FT                   DIIDAKRSTRKLYTEALIGRGDITLEEAEEALRDYQEQLERAFAETREAAKKPIEPGSV
FT                   IKPEVFTEAPIDHSATPTAVSEEVIKRVAETQVTFPEGFTVHPRLLPQLQRRVRMVEEN
FT                   AIDWAMAETLAFGSLLIDGHPVRLVGQDSRRGTFGQRHAVLVDRKTGEEYTPLKVFDRG
FT                   TAKFHVHDSLLSEYAALGFEYGYSLERPDALVAWEAQFGDFVNGAQTVIDEYISSGEQK
FT                   WGQKSSVTLLLPHGYEGQGPDHSSARIERFLQLCAQENMTVTIPTTPANYFHLLRWQVK
FT                   SPYRRPLIVFTPKSMLRHKAAVSAVSEFTSGSFRPLIPDTSGIAPEDVRRVILCAGKIY
FT                   YELDAARKRTGDQHTAIIRVERLYPLPIDEIRQQLRSFPNAGEVLWVQEEPANMGPWPF
FT                   VALVFAEQLDRPFTRISRSASSSPATGSAKRHEVEQQALVNTVFPPTE"
FT   gene            644969..645349
FT                   /locus_tag="Tfu_0567"
FT   CDS             644969..645349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0567"
FT                   /product="possible regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54605"
FT                   /db_xref="GOA:Q47SG2"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54605.1"
FT                   /translation="MKIREFGELESAIMDALWKADRPLSVREIRETMTYRRNIAYTTVM
FT                   TVANILVNKGILDREKVGRAWRYQPRESREEHTARIMSEVLHSGGDRGATMIRLIEQFS
FT                   DEEMTRLHEALSEMRIRRGIAS"
FT   gene            645422..646597
FT                   /locus_tag="Tfu_0568"
FT   CDS             645422..646597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0568"
FT                   /product="succinyldiaminopimelate aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54606"
FT                   /db_xref="GOA:Q47SG1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54606.1"
FT                   /translation="MSEPLVARMAAFGETIFAEMTRLAEHTGAINLGQGFPDTDGPPFL
FT                   LAEAARYLTEGVNQYPPGYGREELRTAIAADRQERYGLAYDPATEVYITVGATAGIAAS
FT                   ILALVEPGDEVVLFEPMYDSYSAVIALAHGVRRPVTLRPSPDNGRYTFDPDELAAAITP
FT                   RTRAIIVNTPHNPTGTVFTADELAWIARLCRENDLVAVTDEVYEHLTFDGTPHLPLAAL
FT                   PGMAERTLSVSSAGKTFSVTGWKIGWVTGPEPLVRAVATVNQYLTFTANGAQQLAVATA
FT                   LRHGMDWVSEQRDALHAKRDRLVAGLAAAGFQVHPPQGTYFVMADIRPLGYDDGLTFVR
FT                   TLARRAGVVAIPAQVFYADERHGRHLVRFAFCKRDDVLDEAAARLRAWGDR"
FT   gene            646664..647296
FT                   /locus_tag="Tfu_0569"
FT   CDS             646664..647296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54607"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54607.1"
FT                   /translation="MTTPMPDHLLRVAENTKGFMPTDEGLVLYETALAYAPLGPVLEIG
FT                   TYCGKSTVFLGAAVQQVGGVVITVDHHHGSEEHQVGWEYHDPSLVNPTTGKLDTLGAFR
FT                   ETMAAADLEDHVIAIVGHSAAVARLWNTPLGMVFIDGSHTEEAAQADYTGWSPHVCVGG
FT                   ALVIHDVFPNPADGGRPPYHIYRRALESGEFVEERAHGSLRVLRRKR"
FT   gene            647955..651344
FT                   /locus_tag="Tfu_0570"
FT   CDS             647955..651344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0570"
FT                   /product="similar to Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54608"
FT                   /db_xref="GOA:Q47SF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54608.1"
FT                   /translation="MPGGDELSESSRGDTTPRPETEEATVADSSVTNDDVSVDESGVDA
FT                   RADDVDDGSEPEWFASAGESPYLEASAFKDSGSFFRDKVARSLAEEYGIDLDDAGDQTA
FT                   DSAASSGADGQQAQDADTHAGTASPAEDTDQAAAAAAGAEEDEEATEQLRPADAVGGDS
FT                   GGLDEATVQITPTDAADASAVDEEGTTERLSPPSSSGPGADDEATEQINLPSSAAADDE
FT                   ETTERLSPSAARAGDDEATERLDVPASSTAVDAEEATEQLRPADAVGGDSGGLDEATVQ
FT                   IAPVGAVDAEETTERLSPSAARAGDDEATERLDVPASSATVDAEETTERISPVTPTGHG
FT                   SGEETTVQLSPVEAAQSQAAPSTTDPSESTKLETTAVLRENLKSRLRKRPLRPRFRKSA
FT                   AAAGGVGPASPPPPTAPSGTSHSSGPAEKKAPAKKTKRKKPLWWRITRAGLIVIVLLVG
FT                   LVTGAFAYAYSMFEVPDAAQADATAQGSIFYYADGSVLTERGVNRKPVSLDEVPEHVQN
FT                   AILSAENRGFWDEPGVSITGTARAVWSTVTGKQLQGGSTITQQFVRNYYEGLSQEQTIE
FT                   RKLKEIIIALKVDRSQSKEWILEQYLNTIYFGRNAYGIQAAAEAYYDKDVGDLTPDEAA
FT                   FLAAAIQQPTKFGFADSDTTPEMESRWQYVVNGLVDMGSITEAEAAEYKFPKPLPERPQ
FT                   DNIDLSGYKGYMFQQAMKELEELGYTEDNINRGGYEIHTTFDPKLMELAYEAVQETVPI
FT                   DDLPEGVRVGLSVVDPKTGGVLAFYGGEDYFENQYDSAFLGTAQAGSAMKPYVLAAALK
FT                   EGLSLHTVVDGRGPRYINGTRIQNAGNAPGGPMNLIQATAVSNNLGYIDLAQRVGLEKV
FT                   AETAYAMGLPEGSIDLVPVLPLGANSVSPTDQAGGYATFANGGEHIETHVVASIINKEG
FT                   EEERPEPKRNRVLTKEQAADATYAMRQVITSGTGTAANIGRPAAGKTGTTDGSVAAWFV
FT                   GYTPQLSAAVGIYSGDNQRFYVPGWGTLSGGTLPATVWRTFMQKALADKPVEDFPSPSF
FT                   GGSAQNWAPQPEPSTPADTPQDQGPNQDGLNPAPEPEVPQPAPEPVVPEPVVPEPVVPE
FT                   PVVPEPGGPDPGFPGGGLPPSG"
FT   gene            complement(651406..652500)
FT                   /locus_tag="Tfu_0571"
FT   CDS             complement(651406..652500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54609"
FT                   /db_xref="GOA:Q47SF8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54609.1"
FT                   /translation="MNRHDLPELPGVLRADEIARSAAYLLHAQEPSGAIPWFPGGHLDV
FT                   WDHIECAMALSTVGHYTAAVRAYDWLAAVQHPDGSWPAKLRQGTVVNPLREANHASYLA
FT                   VGVWHHFLVTGDDAFLERLWPTVRAGIGFVLGLRTERGEILWARDADGSPGDHALLTAC
FT                   ASIHHALRCAIALADHLDHPQPDWELAAARLAHLICEHETVFADRSRYSMDWYYPILGG
FT                   AMRGARAEKRIAERWDTFVVPGLGIRCVSDQPWVTGAETSELVLALAAIGSRDRGAELL
FT                   ASIQHLRDPDDGAYWTGYQFVEDVRWPVERSTWTTAAVILAVDALCGATPGSQVFTRIP
FT                   RAAEQSAEGCCDQPVVLPAEAGLA"
FT   gene            complement(652497..653228)
FT                   /locus_tag="Tfu_0572"
FT   CDS             complement(652497..653228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54610"
FT                   /db_xref="GOA:Q47SF7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54610.1"
FT                   /translation="MITIDFTLFPVGPGHRVLDLGCGGGRHAFEVYRRGADVVAFDQNA
FT                   EDLAAVSAMFAAMRAEGEAPAEATAETVRGDALAMPFDDNTFDRVIAAEIMEHIPHDTA
FT                   AMAEMYRVLRPGGIAVVTVPSWFPERICWALSEEYHTVEGGHIRIYTRAELEAKLKATG
FT                   FIIGPHHHAHALHSPYWWLKCAVGTTNDSHPLVRAYHNLLVWDMLKAPRITRVTERLLN
FT                   PLIGKSVVVYLRKPRNDGDTG"
FT   gene            complement(653303..654580)
FT                   /locus_tag="Tfu_0573"
FT   CDS             complement(653303..654580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0573"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54611"
FT                   /db_xref="GOA:Q47SF6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54611.1"
FT                   /translation="MPLDRPLRIALLSYRSKPHCGGQGVYVRHLSRELAALGHHVRVLS
FT                   GQPYPVLDDGVTLDPVPSLDLYNDEHPFQAPPMREWRDWIDALEVATMWTAGFPEPLTF
FT                   SLRAFRELRARRHEFDVVHDNQTLGYGLLGIQAILPTVTTIHHPITVDRRIELESATGW
FT                   QRWSKRRWYSFVTMQGRVARRLRSILVPSQSSADDVAREFRVRPSVINVVPLGVDTRVF
FT                   HPRPDITRVPGRIVCVASADSPLKGVAVLLRAVAKLATERDIELTVVSKPQPGGPTEQL
FT                   VDELSLHDRVTFVSGIDETELACLLSSAQIAVIPSLYEGFSLPAVEAMATATPLVASRA
FT                   GALPEVVGDDGAGRLVPPGDAEALAAAIAELLDNDAARARMSEAAWRRVQEKFTWRTVA
FT                   ENTARHYAAALDAAQRGRADRSAAAS"
FT   gene            complement(654946..656379)
FT                   /locus_tag="Tfu_0574"
FT   CDS             complement(654946..656379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0574"
FT                   /product="similar to DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma24-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54612"
FT                   /db_xref="GOA:Q47SF5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54612.1"
FT                   /translation="MTAPQRPERQQISEDHAFALLLRQGEGYERCYDAFAPALYRYCWT
FT                   LLGAEQEDAAAEAVYETFLAAVELLPRLSDPDLFRAWLFALARAACERHGFAAQPAYAH
FT                   LTVHSEQQPFVAALSALLPSQRELLELSLRHGLTHTQIAAVLGLDPETVSDLCRSAAQQ
FT                   AADLLTEQQPGGSPGSRWFIADIPLVVSSIALPGPPRSLRARVIADCSDATAITRREQA
FT                   AALLCPLGANGFPLPGARGAEAEAAEPVQADAAVPAASASEADASPAAAEPETTDSAIA
FT                   GEPHRLSGWLVPATAGLVTALVAFSLWGLGAFTNRPGNGTAAGTPPPVDGVSVAPMSDH
FT                   VPASAAPDTGKVPSIELTEPTLEPTPEEPVEPVAPDSVEDDTAEPAAPPAEPDPAPPAS
FT                   EDAATVDPPAPAPQQPAPAPREEPASQPQPAPTAPAAPAPAPAPAQPAQEDPPPRRPGS
FT                   GVISLLEGVLGLLGLHGNR"
FT   gene            complement(656596..657594)
FT                   /locus_tag="Tfu_0575"
FT   CDS             complement(656596..657594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0575"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54613"
FT                   /db_xref="GOA:Q47SF4"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54613.1"
FT                   /translation="MATVTTSADTMTRQEWAAEVRRLAKERDAVILAHNYQRPEIQDVA
FT                   DYTGDSLALSRLAATVEASTIVFCGVHFMAETAKLLSPEKTVLLPDPAAGCSLADTITA
FT                   EDVRAWRAEHPDAVAVAYVNTTAAVKAEVDICCTSSNAADVIRSIPEDREILFLPDQFL
FT                   GAHVKRVTGRDNIHVWMGECHVHAGIDGHTLRQRVEAEPDAELYVHPECGCATSALYLA
FT                   SSGMVPEERVKVLSTGGMLRAAEKTTARKVLIATETGMLHQLRAANPSTVFEPVNSRAE
FT                   CHYMKMITAEKLLASLRDGTTEITVPEDVAARARASVERMIAIGSPSRGGE"
FT   gene            657742..658473
FT                   /locus_tag="Tfu_0576"
FT   CDS             657742..658473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54614"
FT                   /db_xref="GOA:Q47SF3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54614.1"
FT                   /translation="MDGVGADPANLAQVRHPTENTSGTAHEVLAVVFQIRQDRLCVLIW
FT                   QRGRPPYEGLWALPGGRLGATEGLGESIRRQLAQKVDVRELAHLEQLQTWGDPNRHPLG
FT                   RVVATAYLGLVPAGIDPLIPDDTQWFPVTDLPPMAFDHAAMVGAARQRLRAKLSYTNIG
FT                   FALAPPEFTISELSRYYRAALGHDVTATNLRRILLRRGQIEETGRSVPSGRLGGRPAAL
FT                   FRFRTRTLEITDAFAVLRPPT"
FT   gene            658547..659197
FT                   /locus_tag="Tfu_0577"
FT   CDS             658547..659197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0577"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54615"
FT                   /db_xref="GOA:Q47SF2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54615.1"
FT                   /translation="MVFDVGETLIDETRIFGRWADRLGVPRLAFFGTLGGVLAEGRPML
FT                   DAFRLVKPDFDLEAELEAWQRDEPHSLRENFDEADLYPDARPTLERLRGLGLRVIIAGN
FT                   QPPQAADALRAMDLPAEGIYVSAQWGVAKPEREFFTRVIDVAGVPAEEILYVGDRVDND
FT                   VIPARASGLRTALVRRGPWGYLHAERPEAAQADVIVSSLTELTEWLTARLARP"
FT   gene            complement(659295..659786)
FT                   /locus_tag="Tfu_0578"
FT   CDS             complement(659295..659786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0578"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54616"
FT                   /db_xref="GOA:Q47SF1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54616.1"
FT                   /translation="MISAGEFTEALAHFATGVTVVTVADGRDDIGSTITAFASISVEPP
FT                   LVMVSITSTSYLAEVIDRRGRFAVNVLSARQKALAGRFAAAGRPSARLLLAAEPHQRGE
FT                   HTGALVLTTAVAALECEVSQRVVAGDHTIYLASVLALPPVTGGVDGPLIRYTSRYRTLG
FT                   "
FT   gene            complement(659783..661492)
FT                   /locus_tag="Tfu_0579"
FT   CDS             complement(659783..661492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0579"
FT                   /product="signal peptide peptidase A. Serine peptidase.
FT                   MEROPS family S49"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54617"
FT                   /db_xref="GOA:Q47SF0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54617.1"
FT                   /translation="MDAAKLFDPLTTIRRRRTAPLVLELDLTEGMIDEPPGDPLSQIMA
FT                   MRRQRLFDIVEGIRRGAHDPRVKALIVKIGSQSLGMALVQELRQAVAMFRRAGKHTVAW
FT                   SESFGEFGPGSLPYYLATAFDEIALLPSGSVGLTGLRVENLFFAEALEKLGVDYQGGAR
FT                   HEYKTALNMFTERGFTDAHREASGRIVESLTEQLVAGISSGRDLSEERVRELIDQGPFL
FT                   ATEAVEAGLVDKVAYRDEIYSDLLDRYSADGTPAHLQYVSRYQRTRSLADRVPVAQRSG
FT                   YVALISGVGQIVTGRSRRSPLGGGAVMGSDTVAAAFRAARKDPNVRAVVFRVNSPGGSY
FT                   TASDVIWREVVLTSQAGTPVVVSMGDVAGSGGYFIAAGADVIIAQPGTITGSIGVVVGK
FT                   AVLSTMLAKLGVTSDWIDSGNHAGMFSPNRPFSESEWERVNTMLDHIYDDFVGKVAEGR
FT                   KMTRDQVHEVAKGRIWTGQDACERGLVDEVGGLETAIRIARDRGGLPPSAPVRHFPQLG
FT                   PLERLIPAESSEDRTAQAQLRLSGWGPLAELSARLGLPAAGPLVMPGTWEIR"
FT   gene            complement(661572..662774)
FT                   /locus_tag="Tfu_0580"
FT   CDS             complement(661572..662774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0580"
FT                   /product="chitinase. Glycosyl Hydrolase family 18"
FT                   /EC_number="3.2.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54618"
FT                   /db_xref="GOA:Q47SE9"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54618.1"
FT                   /translation="MRIIGYFPQWGIYDRHYFLRDVHSSGQAAKLTHLTYAFGELDEKG
FT                   VCVMTDEATGDAWADYQCRFSTAQSVDGRGDSYEQPLAGNFNQLRKLKKRHRHLKVGIS
FT                   FGGWNASRYFSNAARTPASRAAFASSLVSLYFDGNLPILPGEPQGGPGVAAGIFDYVDF
FT                   DWEWPGSPGHEHNVVRAEDRRNYTLLVAETRRQLDAFTARTGRPVEISAYLPADPERAA
FT                   AGIEPELFDYLDFGIVQGYDFNGDWDLTTNHASQLYTPPDDPSPRKLSLDVGVVTYLEM
FT                   GVPPEKLVISVPGFGRGWRGVPRGRRNGLYQRAREVAPGTWEPGDEDYKTLARRPGRRF
FT                   RDREYGALWLYDGNEFWSYDDPEIIRMKAAYAKDLGLGGLSLWSLDNDDSRGSLVRAMH
FT                   G"
FT   gene            662881..663678
FT                   /locus_tag="Tfu_0581"
FT   CDS             662881..663678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54619"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54619.1"
FT                   /translation="MSGIPSRSRFEAPRRRLPVRLMAALAAGALAMTGCSDDSDSASSE
FT                   RPPVPEPEATYGGVLEAAEAPAPAGFTQLNIEGVKINAPQGWEVDQGEGMLCMRPPGQD
FT                   TCGYGAVEVRPKAAQRHPDNWPKRDSSFHKDDGWAADPTTCRSLTTAEAGNVGIKESTL
FT                   HLIGDGLTTHADGLKSHYSTWKVTCENDDTFEVRLWFLPESDVLVYVWSVDQRYDSLYL
FT                   TIAESMDVTEYKQRIREEEERRNRDRDRDNDRDQDQGDNQDDD"
FT   sig_peptide     662881..663006
FT                   /locus_tag="Tfu_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.642 at
FT                   residue 42"
FT   gene            complement(663757..666006)
FT                   /locus_tag="Tfu_0582"
FT   CDS             complement(663757..666006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0582"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54620"
FT                   /db_xref="GOA:Q47SE7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54620.1"
FT                   /translation="MTARPAVRQPAGLPCPQPCNRYGYPMTNALLAEIDALVAGTHHNP
FT                   HALLGAHPGPEGVWVRALRPLARSVHVLLANGSRVELPHLHKGVFAGVVPGAEVPDYRL
FT                   VVRYDDGTELTVDDPYRHLPTLGELDIHLIQEGRHEELWRVLGAHTKRFPSVLGDTEGT
FT                   AFTVWAPNARGVRVIGDFNHWDGTGHPMRSLGSCGVWELFIPGVGDGTRYKYQVLGADG
FT                   VWREKADPVAFATQAPPETASVVFTSRYTWQDDEWLTQRAAADLHRKPMSIYEVHLGSW
FT                   RPGLSYRELADQLVDYVRELGFTHVEFLPVAEHPFGGSWGYQVTSYYAPTARFGSPDDF
FT                   RYLVDRLHQAGIGVFLDWVPAHFPKDDWALSRFDGTALYEHPDPRRGIHPDWDTLIFNY
FT                   GRTEVRNFLVANALFWLEEFHIDGLRVDAVASMLYLDYSRESGQWEPNAYGGRENLDAI
FT                   DFLRELNATAYRRNPGIAMIAEESTAWPGVTRSTDTGGLGFGFKWNMGWMHDTLSYLQH
FT                   DPVHRQYHHNEVTFSMVYAYSENYVLPLSHDEVVHGKRSLLYKMPGNEWQRCANLRALL
FT                   AYMWAHPGKQLLFMGNEIAQGDEWSHDAGVQWWLLRYPHHAGMRRLVADLNRLYRNTRA
FT                   LWSQDTVPEGFTWLDGGDASGNTLSFLRWGDDGSVLACLVNFSGRPHPERRVGLPYAGR
FT                   WREILNTDAVLYGGSGVSQPGIIEASEETPWQGQPASALVTYPPLGVSWLVFDGT"
FT   gene            complement(666003..667412)
FT                   /locus_tag="Tfu_0583"
FT   CDS             complement(666003..667412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0583"
FT                   /product="putative pep2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54621"
FT                   /db_xref="GOA:Q47SE6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54621.1"
FT                   /translation="MDRSVMTQLEELLATWLPAQRWFAGKGTAIDTLRIDSDHILLPGL
FT                   PGLRLLVAEVVQGSRTDRYQVLLGMRAVGAVPDELVHAVIGTCPAPADLDSPAPVVVYD
FT                   AAHDAAMTGHLLSWIAENRDVGAVRFRAAPGTEVRTGLRSLVITGEQSNTSLVYGEEYV
FT                   LKMFRRLWPGTNPDLELTSALATVDSPHIARPHGWIDVDLVDPASGRTVPTTLAMLQTY
FT                   LRSATDGWVLAATSVRDLYASPELAPSEAGGDFAGEAQRLGAATAAVHRDLARVLPTGV
FT                   LSPEGQAHLAATMMARLHTAVDEVPELAPYAETLYSAFEALGNTSTDLPVQRIHGDYHL
FT                   GQVVRTDAGWVLLDFEGEPAVPVSERQKLSSPLRDVAGMLRSFDYAARYQLVGRTDNPA
FT                   LVTAARAWAQRNREAFCAGYTRGGGIDPDLHQVVLRAFEYDKAVYEVLYEARHRPHWIS
FT                   IPLDSITALTG"
FT   gene            complement(667419..669239)
FT                   /locus_tag="Tfu_0584"
FT   CDS             complement(667419..669239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0584"
FT                   /product="trehalose synthase. Glycosyl Hydrolase family 13"
FT                   /EC_number="5.4.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54622"
FT                   /db_xref="GOA:Q47SE5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54622.1"
FT                   /translation="MTTQPAPGARPTPTGSVPDTFTHAKPRDPYWYKHAVFYEVLVRGF
FT                   YDSNGDGTGDLRGLIEKLDYLQWLGIDCLWLLPIYESPLRDGGYDVSDYMKILPEFGRI
FT                   SDFVELVEKAHQRGIRVITDLVMNHTSDQHPWFQASRHDPDGPYGNFYVWSDTTERYSD
FT                   ARIIFIDTEQSNWTYDEVRGQYYWHRFFSHQPDLNFENPDVQDAILEVMRFWLDLGIDG
FT                   FRLDAVPYLYEREGTNCENLKETHEFLKRIRAEVDRLYPDRVLLSEANQWPADVVDYFG
FT                   DYESGGDECHMNFHFPLMPRMFMAVRREQRYPISEILAQTPPIPRNCQWAIFLRNHDEL
FT                   TLEMVSDEERDYMYSEYAKDPRMRANMGIRRRLAPLLENDLNQIKLFTALLLSLPGSPV
FT                   LYYGDEIGMGDNIWLGDRDSVRTPMQWTPDRNAGFSRCDPGRLYLPVIMDPIYGYQAIN
FT                   VEAQQNNPNSLLNWTRNMIQIRKQHPVFGTGDFTELHASNPSVFAFVREYGDDRMLCVN
FT                   NLSRFPQPVELDLRRFEGITPIECTGGVHFPPIGELPYLLTLPGHGFYWFQLPPVAEEQ
FT                   PLAQPVTTVPAAPQPPAPADRPASDPTQRS"
FT   gene            complement(669306..671273)
FT                   /locus_tag="Tfu_0585"
FT   CDS             complement(669306..671273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0585"
FT                   /product="alpha amylase, catalytic subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54623"
FT                   /db_xref="GOA:Q47SE4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54623.1"
FT                   /translation="MIGRFPILDVSPVVDIGTAKAVVGETFPVRATVFREGHEALGAGV
FT                   VLYTPEGQRQPLVPLREIAPGTDRYEAEVTVTSEGLWHFAIEAWSDPYATWCHDARIKI
FT                   PAGQDVELMLEEGARLLERAARRVPRRPALAEIAAAMRDGSRSAHERLDLALSDLVRDE
FT                   LAERPLRELVTRSQRFPVMVSRRRALFGSWYEFFPRSEGAVLDTEDGEPRSGTFATAAR
FT                   RLPAIADMGFDVVYIPPIHPVGYSFRKGRNNSTVAQPGDPGSVWAIGSHEGGHDAIHPD
FT                   LGTIDDFDAFVARARELGLEIAMDLALQASPDHPWVKEHPEWFTVRADGSIAYAENPPK
FT                   KYQDIYPINFDKDPEGIFTEVRRIVRYWMSHGVRIFRVDNPHTKPVAFWERLLADIAAT
FT                   DPDVIFLSEAFTRPAMMHTLAKIGFHQSYTYFTWRNTKQELEEYLTELTGEAAAYMRPN
FT                   FFVNTPDILHAYLQHGGRPAFEVRAILAATLSPTWGMYSGYELCENRALKPGSEEYLDS
FT                   EKYQYKPRDWEAAEAAGITITPLIRKLNSLRRSHPALQELRNLRFHYADQPEIICYSKR
FT                   LAGANHGADDTILVVANLDPHHTREATVWLDMPALGFAPGDHITVTDQLSGHSYHWVEA
FT                   NYVRLDPHVQTAHIFTVAPA"
FT   gene            671844..674465
FT                   /locus_tag="Tfu_0586"
FT   CDS             671844..674465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0586"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54624"
FT                   /db_xref="GOA:Q47SE3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54624.1"
FT                   /translation="MKAIRRFTVRTVLPDELAALCTLAANLRWTWHAPTRAVFAAVEPR
FT                   LWEAVGRDPIRLLGEVTPERLRELAADAEFRARLDAAAADLDRYLTAPLWYQQLTDSSD
FT                   TPPPAAIAYFSAEYGLDATLPQYSGGLGILAGDHLKSASDLGIPVIGVGLLYRHGYFSQ
FT                   TLSPDGWQLERYPEIDPHCLPMTRLEDRGTPVRITVDLPENRTLTAHVWIVRVGRVPLL
FT                   LLDTYHDDNDLDLRGVTDRLYGGGTEQRLRQELLLGIGGLRAVRAYCLRTGYPEPEVFH
FT                   MNEGHAGFLGLERLREYIETAGLDFDQALEATRSGTVFTTHTPVPAGIDRFPKELVERH
FT                   FSGPVALPGLPVERVMALGAETYPGGDPNVFNMAVMGMRLAQRVNGVSALHGAVSREMF
FT                   GGLWPGFDVDEVPITSITNGVHAATWMAEEAWDAAQAMGLGLEELETPAGWQRLVERDA
FT                   EELWRMRRALRERLIIEARKRLRASWRQRGATDAELAWIDEALDPEVLTVGFARRVPSY
FT                   KRLTLMLRDPERLTALLRHPERPIQIIIAGKAHPADEGGKRLIQEMVRFSDDPRVRDRI
FT                   VFLPDYDMALAALLVQGCDVWLNNPLRPLEACGTSGMKSALNGGLNLSIRDGWWDEWFD
FT                   GSNGWAIPTADGVDDPDRRDDIEAAALYELFEEQVAPLFYERDDHGLPRRWLETVKHTM
FT                   VSLGPKVQATRMVREYVDQLYQPAALAMRRLAADNYRGARELAAWKQRVQHAWPGVRIE
FT                   HVETSMNGDTPQVGGELEVRATLVLGGLDPDDVCVEVVLGLVNDDDELINPTTTELVPL
FT                   PASDVVYPLVRFGGTVPLDRAGTCGYTVRIRPRHRLLTHPAEAGMAVVAEPTMGIGTLV
FT                   PH"
FT   gene            674961..675563
FT                   /locus_tag="Tfu_0587"
FT   CDS             674961..675563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0587"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54625"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54625.1"
FT                   /translation="MSPAEPQPGQDRQSLLHWRTVDIVVAAVIGVAVGIVFWVWSVLWN
FT                   ATTGLFAFFPPAQAILYGMWMVPGVLGGLIIRKPGAAVLTSIAAASLEMLLGTGWGVSV
FT                   LISGALQGLLSELVFLAFRYRSWGMGVAVLAGVAGGISPAIRDNLTYHVTWPLSYQVVY
FT                   GVLVLISAGLIAGAGSRVLTTRLAAAGALSPFASARG"
FT   gene            675568..677106
FT                   /locus_tag="Tfu_0588"
FT   CDS             675568..677106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0588"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54626"
FT                   /db_xref="GOA:Q47SE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54626.1"
FT                   /translation="MGTGNRDGHGARVELSGWGWRHAGRADYALRGVDLVIEPGERVLL
FT                   LGASGAGKSTLLHALAGLTGPNGAITGEEEGRLLVDGKPATSQRGRIGLVAQDPESQLV
FT                   MARAGDDVAFGLENLGVPREQIWARVDEALARVGFPYGRAHPTAALSGGEKQRLVIAGV
FT                   LAMSPRLLLLDEPTANLDPPGARLIRDVLARLLADTGATLVLVEHRVADVVDLVDRVVV
FT                   VEPGGGVIADGAPRTVFARHGTALAERGVWVPHADPVPCTTPAPGGPVLIEAADCTLGT
FT                   PRTPGRRRPKTVLNAVDVTVAAGTATALTGANGAGKSTLLTALAGLAKPQSGQIRPCGP
FT                   LAAADPRPLVKWPARQLARHVGTVFQHAEDQFVTATVRDELRFAPLRLGMGEAETAAWV
FT                   DELLERLRLTHLADKHPYTLSGGEKRRLSVATALSSGPAHAPDVLVLDEPTFGQDTRTW
FT                   VELVELLDALRGQGRAIVLATHDTLLLRHLADVELRVADGSVTETARTGMEESR"
FT   gene            677103..677879
FT                   /locus_tag="Tfu_0589"
FT   CDS             677103..677879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0589"
FT                   /product="ABC-type cobalt transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54627"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54627.1"
FT                   /translation="MNLTSAPAGRAAPGNGQPGVRSWLLGINPAAKLIAACVISFGLIP
FT                   AVDPVTGGIVLAVTALLLPFSGINRATLLVLSVPFCLMGLSTWVVNLLYGEEGLWGASG
FT                   AAVRILAIALPGMLAAVSSDATDLADALVQRLKVPERPAMGVLAALRLVPLLADQWRTV
FT                   TLARRARGLEAGRNPLAALSIFFGKLFALLVRAVRTGTLLATAMDARAFGTGPRSHARV
FT                   SRWRLADTVLVAASLLLLAAAYTVSAQLGTLRLLFT"
FT   gene            678140..678928
FT                   /locus_tag="Tfu_0590"
FT   CDS             678140..678928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0590"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54628"
FT                   /db_xref="GOA:Q47SD9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54628.1"
FT                   /translation="MGEFVRVETDADHPAVAVIRLDRPKMNALNTQVQRELAEAAAQVS
FT                   EDSAVAAAVIYGGERVFAAGADIKEMADMDYAAMAAHSRTLQDCFTAVARIPKPVIAAI
FT                   TGYALGGGCELALCADFRVAADNAKLGQPEIQLGIIPGAGGTQRLPRLIGPAKAKDLIF
FT                   TGRHVDAAEALEIGLVDKVVPAEEVYATAVAMAARYANGPALALRAAKQAIDAGLEVDL
FT                   DTGLEIERLQFSALFATEDQKTGMRSFMEHGPGKATFSGR"
FT   gene            678936..679478
FT                   /locus_tag="Tfu_0591"
FT   CDS             678936..679478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54629"
FT                   /db_xref="GOA:Q47SD8"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54629.1"
FT                   /translation="MWQLTEYPAAERTDLLAAPVAAAVTEWKHDTPVDRLRVAAIDPEL
FT                   ADTANFCAAYGVPLDASANCVIVAARRGGETRLAACVVLATTRADINGVVRRHLGARKA
FT                   SFAPQEEAVQQTGMEYGGITPVGLPPEWPILIDSAVVAQPEVVVGSGLRRSKLILPGAA
FT                   LAELPGAEVLDGLARPA"
FT   gene            679872..681683
FT                   /locus_tag="Tfu_0592"
FT   CDS             679872..681683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0592"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54630"
FT                   /db_xref="GOA:Q47SD7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54630.1"
FT                   /translation="MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLV
FT                   AVKVLRAEVAGDDIARARLAREVMTMRRVRSRNVAEVIDADTTAPLPWVVTEYIPGPTL
FT                   DSTVTNHGPLRGRALTRVVTGLARALRDIHAAEIIHRDLKPGNVIICNGEPIIIDFGIA
FT                   YAVDGSKLTQTGTFVGTPSYLSPEVIEGSDLSPATDIHAWGATVAFAATGNPPYGAGAF
FT                   EVIFFRILNGEINLDGVPEPLRPIVQDAVQRDPRKRPTAEELVARTEQLNLDLPWMEDE
FT                   YRSSGMTGLHTVSADLPTSTPQPAPPEPEENQATAVAEAAAPDRTMVAPEGFGDDEEEQ
FT                   DSGRRYDHYYDATLRPEEFRDILTPVDYEGRNRDSADYDDEPPSLLERFRAYRRGEDRL
FT                   SDYFSDDEDDYYDEYEAKRLPWVMVVPVALGIVGLTLMMPTIGLILGTLAVTVLGGLDL
FT                   ARREHARRLHERGPRSSDNVVIALSMPWALLRTLGHAALYGLGYLLAGIVVGIAIGMVS
FT                   GNSSANVVGSWALGVVVLMNFLFGPHARGAQRQSRWLVSKITIRNPYVYWGTIIAISLL
FT                   ALFLVVFGVQLVPAWDPIPGPSEWFGS"
FT   gene            681924..682703
FT                   /locus_tag="Tfu_0593"
FT   CDS             681924..682703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0593"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54631"
FT                   /db_xref="GOA:Q47SD6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54631.1"
FT                   /translation="MNIVVLVKQVPDTETERKLDPADSTVDRAASDGVINELDEYAIEE
FT                   ALRLKEKHGGEVTILTVGPEQATDSIRKALSMGADKAVHVCDDALAGSDALQTAYAIAQ
FT                   TLGTLEYDLVILGSESTDARTGVVGAALAEYLGLPQLTLANKVDVDGTSVKIQRQTDDG
FT                   YQVVEATLPAVISVVEKINEPRYPSFKLIMAAKKKPVTKLSIAEAGIDADKVGLANATT
FT                   QVVDFAPAPPRTAGTVVKDEGNGGVLIADFLASKKFV"
FT   gene            682731..683672
FT                   /locus_tag="Tfu_0594"
FT   CDS             682731..683672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0594"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54632"
FT                   /db_xref="GOA:Q47SD5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54632.1"
FT                   /translation="MAEVLVLVDHVDGQVKKVTLELLTAARRIGEPAAVVVGEPTDELK
FT                   AKLGEYGAEKIYTAPAELDDYVVAPKAELLAKLANDKSAAAVLVSATPENKEIAGRTAV
FT                   KLGSGVLTDVVDINSELVAEHSIFGGSIITHAKVTKGVPVVAVRPNAIPAEPSAGAAAV
FT                   EAVEIELSDAAKAARITDRVKQEKGARPELTEAAIVVSGGRGVGEDFSVVENLADALGA
FT                   AVGASRAAVDAGWYPHAFQVGQTGKTVSPNLYIALGISGAIQHRAGMQTSKTIVAVNKD
FT                   PEAPILEISDFAVIGDLHKVAPQLTEEINKRK"
FT   gene            683860..685032
FT                   /locus_tag="Tfu_0595"
FT   CDS             683860..685032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0595"
FT                   /product="putative pyridoxal-phosphate-dependent
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54633"
FT                   /db_xref="GOA:Q47SD4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54633.1"
FT                   /translation="MVYLDHAATTPVRPEVLADLTDAFGLLGNASSLHEAGRHARRVVE
FT                   EARETLAEAMGCTPHEVVFTSGGTEANNLALKGLYWARNAQDPTRQRILVSAVEHHAVL
FT                   DPARWLADHQGAVVEELPVDSYGRLHPDTLREAIERDPASVALVSVMWANNEVGTLQPI
FT                   PELAAIAAEHGIWFHTDAVQAVGLEDIDFAASGVSALTLTGHKLGGPVGVGALLLARGV
FT                   DPVPVLHGGGQERDVRSGTLATPLIRGFATAVRLAVAEREEHAAHLADLRDELVAAVRG
FT                   VVPDIRVNGHPTERLPGHANIGFPGCEGDALLMLLDAQGIYCSTGSACSAGVSQASHVL
FT                   LAMGADPDTARESLRFSLGRGSTSADIKALADAIGPAVARARQARARRRA"
FT   gene            complement(685117..686271)
FT                   /locus_tag="Tfu_0596"
FT   CDS             complement(685117..686271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54634"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54634.1"
FT                   /translation="MALFRRRRSDESAVAIDDFWSGWGELRSALAASIDEGAPVPAEVA
FT                   QQLDERVQRIHPSLTWEVSRAPEPAPTNLASSPFESLDSPEALLASLDAEPASARASYA
FT                   LTLRAGDDDEARVLAERWYRAAPEDAEWTFFPARPADHAQLSRTITWHDHELDLSHVSV
FT                   SMRVNHATGKIEAGVYHPDFMFLPEETQREVAEHVMLLAVGEDDMVRWVDSVKPLVEKP
FT                   LDPLPPTSVPAVVRQLSGMSGGGGWVTLQGRIPLRGAMQLSARHPLHRRDYPALTLYVQ
FT                   VVASYTEADKDRLPTGSSAAALESYALRLREMLGANGALFAVQTLGGQRVFHFYLDPES
FT                   GIFPEFEKAAREWSEGQASVTSELDPEWRIIEQLLKPIRKQLGR"
FT   gene            686385..687476
FT                   /locus_tag="Tfu_0597"
FT   CDS             686385..687476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0597"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54635"
FT                   /db_xref="GOA:Q47SD2"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SD2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54635.1"
FT                   /translation="MTLRVLAAMSGGVDSAVAAARAVEAGYDVTGVHLALSSNPQSYRT
FT                   GARGCCTIEDSRDARRAADVIGIPFYIWDMAEEFDRDVVQDFVAEYAAGRTPNPCLRCN
FT                   EKIKFQAVLERALALGFDAVCTGHHVRLENGRLRRSVDAVKDQSYVLAVLTREQLAHAI
FT                   FPLGDCTKEEVRAEAARRGLTVADKPDSHDICFIADGDTSGFLERRLGSNPGPIVDETG
FT                   QVVGEHRGAHAFTVGQRRGLNLSGAPHRRYVLSIEPVSNTVRVGPREALQVDRIVGERP
FT                   VWSGCEPPEEWTPFLVQLRAHGEVYSCRARQYEGRVEILLDEPALGVAKGQAAVLYDGD
FT                   VVMGSSTIAETSRVEQAAANHAE"
FT   sig_peptide     686385..686462
FT                   /locus_tag="Tfu_0597"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.857) with cleavage site probability 0.268 at
FT                   residue 26"
FT   gene            687577..688134
FT                   /locus_tag="Tfu_0598"
FT   CDS             687577..688134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0598"
FT                   /product="similar to Uncharacterized membrane-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54636"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54636.1"
FT                   /translation="MPYEFLEGRPFWVVYLSLLGIVFARAQATYWLGRGLGAGVHRSRL
FT                   GQRIGPRLEHAENLINRYGPPAVTLSFLTIGIQTAVNLTSGAMRMRFVRYLIAMFVGCL
FT                   AWAAIYSLGGMAVLAAWWGLFLHSPWAATAAAAAVIAAVVGVKTWRKRRSAAALKEALA
FT                   APVADRKRATSPTLAVDREADV"
FT   gene            688296..689051
FT                   /locus_tag="Tfu_0599"
FT   CDS             688296..689051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54637"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54637.1"
FT                   /translation="MCPWGRLLTPRLSVTVSASLEGVAPPMQGLTYGVDIVLCIDATGS
FT                   MSPIIDRVKESALRFHEDLRKVMAAKSKNIDSLRVRVIAYRDYYCDAPEEAMVTSEFFS
FT                   LPQQAAEFSRFVNGIEARGGGDEPETGLEALALAMRSDWDTKSRKRRQIIVVWTDASVH
FT                   PLEKNAGDKPDGYPQDIPEDFDELTDMWEGQEYMDASAKRLILYAPDALGWTEIANHWE
FT                   NVIHFPSQGGNGLEEVDYSTILDTIANSI"
FT   gene            689068..690114
FT                   /locus_tag="Tfu_0600"
FT   CDS             689068..690114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54638"
FT                   /db_xref="GOA:Q47SC9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54638.1"
FT                   /translation="MKTPRLYLSFQIDKEGSAEDAPPLCETVGEISCLGVFDGLGGSGA
FT                   ASYQTPNGRVSGAYLASRKVRQVVRDWMRQNCTTGLPAEGKTVDLEQYIKKELSDYAHS
FT                   LSSSGGRLRSSMLRTLPTTLAVLAVSVREEPPLPDGTPSNLKLSCRYYWAGDSRCYLLT
FT                   PENGVQQLTRDNLKGSPDALENLSTDAPVSNCISANKPFQIFSSVVNGVAPAVFFTATD
FT                   GCFGYLPSPLFFEEMLLETMAQAATEQEWESLLRDRVKQVTGDDATFAAVCVGFDGFLH
FT                   MRERFAYRRKFIADLVAPLRAYQNRCEQLRKELEKAEQDYAAKLHSSWSFYKTGYERIL
FT                   PHLPGGGA"
FT   gene            690111..691193
FT                   /locus_tag="Tfu_0601"
FT   CDS             690111..691193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0601"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54639"
FT                   /db_xref="GOA:Q47SC8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54639.1"
FT                   /translation="MSEFIGKYRIITDFTTSGGGQCRWAFAVHGGKEYFIKEFLSPTYP
FT                   LPDSPGSKATKERKLRKCEQFEKHHREITKTLKRLSKPGGNLVITQDFFRHGAKYYKVT
FT                   EKIDTSALSLEEIAAEPMERRLLMLITVTHSLKILHQAGLVHGDIKPENILIKGTVKNY
FT                   HTAKLIDFDNAFFSGKPVPPDDMVGDLNYYSPETFGYLNGTVMGEQLTTASDIFALGLV
FT                   AVQFLTGSLVSFIPVEGAGRYPGELCAAGASYTTGLEEIFPQADSFVRKMLSAEPSKRP
FT                   TVDQVFDHVKELRSEVKKREDFITTTIVPRASSAKKSRLKGTLLKKSASTSREAEPTPR
FT                   NEKRSRLRGTLLEKRDSPPA"
FT   gene            691632..692660
FT                   /locus_tag="Tfu_0602"
FT   CDS             691632..692660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54640"
FT                   /db_xref="GOA:Q47SC7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54640.1"
FT                   /translation="MNEEQRHPWQPEAYTGIGSWPGTDPGEAIRTILGELPHLPHLPEL
FT                   PGRGPGADMIGRTGALLVELPIEVQPSGWRVTQRAGRDLTRARSFLSWDLDALEEHTSG
FT                   YTGPLKIQATGPWTMAASVELRNGEKMIADLGAVADLCESFREGLLAHLAEVRKRVPEA
FT                   TILVQVDEPSLPAVLTGSVPTASGYGRLRAVDRVLVEERLRALFSAIDTAGGYPLVHCC
FT                   APRVPVDLLRRCGARALSLDATRLTRESDEAIGTAVESGVGLLLGVVPAVDSRMSPPVD
FT                   TVEPVRELWHRIGFDPEHATRDVVITPVCGLAGASPRHARAALDLCREAARVLREEPRP
FT                   RQ"
FT   gene            692635..694872
FT                   /locus_tag="Tfu_0603"
FT   CDS             692635..694872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0603"
FT                   /product="NAD-dependent DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54641"
FT                   /db_xref="GOA:Q47SC6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54641.1"
FT                   /translation="MRNHGPGSERKDACVSAPDPTFSDDVPADVRERHARLSQDLDDYS
FT                   YRYYLGSPIISDAEYDQLMAELRDLEAQYPSLVTPDSPTQKVGAPISNEFAPVEHLERM
FT                   QSLDNAFSDAQLEAWAHRVSAEVPVDAFLCELKIDGLAVALVYEKGRLVRAATRGDGRI
FT                   GEDITLNIRTIDTVPLRLDESRYPAPELLEVRGEVFLPVKAFEQLNSRLADEGKPPFAN
FT                   PRNAAAGSLRQKDPRVTASRPLSMLVHGIGAHRGVTITHQSQSYELLAAWGLPVSDRIR
FT                   VVSTLDEVREYIAYYAEHRHDPEYEIDGVVVKVDDVSLQRRLGSTSRAPRWAIAYKYPP
FT                   EEVTTKLLDIKTSVGRTGRVTPYAVLEPVKVAGSEVEFATLHNAQEVARKGVLIGDTVV
FT                   VRKAGDIIPEVVGPVVEKRTGTERPFVMPTECPECGSPLGQQKEGDVDLRCPNTRYCKG
FT                   QLRERLAFIAGRKALDIEALGYVAATALTQPLEPAEPPLRDEGDLFSLTVEQLLPIRTL
FT                   VLDPDTAEPKIDPKTGKPKVVSFFANQKGEPKKIVEKLFQQLEEAKKRPLWRVLVALSI
FT                   RHVGPRAAEDLARHFRSLDAIAQASEEELEAVEGIGPTIARSIVDWFSVDWHREIVEKW
FT                   RAAGVRMEEEGADDGPRLLDGITTVITGTLEKYSRDGAKEAVQKLGGRVTGSVSRKTDF
FT                   VVVGANPGSKYDKAVKLGVPILDEAGFEVLLTQGPEAARAARLSEDESVLS"
FT   gene            695207..697309
FT                   /locus_tag="Tfu_0604"
FT   CDS             695207..697309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0604"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54642"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54642.1"
FT                   /translation="MKDPTSTRDVGPRVGTPLWLYFASTTVAGCVLLVVSLIWLRADRL
FT                   QVFATEPLVWVLLCMVIIGELRPIAAQRPTGGNAPTSLPFSFALVIYHGLPIAGLVQAV
FT                   GSLLAGVTRGQEPHRIAFNIAQYTLSFGVADAVIQLAYPRTPLVPWVPQGSGLVMVVLA
FT                   AGAYFVTNLLLVECAVAMHERIPLHRVLMKDLGYRLFVAGVLLSLAPLVVIAMAHSIWL
FT                   VPLFFFPLAALYSSASLSVKREYQANHDELTGLANRKLLILRTQEALSEAQERRQCVGL
FT                   LLLDLDRFKEVNDTLGHPTGDRLLQTVAYRLTHSVRPGDLVARLGGDEFAVLLPQVRDA
FT                   ASAREVAARLRVALAEPLRLDGMDFDLEASIGIALYPDHAPDFELLMQRADVAMYVAKE
FT                   QRTGVELYAPHKDRNSAARLSLFGELRRALIENELEMFYQPIVALADERVVALEALVRW
FT                   RHRRRGILPPEEFVPMVEQSYLMRSFTHEVIEQTCAQAARWWSEGITLPVAINLSAREL
FT                   LDPTLPESIESGLRRYRLQPKALRLEISERALVSDAEAIIPAIMSLAELGVTVALDDFG
FT                   TGYFTLARLNGLPVGEVKVDGSFVRHVIDDSDSKVVVEAAVDLMNTLGLRAIAEGVENA
FT                   EQVEAVRALGCYAAQGRYFTPPLDAGAVTGWLLEHGDLAISPSASSTGTSWPHSGMRPP
FT                   TTPQQP"
FT   gene            697352..697651
FT                   /locus_tag="Tfu_0605"
FT   CDS             697352..697651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0605"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54643"
FT                   /db_xref="GOA:Q47SC4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54643.1"
FT                   /translation="MSAITRDEVAHLARLARLALPEDELDQLAAQLDVIISAVAKVQEV
FT                   AKGDIPPTSHALPLTNVYRPDEVKPGLTPDQALAEAPAVEDGRFRVPQILGEEG"
FT   gene            697648..699144
FT                   /locus_tag="Tfu_0606"
FT   CDS             697648..699144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0606"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54644"
FT                   /db_xref="GOA:Q47SC3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54644.1"
FT                   /translation="MTELLKLSAAELGAAIASGETSAVEATQAYLDRIAEVDGQIHAFL
FT                   HVAADKALEQARAVDARRAAGEKLGPLAGVPVAHKDVFTTKDMPTTAASKILEGWQSPY
FT                   DATVTERLRDAGLVILGKTNLDEFAMGSSTENSAYGPTRNPWDTDRVPGGSSGGSSAAV
FT                   AAFEAPLATGTDTGGSIRQPAAVCGLVGAKPTYGTSSRYGLIAFASSLDTPGPIARNVL
FT                   DAALLHEAFSGHDPRDSTSVNEPVPPVVEAARRADVSGMRIGVVKELSGEGYQPGVMQR
FT                   FTEAVELFESLGAKIVEVSCPSFTAALAAYYLIAPSECSSNLARFDAMRYGLRVGDDGT
FT                   RSADEVMALTRAQGFGPEVKRRIILGTYALSSGYYDAYYGSAQKVRTLIKRDFEAAFQQ
FT                   ADVLVSPTTPTTAFRLGERIDDPMAMYLADLCTIPTNLAGNAALSVPCGLAPEDNMPVG
FT                   LHIMAPTLADDRAYQAGAAVEAALRDKWGGDLLSQCAYAV"
FT   gene            complement(699303..700547)
FT                   /locus_tag="Tfu_0607"
FT   CDS             complement(699303..700547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0607"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54645"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54645.1"
FT                   /translation="MLTTDSSSRTPRGVRRALVTVAGTATAAFLAFGMSAAPAFADHYS
FT                   GGADAQYTGNVASGHTLSFDRGSVGTVLFQLTLSDGTKIPAYCIDFETPIRSKAKYEEG
FT                   DWSEYPGEGEFANSQPGKVLWILQNSYPELSADQLSERTGIKDLTAKDALSATQAAIWH
FT                   FSNGVNLKEKGTPKKVWKLYNYLIENATEIQQAPASLTISPNEASGESGGLIGEFTVST
FT                   TASSVPLTLNGPEGVQTVDLEGNPVTEVGNEDKFSVLVPEGTADGEATVSASVSATVEI
FT                   GRLFKGLQGDPPTQTLITADKAETTASAEVKVTWTAPAPSDDETPGDDETPGDDETPGD
FT                   DETPGDDETPTPGDDETPPATESPKPTPPADDKPGLPVTGAALGGLIAAAVVAVGGGGA
FT                   AMYLARKRKSNADDA"
FT   sig_peptide     complement(700422..700547)
FT                   /locus_tag="Tfu_0607"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 42"
FT   gene            complement(701101..702267)
FT                   /locus_tag="Tfu_0608"
FT   CDS             complement(701101..702267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0608"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54646"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54646.1"
FT                   /translation="MPSLLSRVRSGLCAATAAILLACWGPSLPAAAESTSIARVDRNGT
FT                   PGENVHFTNGESATTTLFELRVDDDTTVAAYCVDVSRNVDYTAAYTMAEWPQLPGAAHA
FT                   GKIVWIVRNSYPVLPLEEVAEHSGIDGLSAEQAIAGTQAAIWHFSNGIQLRPPGFGDSG
FT                   AAHVHALYRYLLDHATPVAEPDAPLGLVPTEVVGETSSSLGPLTVHTTGDAPVRLTVNG
FT                   IGEAALVDADGSPVFEARDGDEILLALPADVEEGTATVYARTDQAEILPGLVYTGKDGV
FT                   QTQPLVVADTATIALTVAARVSWNAPDSAASASPSGSPSDAPAPEQSASAPAPTPPAEP
FT                   AAPIVAEDKRIEADLPLTGTWLGAVLAGALALLGLGAVLILVTWRRRR"
FT   sig_peptide     complement(702169..702267)
FT                   /locus_tag="Tfu_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.837 at
FT                   residue 33"
FT   gene            702629..704182
FT                   /locus_tag="Tfu_0609"
FT   CDS             702629..704182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0609"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54647"
FT                   /db_xref="GOA:Q47SC0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54647.1"
FT                   /translation="MGSAVTSDHSAKGGATALMPYDEVLRGYEPVLGLETHVELGTRSK
FT                   MFCSCATTFGAEPNTQVCPVCLALPGALPVVNSAAVESAIRLGLALNCSIAEWCRFARK
FT                   NYFYPDMPKNYQISQYDEPLCYDGYLDVTVDTPEGPREFRIGIERVHMEEDTGKTSHVG
FT                   GADGRIHGAEYSTVDYNRAGIPLLEIVTKPIEDAGEWAPQVARAYVRELRDLIRALGIS
FT                   DVRMEEGSLRCDVNVSLKPRGSTEWGTRTETKNVNSLRSIERAVRHEIERQGGVLSAGG
FT                   RVVQETRHFQESTGTTVAGRSKEEAQDYRYFPDPDLVPVAPDREWVEQLRATLPELPSA
FT                   KRRRLKAEWNLTDKELQDLVNANAVDLVEQTVAAGAPPAEARKWWLNDLSRRATETGVE
FT                   LSELPITPAQVARVVELVAEGSLTNKLARQVVDGVLAGEGEPDEVVEARGLRVVSDDAA
FT                   LGAIVDQAIANNADAAEKVRNGKIAAVGALVGAVMRETKGQADAGRARQLILERLGVSG
FT                   "
FT   gene            704595..707300
FT                   /locus_tag="Tfu_0610"
FT   CDS             704595..707300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0610"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54648"
FT                   /db_xref="GOA:Q47SB9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54648.1"
FT                   /translation="MKGGTRVWLSAILGLFMSYVLGTLVRVGEVPLTVWAGTWPTAVAA
FT                   AGAAAALLYAARARMRVEGADGDVPDSAGALRLFGFAALAWCAGSITYGVTGLLNAGAF
FT                   SLTFGDLFSLVALPLFTVGFLRFAPLPRRPRALVRHVTDSYVCAAAVFSTVWLVLFQPL
FT                   YQELGGNAGAMAFALVYPVTDIAVVCLLAPLVLTSPHSTRRAVLLAMGAFVTICAADLI
FT                   GAVGRLSGEAVAGGIEYPVRLLGFLLLGAIPAVVKRKPGTAPRRITGRGLYRVAPEIAA
FT                   VTALSTAAVVITIAGLRAEGIAPVLPLTAGSAVLVLLVRMVGLMDETTVLARIVQTRER
FT                   HLHDLAEHSGDIIVILEEDCRICYMSPGAGAMFGYRDGDPLLAEPVTSLVHPEDLPDLA
FT                   AAAAELRNGAESARVRARVRAADGTWRHTTSTVSVYERPGEPVRFLLTTRDISAQVELQ
FT                   KQVDHLTFHDGVTGLPNRAYLEERVREVLSGHAEAEGGREQPEVAVIFLDLDGFTAVND
FT                   SAGHAFGDYLLAQVGHRLRAVLDTGDTLARWGSDEFVALVEDRPRADSVVDLAERMIQV
FT                   IEGEPFPVADRDVIVTASVGVAFAEPGIDGAELLRNADMAMARAKEHGGGRVEVYAAHM
FT                   HAQVVERLELQTELRQALAEHAFVLEYQPVVSLETSQVTAVEALVRWRRADGSLVPPEE
FT                   FLGPAEESGLIVPLGEWILREACQKVAVWRATTGLDIGLSVNVSARQVLSAGFVQSVEE
FT                   VLAESGLNAEALTVEVDEEVLLENPVVAAEHLTKLRELGVRLAVDDFGMGHASLSHLRR
FT                   LRVDEIKIDPSFVRDLDADETVTLLTRTLIRLGQDLGVQVVAEGIEHPWQLRRLREMGC
FT                   AYGQGFLVGRPMDAAGVEALVGGETNAAAL"
FT   sig_peptide     704595..704732
FT                   /locus_tag="Tfu_0610"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.912) with cleavage site probability 0.375 at
FT                   residue 46"
FT   gene            707643..709412
FT                   /locus_tag="Tfu_0611"
FT   CDS             707643..709412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0611"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54649"
FT                   /db_xref="GOA:Q47SB8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54649.1"
FT                   /translation="MTEQMTGAQSLIRALEHVGVDVVFGIPGGAILPAYDPLYDSTKVR
FT                   HILMRHEQGAGHAAEGYAYATGRPGVCIATSGPGATNLVTPLADAYMDSVPVVAITGQV
FT                   ASPAIGTDAFQEADICGITMPITKHNFLVRDPSKIASTIAEAFHIASTGRPGPVLVDIA
FT                   KDALQAQTRFEWPQRPELPGYRPVTKPHGKQVREAARLIAEAKRPVLYVGGGVFKSGAS
FT                   KELRVLAELTGIPVVTTLMALGTFPSSHPQNLGMPGMHGTVAAVGALQRADLIVALGAR
FT                   FDDRVTGKLSSFAPHATIVHADIDPAEISKNRYADVPIVGDCREVIADLIVAVRADQAA
FT                   GRQGDYTAWWEQLNRMRETYPLGYTEPEDGSLAPQYVIKRIGQIVGPDATYVAGVGQHQ
FT                   MWAAQFIDHQRPGSFVNSGGAGTMGFAIPAALGAKVGDPDRVIWAIDGDGCFQMTNQEL
FT                   ATCAIEGIPIKVAVINNGNLGMVRQWQTLFYDGRYSNTNLHTAPTPEDGKVRIPDFVRL
FT                   AEAYGCVGLRCDRAEDVDATIEKAMAINDVPVVIDFTVHHDAMVWPMVPAGVSNDDIQY
FT                   ARDMAPEWDDEEE"
FT   gene            709426..709950
FT                   /locus_tag="Tfu_0612"
FT   CDS             709426..709950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0612"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54650"
FT                   /db_xref="GOA:Q47SB7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54650.1"
FT                   /translation="MSLHTLSVLVEDTPGVLARVASLFSRRGFNIHSLTVGPTEYEGLS
FT                   RMTIVVNCDRHPLEQVTKQLNKLVNVIKIVEMDPEASVRRELLLIKVKADSSNRSHVLE
FT                   TAQLFRANVVDVNPDVVVIEATGQPEKLQALIRNLEPFGIKELVKSGVVALGRGPRSIT
FT                   DRSLRVVERSA"
FT   gene            710070..711065
FT                   /locus_tag="Tfu_0613"
FT   CDS             710070..711065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0613"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54651"
FT                   /db_xref="GOA:Q47SB6"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54651.1"
FT                   /translation="MAAQMYYDDDADLNIIQGRTVAVIGYGSQGHAHALSLRDSGVDVR
FT                   VGLPESSKSRAKAEEDGLRVVTPAEAAQEADLIMILVPDHIHRDLYANEIAPHLNEGDA
FT                   LFFGHGFSIRYGLITPPEGVDVAMVAPKGPGHLVRRQFEAGRGVPVLVAVEKDASGSAW
FT                   DLALSYAKAIGGTRAGALKTTFKEETETDLFGEQAVLCGGVSELIKAGFATLVEAGYQP
FT                   EVAYFECLHEMKLIVDLMYEGGISKMYWSVSDNAEYGGYTRGPRVITESTREEMRKILQ
FT                   EVQDGTYAKELVEEFDKGRPNFLKRREAEQGEQIEKVGTELRSLMSWLKN"
FT   gene            711305..712891
FT                   /locus_tag="Tfu_0614"
FT   CDS             711305..712891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0614"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54652"
FT                   /db_xref="GOA:Q47SB5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54652.1"
FT                   /translation="MPKPVVLVAEELSPAGIALLEEDFEVRHVNGADRSQLLPALAGVD
FT                   ALIVRSATKVDAEVLAAAPSLKVVARAGVGLDNVDVEAATKAGVLVVNAPTSNIISAAE
FT                   QAINLLLATARNTAAAHAALVRGEWKRSKYTGVELYDKTVGIVGLGRIGVLVAQRLQAF
FT                   GTKLIAYDPFVQPARAAQLGVELVELDELLERSDFITIHLPKTKDTIGLIGEEELRKVK
FT                   PTVRIINAARGGIVDETALYHALKEGRVAGAGLDVFAKEPCTDSPLFELENVVVAPHLG
FT                   ASTHEAQEKAGTQVARSVKLALAGEFVPDAVNIQGKGVAEDIKPGLPLTEKLGRILAAL
FT                   ADGAITRVEVEVRGEIVAHDVKVIELAALKGLFTDIVEEAVTYVNAPLVAKERGIEVSL
FT                   TTEEESPDWRNVITVRAILSDGQRVSVSGTLTGPRQLEKLVEVNGYTMEIAPSEHMAFF
FT                   SYHDRPGVVGVVGQLLGQAQVNIAGMQVSRDKEGGAALIALTVDSAIPDETLETISKEI
FT                   GAEISRVDLVD"
FT   gene            713595..714659
FT                   /locus_tag="Tfu_0615"
FT   CDS             713595..714659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0615"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54653"
FT                   /db_xref="GOA:Q47SB4"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR023698"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SB4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54653.1"
FT                   /translation="MSARTVKLAVIPGDGIGPEVVAEGLKVLSAVAPRHGLTLDTTEYE
FT                   LGAQRWHATGEVLPDAVEEELRQHDAILLGAVGDPTVPSGVLERGLLLRLRFNFSHYVN
FT                   LRPVRLYPGVTTPLAGVAPEDIDMLVVREGTEGPYAGMGGVLRKGTPHEIATQDSVNTR
FT                   LGVERVVRYAFAKAAERPCHKLTLVHKDNVLTYAGELWQRVVREVGAEYPQVEVDYLHV
FT                   DAATMFFVTQPRRFDVVVTDNLFGDIITDLGAAVAGGIGLAASGNINPEGDFPSMFEPV
FT                   HGSAPDIAGQGKADPTATILSVSLMLEHLGYADAAAQIDQAVAEDLQERAKNGGVRSTT
FT                   QIGDDIAQRVAEQG"
FT   gene            714869..715990
FT                   /locus_tag="Tfu_0616"
FT   CDS             714869..715990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0616"
FT                   /product="branched chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54654"
FT                   /db_xref="GOA:Q47SB3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54654.1"
FT                   /translation="MSNGTTTSGLTFDIRLSTERKTPQEREAILENPGFGKVFTDHMVT
FT                   IRYTADRGWHDARLEPYGPLSLDPATSVLHYAQEIFEGLKAYRHPDGSIACFRPEANAA
FT                   RFNSSAKRMAMPELPEELFLGAIDTLLTYDGDWVPTQADTSLYLRPFMISTDVGLGVNS
FT                   PSSSYLFVLIASPSGGYFANGVKPVTVWLCEDYTRAAPGGTGAAKFGGNYAASFLAQAQ
FT                   AVEQGCDQVVWLDAVEHRWVEEMGGMNLFFVFGSGENARLLTPELTGTLLPGITRDSLL
FT                   KLAPDLGYPVEEGRISTDEWREAAASGELTEVFACGTAAVITPVSHVKSRQGEFQIGDG
FT                   TPGPITMRLREELVGLQYGTRPDSHGWIRKFGR"
FT   gene            716285..717868
FT                   /locus_tag="Tfu_0617"
FT   CDS             716285..717868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0617"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54655"
FT                   /db_xref="GOA:Q47SB2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54655.1"
FT                   /translation="MLDDSFHVFDTTLRDGAQREGINFTVADKLAVAKLLDEFGVGFIE
FT                   GGWPGANPKDTEFFRRAQTELSLKHAQLTAFGSTRRAGTTAAKDPQVLALRDSGAPVVT
FT                   LVAKSDDRHVELALRTTLEENLEMIADTVSFLLGQGQRVFVDCEHFFDGYRHNPEYALR
FT                   VVRTAAEAGASVVVLCDTNGGMLPSDVFQIVSEVREATGARLGIHAQDDSGCAVANTLA
FT                   AVDAGATHVQCTANGYGERVGNANLFSVVPALVLKRGRNVLPEGCLREMTRVSQAIAEI
FT                   ANIAPATHQPYVGISAFAHKAGLHASAIKVDPDLYQHIDPALVGNDMRMLVSDMAGRAS
FT                   VELKAKELGVDLSGDRETLGRIVERVKDMEMAGYSFEAADASLELLLREEIGQPVRYFE
FT                   VESWRTISERRPDGSSASEATVKLYVKGERVVATGEGNGPVNALDRALRSALESVYPDL
FT                   ATMELVDYKVRILEGTSGTDAVTRVLIDCSDGQGEWTTVGVGENVIEASWTALEQALTY
FT                   GLLRRGYTQQ"
FT   gene            complement(717936..718709)
FT                   /locus_tag="Tfu_0618"
FT   CDS             complement(717936..718709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0618"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54656"
FT                   /db_xref="GOA:Q47SB1"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54656.1"
FT                   /translation="MTAQKAGRPRRTGRHRRRQLPVGTIAGLIVALSGVGMVSANVLPW
FT                   EPSDPASVVPATSQGSSSPMTPEPSPSPVPPLLRSVVEEVPSASGELRVVEGDGEVVGE
FT                   GTLLRYLVEVEEGLPGDPADFAAAVEHVLSDPRSWTHDGTLAFQRVDEEPVDFRVTLAS
FT                   PETVDQQCAPLQTNGYVSCFSGERAMINQNRWVSGVPHFDGDLETYRAYVINHEVGHAL
FT                   GYGHVDCPAPGEPAPVMQQQTFGLQGCEKNGWVSP"
FT   sig_peptide     complement(718587..718709)
FT                   /locus_tag="Tfu_0618"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.806 at
FT                   residue 41"
FT   gene            complement(718836..719174)
FT                   /locus_tag="Tfu_0619"
FT   CDS             complement(718836..719174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0619"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54657"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54657.1"
FT                   /translation="MASVVKFNVLTVPPGAGATLEERFAKRAGLVENQPGFEEFQLLRP
FT                   VDGTDKYIVYTRWRSEEDYQNWLNSEAFQRGHAQASEDSRRSSQGGPAASASELWSFEV
FT                   VQHVQAQD"
FT   gene            complement(719475..721265)
FT                   /locus_tag="Tfu_0620"
FT   CDS             complement(719475..721265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0620"
FT                   /product="cellobiohydrolase. Glycosyl Hydrolase family 6"
FT                   /EC_number="3.2.1.91"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54658"
FT                   /db_xref="GOA:Q47SA9"
FT                   /db_xref="InterPro:IPR001524"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="PDB:4AVN"
FT                   /db_xref="PDB:4AVO"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SA9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54658.1"
FT                   /translation="MSKVRATNRRSWMRRGLAAASGLALGASMVAFAAPANAAGCSVDY
FT                   TVNSWGTGFTANVTITNLGSAINGWTLEWDFPGNQQVTNLWNGTYTQSGQHVSVSNAPY
FT                   NASIPANGTVEFGFNGSYSGSNDIPSSFKLNGVTCDGSDDPDPEPSPSPSPSPSPTDPD
FT                   EPGGPTNPPTNPGEKVDNPFEGAKLYVNPVWSAKAAAEPGGSAVANESTAVWLDRIGAI
FT                   EGNDSPTTGSMGLRDHLEEAVRQSGGDPLTIQVVIYNLPGRDCAALASNGELGPDELDR
FT                   YKSEYIDPIADIMWDFADYENLRIVAIIEIDSLPNLVTNVGGNGGTELCAYMKQNGGYV
FT                   NGVGYALRKLGEIPNVYNYIDAAHHGWIGWDSNFGPSVDIFYEAANASGSTVDYVHGFI
FT                   SNTANYSATVEPYLDVNGTVNGQLIRQSKWVDWNQYVDELSFVQDLRQALIAKGFRSDI
FT                   GMLIDTSRNGWGGPNRPTGPSSSTDLNTYVDESRIDRRIHPGNWCNQAGAGLGERPTVN
FT                   PAPGVDAYVWVKPPGESDGASEEIPNDEGKGFDRMCDPTYQGNARNGNNPSGALPNAPI
FT                   SGHWFSAQFRELLANAYPPL"
FT   sig_peptide     complement(721149..721265)
FT                   /locus_tag="Tfu_0620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.816 at
FT                   residue 39"
FT   gene            721840..722643
FT                   /locus_tag="Tfu_0621"
FT   CDS             721840..722643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0621"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54659"
FT                   /db_xref="GOA:Q47SA8"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SA8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54659.1"
FT                   /translation="MRIARFSAGDDVGFGLVDTDDEGNQFVTRMKSHPLVGPIQLTGER
FT                   TKLEDVRLLSPILPTKIVCIGKNYADHIAEMGGSAEDERDPKEPVVFLKPSTAVVGPND
FT                   PVFHPKLSSRVDYEGELAVIIGRLCREVPAERAKDVIFGYTIGNDVTARDLQQADHQWT
FT                   RAKGFDSFCPLGPWIETGLSVEEASQLRITTTVDGEVRQDGNTGQMIHSIPEIISYVSS
FT                   FMTLLPGDVILTGTPAGVGPVRVGQRMTVAIDRIGELSNPVVARD"
FT   gene            complement(722856..724175)
FT                   /locus_tag="Tfu_0622"
FT   CDS             complement(722856..724175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54660"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54660.1"
FT                   /translation="MTGHDPTGPPTSDDAGTHEPRESTAPAQPAPPSLRGPVRPGERAL
FT                   APDLARGFMLLLIVLANSTWYLWAASPGELSIHPSDGSLLDRIVQGVLITAVDARTYPI
FT                   FAFLFGYGMVQLWLRQRAAGATERDVRALLRRRNLWLLVFGFVHAALLWLGDVLGAYGF
FT                   AGLIFGWLFLRRTDRTLLVWSGIFTGLLAALTALSVLAFIVAPEGAAPAEPAESGSPSW
FT                   FPSSELNAEENYLASMVLRIQVWAFLVVGQGLLTISVPIAILLGFWAARRRILEEPGNH
FT                   LRLLRITAAVGIPLGWLTGLLHALDHVGILSLSAEESVAVASIASTTGIATGLGYVALF
FT                   GLIAHRLSRRTSRGPVLTALTAVGKRSLSCYLAQSVLCAPVLTAWGLGLGAHLHSATMA
FT                   LFATGVWLVTVLLSYLQERAGQRGPAEVLLRRLSYRASYS"
FT   gene            724678..726111
FT                   /locus_tag="Tfu_0623"
FT   CDS             724678..726111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0623"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54661"
FT                   /db_xref="GOA:Q47SA6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54661.1"
FT                   /translation="MTDKAIRTRFAPSPTGMFHVGGARSALFNWALALQQPEGKFVLRI
FT                   EDTDAARNRPEWTEGILRALSALGIDERDPHFEGPYFQSAYADKHREVAEELYRKGRAY
FT                   YCDCTREQIQERRGNPHLGYDGYCRDRGLEPGPGRALRFRVPEGGPTVVDDKIRGRVEF
FT                   DHSAIEDFVIARSDGSPLFVLANVVDDVEMAITHVVRGEEHLSNTPKQQLLWEALGQTP
FT                   PVWAHLPVIVNEKRQKLSKRRDKVALEDYLAEGYLPEAMVNYLMLLGWGPGDDREIMPF
FT                   SEMVPLFRLEDVNSSSAFFDEKKLRAFNGEYIRALDTTEFVERCAPWLGSEKAPWPAEN
FT                   FDAQVFEAVAPLAQTRISVLSEIVSYVDFLFLDRPVEDEKSWAKAMKPGVGEEMLTAAL
FT                   ERFSDPNLEWRAEPLKAALEEVAAAQGLKLGKAQAPVRVAVTGRTVGLPLFESLELLGR
FT                   SRVQERLRAALEKLKAAGE"
FT   gene            726244..726315
FT                   /locus_tag="Tfu_R0014"
FT   tRNA            726244..726315
FT                   /locus_tag="Tfu_R0014"
FT                   /product="tRNA-Gln"
FT   gene            726378..726450
FT                   /locus_tag="Tfu_R0015"
FT   tRNA            726378..726450
FT                   /locus_tag="Tfu_R00