spacer

EBI Dbfetch

ID   BX322232; SV 4; linear; genomic DNA; STD; MAM; 4001 BP.
XX
AC   BX322232;
XX
DT   01-APR-2003 (Rel. 75, Created)
DT   17-MAY-2007 (Rel. 91, Last updated, Version 5)
XX
DE   Pig DNA sequence from clone PigI-446E4
XX
KW   FK506; FKBPL; HTG.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-4001
RA   Sehra H.;
RT   ;
RL   Submitted (17-MAY-2007) to the INSDC.
RL   Wellcome Trust Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK.
RL   E-mail enquiries: vega@sanger.ac.uk Clone requests:
RL   clonerequest@sanger.ac.uk
XX
DR   MD5; b6e49135336855bcfd6042cfaf36cb5e.
DR   Ensembl-Gn; ENSSSCG00000001431; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000001576; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000034571; sus_scrofa.
DR   Ensembl-Tr; ENSSSCT00000034820; sus_scrofa.
XX
CC   -------------- Genome Center
CC   Center: Wellcome Trust Sanger Institute
CC   Center code: SC
CC   Web site: http://www.sanger.ac.uk
CC   Contact: vega@sanger.ac.uk
CC   --------------
CC   
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats;
CC   all regions were covered by at least one subclone; and the assembly was
CC   confirmed by restriction digest, except on the rare occasion of the clone
CC   being a YAC.
CC   
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases:
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP;
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
CC   
CC   PigI-446E4 is from a INRA Porcine BAC library
CC   VECTOR: pBeloBAC11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4001
FT                   /organism="Sus scrofa"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="SBAB"
FT                   /clone="PigI-446E4"
FT                   /db_xref="taxon:9823"
FT   mRNA            join(504..758,1647..1994,AL773560.9:1..>137)
FT                   /gene="FKBPL"
FT                   /locus_tag="SBAB-446E4.1-002"
FT                   /product="FK506 binding protein like"
FT                   /note="match: ESTs: Em:BP464203.1"
FT   mRNA            join(1172..1395,1647..1994,AL773560.9:1..800)
FT                   /gene="FKBPL"
FT                   /locus_tag="SBAB-446E4.1-001"
FT                   /product="FK506 binding protein like"
FT                   /note="match: ESTs: Em:AW249277.1 Em:AW652378.1
FT                   Em:AW652384.1 Em:BE889603.1 Em:BF389385.1 Em:BQ230624.1
FT                   Em:CK454585.1 Em:CK455632.1"
FT                   /note="match: cDNAs: Em:AK027119.1 Em:BC004168.2
FT                   Em:BC011966.1"
FT   CDS             join(1721..1994,AL773560.9:1..>137)
FT                   /gene="FKBPL"
FT                   /locus_tag="SBAB-446E4.1-002"
FT                   /standard_name="OTTSUSP00000000736"
FT                   /product="FK506 binding protein like"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A5A8W2"
FT                   /protein_id="CAN13310.1"
FT                   /translation="METPPVSPLGEKNISQPQQRWKKNSQKILDSTTQIRQQPQDPSTE
FT                   LLEGRVSPDPAGQILENLQEIEKLAVGREGDSDKSHGPASEMPEPLQASELWYCPDGSF
FT                   VKKILIHGHGLDKPKLGSRCRVQVLGFPLGSGL"
FT   CDS             join(1721..1994,AL773560.9:1..776)
FT                   /gene="FKBPL"
FT                   /locus_tag="SBAB-446E4.1-001"
FT                   /standard_name="OTTSUSP00000000735"
FT                   /product="FK506 binding protein like"
FT                   /note="match: proteins: Tr:O35450 Tr:Q9H5G3 Tr:Q9UIM3"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A5A8W3"
FT                   /protein_id="CAN13311.1"
FT                   /translation="METPPVSPLGEKNISQPQQRWKKNSQKILDSTTQIRQQPQDPSTE
FT                   LLEGRVSPDPAGQILENLQEIEKLAVGREGDSDKSHGPASEMPEPLQASELWYCPDGSF
FT                   VKKILIHGHGLDKPKLGSRCRVQVLGFPLGSGLPEGWTELTMGLGPWREETWGELVEKC
FT                   LESMCQGEEAELQLPGRSGPPVRLKLASFTQGRDSWELEPTEKEALAREERARGTELFR
FT                   AGNPEGAARCYGRALRLLLTLPPPGSPERTVLHANLAACQLLLGQPHLAAQSCDRVLER
FT                   EPGHLKALYRRGVAQAALGNLDKATADLKKVLAVDPKNRAAQEELGKVIIQGKKQDAGL
FT                   AQGLRKMFG"
FT   misc_feature    1995
FT                   /note="Clone_left_end: XX-BS514B12"
FT   misc_feature    2000
FT                   /note="Clone_right_end: XX-BS649D6"
XX
SQ   Sequence 4001 BP; 966 A; 956 C; 1198 G; 881 T; 0 other;
     ggggaagagg gagggagaaa aggtagatta attttcaata agaacataag gattccacga        60
     atcggagtat tcagccttag tcacagtgga ctaaggttac tctggcacag aacccagaaa       120
     taaaacttga ggaaaaaaag tctaggttag tgagctgagg ctcaacacaa aacgaaaagg       180
     actgttttgg cacaaatctg tagctaatga tgaaattacc tcccctcctg gctgtcctgg       240
     catggttctt atagtctggg gcacaatggt ggggtgttac agagcagact ggagagggag       300
     ccaaaatgag gaactgagag tggggttctc ctttccagaa ctgtggtggc ccagcctgtg       360
     cagggagctg ggcaagcaag gctgaaccac agagggacca gcacctttca ctaggaagag       420
     gaggaccggt tttccactga cacttccagt ggagcaggtt ataccagtta tatatgtaaa       480
     atataagaca aactaaaggg gcacagacca aagggtgaag agaatgggat gaagttattc       540
     cagaatcatg ttattcaaag tggggtggga ccaagagcag cagcaacaaa gagcctgtta       600
     gaaatgcaga attgcaggcc ccatcttaga cttcctaatt cagaaggcgc catttaacaa       660
     gttcctcaga ggatgtgtat gcacatcgaa gtttgaaaac cactaagatt tcttgaggaa       720
     gaagacttct aaaggcattg atgaacaaga ggggaaaggt aaggcaagcc tcaggtagtt       780
     ccccaaggga ataggacagg ctggggagaa atagagttta tttgttagca ccctggattg       840
     aatgcgcgaa ggagcagaca ggttgattgg ctgggagcct tgagaccagc aatatgaata       900
     gcacaggtgg gcctgaagtc gccatgcggg ccctcgtcgc taccgctatc attcaccacc       960
     agctccacca ttccccaccc tatcctcatt cgccccaatc tcccactcca ggccttctcc      1020
     agactttaac tctcaatagc caggctagct cgacctcgcc tagttcagtt cgatttggcc      1080
     tagttcggtt gctaaggcct ggagcttccc ggttgctggg ggaggggagg gaaatgatgt      1140
     cacgtccaga aggcgggcta accagacctc tccctcctcc cgattggttg ccgggaactt      1200
     gagtagattc gctttcacgc gggctccagg gttagccgtt agtgtctctc ctcagctgtc      1260
     ccctgctccc cctgaccgtc ctctccgccc gaagcaaaac tctaatgaca gtgctcagta      1320
     gagcttagct tcggaaggag aggtgattcg aatggtcggg ctaccgccac caggagaggc      1380
     acttcggccg cccaggtact ttttgactcg ctcgggtatc cgtagttggg acagtggctc      1440
     aagccgcagg gaattgtgga acttatagtt cgaattagtt cggggttggg aggtaggctc      1500
     gaatccgaca gagattttga ggagggggga aaaaaaaaga gagaacttta aggaccggag      1560
     gcctggatcc cagaaggaca gaaaagaagt ctaaataaga ttcctgccaa tagcattgtt      1620
     ttgatttttt tttctttttt aatcaggtgc tgatctgaat ctgatccata cctttctgac      1680
     caaaactgtt tacccacggt ggaagggact gggtacccaa atggagacgc caccagtcag      1740
     tccactggga gagaagaaca tttctcaacc gcaacaacga tggaaaaaga actcccagaa      1800
     gatccttgat tcaactactc agattaggca gcagccccaa gacccttcta ctgaacttct      1860
     tgaggggaga gtgagcccag atccagccgg ccaaattcta gaaaatcttc aagaaattga      1920
     aaagctggcc gttggacgtg aaggagattc tgataaatct catggaccag ccagtgagat      1980
     gccagagccc cttcaagctt ctgaactctg gtactgcccc gatgggagct ttgtcaaaaa      2040
     gatcctaatc catggccacg gcttggacaa acccaagctg ggctcccgct gccgggtaca      2100
     ggttttggga tttcctttgg ggtcagggct gccagagggc tggacagagc taactatggg      2160
     gttaggccca tggagggagg aaacttgggg agagcttgta gagaagtgct tggagtccat      2220
     gtgtcaaggt gaggaggcag aacttcagct ccctgggcgc tctggacctc ctgtcaggct      2280
     caaactggcc tccttcactc aaggccggga ctcctgggag ctagagccca ccgaaaagga      2340
     ggccctggcc agggaagaac gtgcacgggg cacagaatta tttagagctg ggaaccctga      2400
     aggggctgcc cgatgctatg gacgggctct tcggctgctg ctgactttac ctccacctgg      2460
     ctctccagaa cgaactgtcc ttcatgccaa tctggctgcc tgtcagttgc tgctagggca      2520
     gccccatttg gcagcccaga gctgtgaccg ggtgctggag cgggagcctg gccatttaaa      2580
     ggccttgtac cgaagggggg ttgcccaggc tgctcttggg aacctggaca aagcaactgc      2640
     tgacctcaag aaagtgctgg cagtagaccc caaaaatcgg gcagcccagg aggagctggg      2700
     aaaggtgatc attcaaggga agaaacaaga tgcaggactg gctcagggac tgcgcaagat      2760
     gtttggctaa ttaaaagtta aaccttaaaa gagacaggaa cctgtgaatt gtggtctatg      2820
     ttgtgagttt tggggggagg ggccagtggg aggatttcac ccacatactt ttaccagctt      2880
     ttgccttcct agggaaggta gcagtggtct tagtgtatgt acctctttac cgttttacca      2940
     tgaaaaagcc ttatggtcac gtgtggtata ttttgcgggg cttatctatc tccaaagatg      3000
     aacacaagct atctaaactt ctaaattcag tactgtttgg gggagacggc gaaccttcaa      3060
     aacccggtac ctacgtttcc taggcgcttt caggctgggt ccggcttggc gcacgcgcaa      3120
     acttcactgc ctggtattgc ggaggtgcta gcctccgggg cgctcgtatt ggccggtcct      3180
     gtacagccac cgcctctatt gtctcacgtg ctcaataccc aggtctctta ctggttggga      3240
     gagcttccgg ggcgttcccc cacttttgag gagccagccg attagttgat gatgggagag      3300
     gcgggccttg ggaactgtct cgtggttggg gggtgggggg gaaagatggc ggagctgatg      3360
     ctcctcagcg agattgcgga cccgacgcgt tttttcaccg acaacttgct gagcccggag      3420
     gactggggtg tgcggagtga ggcctcgggg aggggagggg gctgtggcat attgtgcccc      3480
     tgaggcacgc aggaggaagc ggaggcccaa agaggaaggc tggacagata cggaatccat      3540
     cattctgagg aaggcggaac aggggggctg gtggtgcttt cggggagatg cgggagttgg      3600
     ggcagacctc ccctccctgc ggaaatatgg agttgttccg gggtcgggga aggaggggct      3660
     ggagttctct ggctggatca cttttcaagt gggcgggcgg tggatctggc cgcgcagagg      3720
     cagtgagcga cggggcgagg gctgttgtgg ggttccgaag gctgcgctag cggacgactc      3780
     cgctgaccct ccgcccctct tgcagacagc accttgtacg ccggcctgga tgaagtggcc      3840
     gaggagccga cgcagctttt ccgttgcccg gaggaagatg tcccggtatc gctccccggg      3900
     ccttggcctt gactcttacc cttggtgggt ggaagtggtc tcagaactgg ggcttatccc      3960
     caggccagag ctcatccgga gccatccctt cagcctcaca c                          4001
//


spacer
spacer