spacer

EBI Dbfetch

ID   BN001304; SV 1; linear; genomic DNA; STD; FUN; 2831538 BP.
XX
AC   BN001304;
XX
PR   Project:PRJEA40559;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   02-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   TPA: Aspergillus nidulans FGSC A4 chromosome IV
XX
KW   Third Party Data; TPA; TPA:reassembly.
XX
OS   Aspergillus nidulans FGSC A4
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
XX
RN   [1]
RG   the Eurofungbase Aspergillus nidulans re-annotation project
RA   Mabey Gilsenan J.;
RT   ;
RL   Submitted (09-SEP-2009) to the INSDC.
RL   Mabey Gilsenan J.E., School of Medicine, University of Manchester, ERC,
RL   University Hospital of South Manchester, Manchester, M23 9LT, UK
XX
RN   [2]
RP   1-2831538
RA   Russo Wortman J., Mabey Gilsenan J., Joardar V., Deegan J., Clutterbuck J.,
RA   Andersen M.R., Archer D., Bencina M., Braus G., Coutinho P., von Dohren H.,
RA   Doonan J., Driessen A.J.M., Durek P., Espeso E., Fekete E., Flipphi M.,
RA   Garcia Estrada C., Geysens S., Goldman G., de Groot P.W.J., Hansen K.,
RA   Harris S.D., Heinekamp T., Helmstaedt K., Henrissat B., Hofmann G.,
RA   Homan T., Horio T., Horiuchi H., James S., Jones M., Karaffa L.,
RA   Karanyi Z., Kato M., Keller N., Kelly D.E., Kiel J.A.K.W., Kim J-M.,
RA   van der Klei I.J., Klis F.M., Kovalchuk A., Krasevec N., Kubicek C.P.,
RA   Liu B., MacCabe A., Meyer V., Mirabito P., Miskei M., Mos M., Mullins J.,
RA   Nelson D.R., Nielsen J., Oakley B.R., Osmani S.A., Pakula T., Paszewski A.,
RA   Paulsen I., Pilsyk S., Posci I., Punt P.J., Ram A.F.J., Ren Q.,
RA   Robellet X., Robson G., Seiboth B., van Solingen P., Specht T., Sun J.,
RA   Taheri-Talesh N., Takeshita N., Ussery D., vanKuyk P.A., Visser H.,
RA   van der Vondervoot P.J.I., de Vries R.P., Walton J., Xiang X., Xiong Y.,
RA   Ping Zeng A., Brandt B.W., Cornell M.J., van den Hondel C.A.M.J.J.,
RA   Visser J., Oliver S.G., Turner G.;
RT   "The 2008 update of the Aspergillus nidulans genome annotation: A community
RT   effort";
RL   Fungal Genet. Biol. 46(1):S2-S13(2009).
XX
DR   MD5; 8b3f08681e021ec5ec57118fdc5860a7.
DR   BioSample; SAMEA2272224.
DR   EnsemblGenomes-Gn; CADANIAG00000246.
DR   EnsemblGenomes-Gn; CADANIAG00000337.
DR   EnsemblGenomes-Gn; CADANIAG00000509.
DR   EnsemblGenomes-Gn; CADANIAG00000595.
DR   EnsemblGenomes-Gn; CADANIAG00000669.
DR   EnsemblGenomes-Gn; CADANIAG00010615.
DR   EnsemblGenomes-Gn; CADANIAG00010630.
DR   EnsemblGenomes-Gn; CADANIAG00010642.
DR   EnsemblGenomes-Gn; CADANIAG00010686.
DR   EnsemblGenomes-Gn; CADANIAG00010718.
DR   EnsemblGenomes-Gn; CADANIAG00010726.
DR   EnsemblGenomes-Gn; CADANIAG00010728.
DR   EnsemblGenomes-Gn; CADANIAG00010743.
DR   EnsemblGenomes-Gn; CADANIAG00010760.
DR   EnsemblGenomes-Gn; CADANIAG00010790.
DR   EnsemblGenomes-Gn; CADANIAG00010822.
DR   EnsemblGenomes-Tr; CADANIAT00000246.
DR   EnsemblGenomes-Tr; CADANIAT00000337.
DR   EnsemblGenomes-Tr; CADANIAT00000509.
DR   EnsemblGenomes-Tr; CADANIAT00000595.
DR   EnsemblGenomes-Tr; CADANIAT00000669.
DR   EnsemblGenomes-Tr; CADANIAT00010615.
DR   EnsemblGenomes-Tr; CADANIAT00010630.
DR   EnsemblGenomes-Tr; CADANIAT00010642.
DR   EnsemblGenomes-Tr; CADANIAT00010686.
DR   EnsemblGenomes-Tr; CADANIAT00010718.
DR   EnsemblGenomes-Tr; CADANIAT00010726.
DR   EnsemblGenomes-Tr; CADANIAT00010728.
DR   EnsemblGenomes-Tr; CADANIAT00010743.
DR   EnsemblGenomes-Tr; CADANIAT00010760.
DR   EnsemblGenomes-Tr; CADANIAT00010790.
DR   EnsemblGenomes-Tr; CADANIAT00010822.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01504; Afu_254.
DR   StrainInfo; 598196; 0.
XX
CC   Aspergillus nidulans FGSC A4 CADRE,
CC   updated by Eurofungbase with contributions from
CC   CADRE (http://www.cadre-genomes.org.uk),
CC   AspGD (http://www.aspergillusgenome.org) and
CC     Ensembl Genomes (http://www.ensemblgenomes.org).
XX
AH   LOCAL_SPAN       PRIMARY_IDENTIFIER   PRIMARY_SPAN   COMP
AS   1-280307         AACD01000128.1       1-280307       c   
AS   280408-419334    AACD01000127.1       1-138927       c   
AS   419435-459726    AACD01000126.1       481-40772      c   
AS   459727-491138    AACD01000125.1       1312-32723     c   
AS   491139-546293    AACD01000124.1       531-55685      c   
AS   546294-551592    AACD01000205.1       1-5299             
AS   551593-679213    AACD01000123.1       816-128436     c   
AS   679214-684190    AACD01000223.1       650-5626       c   
AS   684191-899139    AACD01000122.1       1-214949       c   
AS   899464-913185    AACD01000121.1       1-13722        c   
AS   913286-917209    AACD01000120.1       1-3924         c   
AS   917310-1054286   AACD01000119.1       1011-137987    c   
AS   1054287-1159455  AACD01000118.1       712-105880     c   
AS   1159456-1166176  AACD01000211.1       1-6721         c   
AS   1166277-1440851  AACD01000117.1       1-274575       c   
AS   1440952-2068786  AACD01000129.1       1-627835           
AS   2068887-2377469  AACD01000130.1       1-308583           
AS   2377570-2494357  AACD01000131.1       1-116788           
AS   2494358-2747382  AACD01000132.1       1714-254738        
AS   2750326-2831538  AACD01000133.1       1-81213            
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2831538
FT                   /organism="Aspergillus nidulans FGSC A4"
FT                   /chromosome="IV"
FT                   /strain="FGSC A4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:227321"
FT   misc_feature    1..280307
FT                   /note="contig 1.128 1..280307(-1)"
FT   gene            1268..6235
FT                   /locus_tag="ANIA_07421"
FT                   /old_locus_tag="AN7421.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1268..1275,1334..1410,1821..1862,1941..1970,
FT                   2180..2205,2303..2340,2510..2539,2678..2721,2943..2968,
FT                   3111..3133,3287..3297,3370..3383,3425..3448,3648..3672,
FT                   4009..4038,4187..4195,4243..4354,4583..4598,4774..4783,
FT                   4901..4928,5205..5212,5387..5401,5864..5897,5943..5952,
FT                   6106..6129,6206..6235)
FT                   /locus_tag="ANIA_07421"
FT                   /old_locus_tag="AN7421.4"
FT                   /note="transcript_id=CADANIAT00000001"
FT   CDS             join(1268..1275,1334..1410,1821..1862,1941..1970,
FT                   2180..2205,2303..2340,2510..2539,2678..2721,2943..2968,
FT                   3111..3133,3287..3297,3370..3383,3425..3448,3648..3672,
FT                   4009..4038,4187..4195,4243..4354,4583..4598,4774..4783,
FT                   4901..4928,5205..5212,5387..5401,5864..5897,5943..5952,
FT                   6106..6129,6206..6235)
FT                   /locus_tag="ANIA_07421"
FT                   /old_locus_tag="AN7421.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000001"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000001"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000001"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWA9"
FT                   /protein_id="CBF78409.1"
FT                   /translation="MHCSSLEFLLADRYGSGDPSYSYWRIGTDYQALGKAIRNHLVELR
FT                   LLLDIFRGILQSFAGQIYNNPVCSLNIVCISGYFARLFSLSLKYLAASLAAGIDRCIKQ
FT                   GIKIHAFAFVNRYYIFSTIYFNGCIGLSNSRRCQLSNIYISTGSIEYLDLSDSAKACAV
FT                   LKAVSHLQDFLATTILLSHFFFSDSFLAKGLAIFDSDLFIPVQTSCKSYISQVSVFVGF
FT                   ALAINISQEIAVFNCQFFKALKSAS"
FT   gene            8987..9589
FT                   /locus_tag="ANIA_07420"
FT                   /old_locus_tag="AN7420.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(8987..9077,9174..9254,9297..9430,9557..9589)
FT                   /locus_tag="ANIA_07420"
FT                   /old_locus_tag="AN7420.4"
FT                   /note="transcript_id=CADANIAT00000002"
FT   CDS             join(8987..9077,9174..9254,9297..9430,9557..9589)
FT                   /locus_tag="ANIA_07420"
FT                   /old_locus_tag="AN7420.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000002"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000002"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000002"
FT                   /db_xref="GOA:Q5AWB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB0"
FT                   /protein_id="CBF78411.1"
FT                   /translation="MLLWGLSRASSLLARWVNHNSYLEKITAGPAILDPPWGKAGRQQV
FT                   SLHGLIKDCWRLGGHSSGGAGVAPQLALPAMAVGKSGCGAEIWSKDAKLRTYKLCYYAA
FT                   MSLIREEK"
FT   gene            complement(12345..13757)
FT                   /locus_tag="ANIA_11561"
FT                   /old_locus_tag="AN11561.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(12345..12413,12808..12828,12985..13027,
FT                   13678..13757))
FT                   /locus_tag="ANIA_11561"
FT                   /old_locus_tag="AN11561.4"
FT                   /note="transcript_id=CADANIAT00000003"
FT   CDS             complement(join(12345..12413,12808..12828,12985..13027,
FT                   13678..13757))
FT                   /locus_tag="ANIA_11561"
FT                   /old_locus_tag="AN11561.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000003"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000003"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000003"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCC0"
FT                   /protein_id="CBF78412.1"
FT                   /translation="MTIMHHTPPKELNNINQIQDCRGLEEVSQVMGPWFQVKGVKHRTN
FT                   PKLLGLTDLKLTKYCCLTGAGLAGN"
FT   gene            14428..15154
FT                   /locus_tag="ANIA_07419"
FT                   /old_locus_tag="AN7419.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(14428..15081,15113..15154)
FT                   /locus_tag="ANIA_07419"
FT                   /old_locus_tag="AN7419.4"
FT                   /note="transcript_id=CADANIAT00000004"
FT   CDS             join(14428..15081,15113..15154)
FT                   /locus_tag="ANIA_07419"
FT                   /old_locus_tag="AN7419.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000004"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000004"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000004"
FT                   /db_xref="GOA:Q5AWB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB1"
FT                   /protein_id="CBF78414.1"
FT                   /translation="MAPPYILSAIAKAILINFIEGGVIGFSPRGSIVRPLALALIVLLA
FT                   ASVHCTIIPWEQHRSLAGILSCNSIFIVAHAPDLFFHSGITYNEHYDWLCKTKGYHPPF
FT                   TLLQRANWAFAMIRNGRRVGTKWQVVPIHPFDPDRPDYIPTRTTFLVHRLLTIFLWCIV
FT                   LYFLGGPPFHSAFPSYITKERQELLLDEYNLALSAFLPRFWLSMSFILGLSTLQRSRFD
FT                   YQIRRIGHL"
FT   gene            complement(15947..18239)
FT                   /locus_tag="ANIA_07418"
FT                   /old_locus_tag="AN7418.4"
FT                   /product="phenol 2-monooxygenase, putative (AFU_orthologue;
FT                   AFUA_1G13660)"
FT   mRNA            complement(join(15947..16635,16705..16941,17003..18023,
FT                   18102..18239))
FT                   /locus_tag="ANIA_07418"
FT                   /old_locus_tag="AN7418.4"
FT                   /note="transcript_id=CADANIAT00000005"
FT   CDS             complement(join(15947..16635,16705..16941,17003..18023,
FT                   18102..18239))
FT                   /locus_tag="ANIA_07418"
FT                   /old_locus_tag="AN7418.4"
FT                   /product="phenol 2-monooxygenase, putative (AFU_orthologue;
FT                   AFUA_1G13660)"
FT                   /note="transcript_id=CADANIAT00000005"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000005"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000005"
FT                   /db_xref="GOA:Q5AWB2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB2"
FT                   /protein_id="CBF78415.1"
FT                   /translation="MPGTVPTHEDHVDVLIVGAGPAGLMLSTWLSRCGIKTRIVDKRGT
FT                   KVFNGQADGLQCRTLEIFDSFGFAHRAWRESNHMIEICLWNPDENGRIRRSDRIPDTIP
FT                   QISRFQQVVLHQGRIERFFLDSMKEHSNLTVERGVLPVSFEIDEAKAADFDDYPISVTL
FT                   RTLSDKEATPQQRQQHQKSADGQRAVVDDGLFRSNLVADDTDDLIRAATADSSRDGQVE
FT                   LVKAKFLVGCDGAHSWVRRQAGFKLEGDSTDYIWGVLDIVPITDFPDIRHRCAIHSANA
FT                   GTIMVIPRENKLVRLYIQLQATSYNKNGEKADRSWITPDIILQSAQRIIHPYKLDYSYC
FT                   DWWTAYQIGQRVGDHFSLHDRVFLAGDAVHTHSPKAGQGMNVSMQDTYNLGWKLAHVVK
FT                   GYCDPAILKTYESERRGIAQQLIAFDHRFSRLFSGRPARDIIDEEGVSMEEFKATFEKG
FT                   NEFASGIAVNYDASLLVAKGSKIAESNDEYKCRVTSKPQLATKIDVGKRMPSFKVLNQA
FT                   DARPWHLQELLKSNGRWRVIVFPGRLTDPRNMQRFQQLGQKLGDPDSFIRQYTPPGQPI
FT                   DSMIEVLTVHAGPRTEIELLDLPEAFHPNHGDMGWDYWKVYVDDDSYHEGHGQAYANYG
FT                   IDPSNGASVIIRPDQYVSWVGDMDDYEEMARFFSAFMKQQVAGKPGAANVRVPFMTTKL
FT                   "
FT   gene            19374..19719
FT                   /locus_tag="ANIA_11560"
FT                   /old_locus_tag="AN11560.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(19374..19415,19546..19719)
FT                   /locus_tag="ANIA_11560"
FT                   /old_locus_tag="AN11560.4"
FT                   /note="transcript_id=CADANIAT00000006"
FT   CDS             join(19374..19415,19546..19719)
FT                   /locus_tag="ANIA_11560"
FT                   /old_locus_tag="AN11560.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000006"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000006"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000006"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCC3"
FT                   /protein_id="CBF78417.1"
FT                   /translation="MDRHPFRPAHLHVISRMLVERRGDARAGLEFENDIKTVKASSAFK
FT                   VDLELPRFMGILRRRLRLLNLAERAS"
FT   gene            complement(20916..22063)
FT                   /locus_tag="ANIA_07417"
FT                   /old_locus_tag="AN7417.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(20916..21460,22057..22063))
FT                   /locus_tag="ANIA_07417"
FT                   /old_locus_tag="AN7417.4"
FT                   /note="transcript_id=CADANIAT00000007"
FT   CDS             complement(join(20916..21460,22057..22063))
FT                   /locus_tag="ANIA_07417"
FT                   /old_locus_tag="AN7417.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000007"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000007"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000007"
FT                   /db_xref="GOA:Q5AWB3"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB3"
FT                   /protein_id="CBF78419.1"
FT                   /translation="MSGVLGSAVLTGFLRHIRAARSNAPEKHLRFIVTTCTAESKTHLH
FT                   KQFLQDADRISFVSGGGKANVVAMQSADVVFLAFPSSLASTILSNEHDLASDLANKLVV
FT                   SLLRDVSTTEIDILIDPQWPDSKTSGGCPPPIIVSAAPYPGEGLRIVRRSSLQFIPKDA
FT                   SNTLHWLFAMVGTLDDKKKT"
FT   gene            complement(22318..22571)
FT                   /locus_tag="ANIA_11559"
FT                   /old_locus_tag="AN11559.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(22318..22376,22418..22571))
FT                   /locus_tag="ANIA_11559"
FT                   /old_locus_tag="AN11559.4"
FT                   /note="transcript_id=CADANIAT00000008"
FT   CDS             complement(join(22318..22376,22418..22571))
FT                   /locus_tag="ANIA_11559"
FT                   /old_locus_tag="AN11559.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000008"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000008"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000008"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCC5"
FT                   /protein_id="CBF78420.1"
FT                   /translation="MLTDAFQPLQLRALKKLYENWLMDQNLSIYFSSDQDAMILDELVF
FT                   LEDAGTETTKQDDREKVMYMVDKGA"
FT   gene            complement(24758..25255)
FT                   /locus_tag="ANIA_07416"
FT                   /old_locus_tag="AN7416.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(24758..25255)
FT                   /locus_tag="ANIA_07416"
FT                   /old_locus_tag="AN7416.4"
FT                   /note="transcript_id=CADANIAT00000009"
FT   CDS             complement(24758..25255)
FT                   /locus_tag="ANIA_07416"
FT                   /old_locus_tag="AN7416.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000009"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000009"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000009"
FT                   /db_xref="GOA:Q5AWB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB4"
FT                   /protein_id="CBF78421.1"
FT                   /translation="MRFAPFLLLASLATASPLLDTNTEVTDIDVVTSLKDLKPVAELVN
FT                   DSNVLEARGSTPWHNCKCFNGYITDENYSGVYEKTLAYEGNWYWGIPDVPQGYGVYFEG
FT                   PSKYFLTVEVVGKNSQLLTKNRVGNIIHQLKVARGDKQCGTKPVVCWTKGENEIKAYVK
FT                   EF"
FT   gene            27990..30657
FT                   /locus_tag="ANIA_07415"
FT                   /old_locus_tag="AN7415.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(27990..28037,28153..28185,28333..28501,28594..28683,
FT                   28969..29634,29695..30230,30483..30497,30640..30657)
FT                   /locus_tag="ANIA_07415"
FT                   /old_locus_tag="AN7415.4"
FT                   /note="transcript_id=CADANIAT00000010"
FT   CDS             join(27990..28037,28153..28185,28333..28501,28594..28683,
FT                   28969..29634,29695..30230,30483..30497,30640..30657)
FT                   /locus_tag="ANIA_07415"
FT                   /old_locus_tag="AN7415.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000010"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000010"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000010"
FT                   /db_xref="GOA:Q5AWB5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB5"
FT                   /protein_id="CBF78423.1"
FT                   /translation="MSPEVAFRGESARLQRGYTYYMYHLSRCPVINSTATAVDSFRGCK
FT                   ASRGGFGYVAHIRVGISRVVDSELLFVMRAHGFNPFAFECLRDIGLEGAVLERATRGAE
FT                   YLSPPVPQHVSNAAADRVVICRVLDHTTEQTYTIQTKYLFGADGARSYVARALDFKFIT
FT                   KLSGKRACNVFFRADLDHIVQHNNSRRGSRVAGLHCILQPDRSIFPGVVAHLRVVRPST
FT                   EWALVCFGPEGRNPLDGMTVNNSPELVKLLHALIGDGSVDIEILAFHPWTVRESVAEEY
FT                   RYPRENILLGDAAHRHPPAFGLGLNTAFQDAYTLAWKVAYVSEGLAGPELLGSYIHARM
FT                   WEALGMSASTGDEGARQLARIAEASPEGAASRLKIHEALGETEVELQSLGIAYNQRYDA
FT                   SEEIAGPTPKNGSSDHGDMRTTARPPLVGNPITTTQISTFPGSRLPHARLDIMTGRKVI
FT                   STHYLASKASFCVFFGVGGEPWREAVVDIGHSTGSRINAYGIGYALDYANIYREWQLKL
FT                   ERKGRIY"
FT   gene            34795..36151
FT                   /locus_tag="ANIA_07414"
FT                   /old_locus_tag="AN7414.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(34795..35940,36140..36151)
FT                   /locus_tag="ANIA_07414"
FT                   /old_locus_tag="AN7414.4"
FT                   /note="transcript_id=CADANIAT00000011"
FT   CDS             join(34795..35940,36140..36151)
FT                   /locus_tag="ANIA_07414"
FT                   /old_locus_tag="AN7414.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000011"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000011"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000011"
FT                   /db_xref="GOA:Q5AWB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB6"
FT                   /protein_id="CBF78425.1"
FT                   /translation="MTTKIANCLHHTPSRIHIWNSDNLLIDQRSQEPSLEHHRPRQDCA
FT                   SGNAAILQNVKAIGKLLGSRSSSMLAWGKDHVPPKRMLSEEQCELSYVNDSPPLNVPES
FT                   SNATSRQLPESLMCGNKMEHPSNRIHFSRSNDRLKACTCPSPEKGPLCVAPSVVTTITS
FT                   GDVDFAAQKTSLPSKIMEWASGLEKQATNILQGPYTLYVGTFTTSPDLNTSSSDVGLTG
FT                   DAGVDHIATTSNPKETGMAIEYSSTVMTEVELVPGATEKTIIRSPTVFQTSDNDPNSRA
FT                   PMMCSTEQGDRDRIHVLEAKRDALARRKASIEKAIYELEWKPQQCSPYNAISREEVKKT
FT                   TTSLKSELADITKEEHDVGLTLYRALKSHDESSGGSGSTSLWSRI"
FT   gene            complement(37341..38408)
FT                   /locus_tag="ANIA_07413"
FT                   /old_locus_tag="AN7413.4"
FT                   /product="endomannanase (Eurofung)"
FT   mRNA            complement(37341..38408)
FT                   /locus_tag="ANIA_07413"
FT                   /old_locus_tag="AN7413.4"
FT                   /note="transcript_id=CADANIAT00000012"
FT   CDS             complement(37341..38408)
FT                   /locus_tag="ANIA_07413"
FT                   /old_locus_tag="AN7413.4"
FT                   /product="endomannanase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000012"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000012"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000012"
FT                   /db_xref="GOA:Q5AWB7"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016714"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWB7"
FT                   /protein_id="CBF78427.1"
FT                   /translation="MKFSQLILPFSAALSLVGSGVATPTTKPVNPRASRPARNLLAHLV
FT                   RSAGNGTTLSGQQELKDADWVTDNVGFSPVILGVDLMDYSPSRVEFGAVSTSIEDAITY
FT                   ATQGGIITICWHWGELSHDWMTDERLTTLLTLGSPSGTYNTTEQPWWSNFYTEATSFNL
FT                   SAAMNPASRDYKLILRDIDAIAEQLARLKDIPVLFRPLHEAEGGWFWWGATGAEPCKAL
FT                   YRLLFDRLTKKHGLNNLLWVWNSKDPLWYPGNEYVDVVSVDVYADNGDHSSQLEAYQAL
FT                   QGLTGNFSKLIALGEVGNIPDPELMREDGAQWAYWVTWNGDFIRGETKNPMEFKKAVYA
FT                   SELVYTLDEIQGWNL"
FT   gene            complement(39749..40173)
FT                   /locus_tag="ANIA_07412"
FT                   /old_locus_tag="AN7412.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(39749..39961,40021..40078,40130..40173))
FT                   /locus_tag="ANIA_07412"
FT                   /old_locus_tag="AN7412.4"
FT                   /note="transcript_id=CADANIAT00000013"
FT   CDS             complement(join(39749..39961,40021..40078,40130..40173))
FT                   /locus_tag="ANIA_07412"
FT                   /old_locus_tag="AN7412.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000013"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000013"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000013"
FT                   /db_xref="GOA:Q5AWB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB8"
FT                   /protein_id="CBF78429.1"
FT                   /translation="MIASIPLVIAALATTAFADLHIQGVCIDTPGSGVEVYNRVATEKA
FT                   CEAYKKRNTGSNQWDQCPDCVLKSERDLLYYCESQGQHIGGDELNYYCKQNGAGDSVAW
FT                   "
FT   gene            41003..42234
FT                   /locus_tag="ANIA_07411"
FT                   /old_locus_tag="AN7411.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(41003..41741,41989..42127,42216..42234)
FT                   /locus_tag="ANIA_07411"
FT                   /old_locus_tag="AN7411.4"
FT                   /note="transcript_id=CADANIAT00000014"
FT   CDS             join(41003..41741,41989..42127,42216..42234)
FT                   /locus_tag="ANIA_07411"
FT                   /old_locus_tag="AN7411.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000014"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000014"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000014"
FT                   /db_xref="GOA:Q5AWB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWB9"
FT                   /protein_id="CBF78431.1"
FT                   /translation="MKIPLLFLAFLCTQSSLATALPSEATVGLESIGHDKAVLLLHDGT
FT                   TKTIDKKDLGLYLGAAAHSPPAVPGSFETNDHESTSLRRLTKRSGAEFIIPLPDAEFLG
FT                   WDIPMSTIVHANQADATAAMAQGQSIANSISVGTSFTATVEKFLQIGTTINYQWTETAT
FT                   LTGTVTMTIPKNKWGAIVSNPLTFRKSGYVFSGQPGSAHYEYFHADSFTQDTYSYGQNS
FT                   LSWVKGVVTTCLGDSYPLKRCLGEALSPLISTAISVAKLNNLWEVFFSFSLRAYKVPLS
FT                   ASAEPVPKGPNLYHTGG"
FT   gene            complement(42930..44012)
FT                   /locus_tag="ANIA_07410"
FT                   /old_locus_tag="AN7410.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(42930..42977,43076..43507,43646..43648,
FT                   43688..43784,43909..44012))
FT                   /locus_tag="ANIA_07410"
FT                   /old_locus_tag="AN7410.4"
FT                   /note="transcript_id=CADANIAT00000015"
FT   CDS             complement(join(42930..42977,43076..43507,43646..43648,
FT                   43688..43784,43909..44012))
FT                   /locus_tag="ANIA_07410"
FT                   /old_locus_tag="AN7410.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000015"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000015"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000015"
FT                   /db_xref="GOA:Q5AWC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC0"
FT                   /protein_id="CBF78433.1"
FT                   /translation="MEAISSQMCAVAFQVFDRYGSVKAKYRSSGAKRNRQFSQDEKGDG
FT                   GSQDLRYGSNEAFERSWTLHALLSQVLGATSDFEPRREEAGGLENEELSETAIFTEVEK
FT                   IKLERLRDTLPLHHAALTLGDNELKAFLMTHVDNNIGWDRVTTSEATFLHLTACELKPP
FT                   STQWLLENVPNTDFLKTARDINGYTPPEALQEKLETTRTQEQVGSRVLNIRVYMRRVSG
FT                   TVSIT"
FT   gene            45287..45456
FT                   /locus_tag="ANIA_11558"
FT                   /old_locus_tag="AN11558.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(45287..45363,45414..45456)
FT                   /locus_tag="ANIA_11558"
FT                   /old_locus_tag="AN11558.4"
FT                   /note="transcript_id=CADANIAT00000016"
FT   CDS             join(45287..45363,45414..45456)
FT                   /locus_tag="ANIA_11558"
FT                   /old_locus_tag="AN11558.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000016"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000016"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000016"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCD3"
FT                   /protein_id="CBF78435.1"
FT                   /translation="MLCPTPTPFYVLLVFAVSSSNAEEALGSGSVRAEPTIGL"
FT   gene            complement(46070..46570)
FT                   /locus_tag="ANIA_07409"
FT                   /old_locus_tag="AN7409.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(46070..46570)
FT                   /locus_tag="ANIA_07409"
FT                   /old_locus_tag="AN7409.4"
FT                   /note="transcript_id=CADANIAT00000017"
FT   CDS             complement(46070..46570)
FT                   /locus_tag="ANIA_07409"
FT                   /old_locus_tag="AN7409.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000017"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000017"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000017"
FT                   /db_xref="GOA:Q5AWC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC1"
FT                   /protein_id="CBF78437.1"
FT                   /translation="MSRALLLVVATMFVSRTLAQEVRCDQNPIGPTFDEAKFNKLVETW
FT                   HGAFGGGGGSLGQPDGFHVTHQAVCCDGWCLAASNSAGSGRSWNDDDFTGAADRLREDG
FT                   GGHSQCETQLCSGIGLDIYCNLEFLNSEYQTTDATCDGEYHGVVEAFGDTCAGAPGYNG
FT                   PEC"
FT   gene            47149..50078
FT                   /locus_tag="ANIA_07408"
FT                   /old_locus_tag="AN7408.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(47149..47169,47280..47390,47462..47480,47865..47982,
FT                   48518..48540,48959..49139,49184..49530,49613..49801,
FT                   49864..49958,49995..50078)
FT                   /locus_tag="ANIA_07408"
FT                   /old_locus_tag="AN7408.4"
FT                   /note="transcript_id=CADANIAT00000018"
FT   CDS             join(47149..47169,47280..47390,47462..47480,47865..47982,
FT                   48518..48540,48959..49139,49184..49530,49613..49801,
FT                   49864..49958,49995..50078)
FT                   /locus_tag="ANIA_07408"
FT                   /old_locus_tag="AN7408.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000018"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000018"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000018"
FT                   /db_xref="GOA:Q5AWC2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC2"
FT                   /protein_id="CBF78439.1"
FT                   /translation="MAKLALYGTPLVAEALSTLVGGSTSNSEMRMRLWSLQTTRCLHYN
FT                   KFVVFRVSKMYLTHKTERNVTIRVKLDIKMTITGPQITVIPMRGIVSGLTDGGYVDRIK
FT                   WAESNRTKALAEGVEYTAPDGSVKTLYANEEIIFSAGSVRSSAILELSGVGNPEILEDF
FT                   KIPVKIFLPSVGENVIDQPNTFIAYASNSTFSGMAPYVTYMTASDILRTEAGTVAAEIA
FT                   AQLKTWADQVAEASDNALSTSALEHLSNPARSYLCPRRALRRDLNYSARNKPINPNYLM
FT                   AQWDLILQRKIAQTVARFWKTAPVSSVAGESVQPPGTDLPIDTTEDEWDAWISRSSQTT
FT                   TFSVRRQCSLRELGGVVDNNLIVYGTENVRGHLASTLCAIAERAAGIIKNKLGKQ"
FT   gene            complement(51364..53463)
FT                   /locus_tag="ANIA_07407"
FT                   /old_locus_tag="AN7407.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_5G13710)"
FT   mRNA            complement(join(51364..52119,52214..52531,52593..52915,
FT                   52993..53237,53369..53463))
FT                   /locus_tag="ANIA_07407"
FT                   /old_locus_tag="AN7407.4"
FT                   /note="transcript_id=CADANIAT00000019"
FT   CDS             complement(join(51364..52119,52214..52531,52593..52915,
FT                   52993..53237,53369..53463))
FT                   /locus_tag="ANIA_07407"
FT                   /old_locus_tag="AN7407.4"
FT                   /product="carboxylesterase, putative (AFU_orthologue;
FT                   AFUA_5G13710)"
FT                   /note="transcript_id=CADANIAT00000019"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000019"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000019"
FT                   /db_xref="GOA:Q5AWC3"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC3"
FT                   /protein_id="CBF78441.1"
FT                   /translation="MRLTLRSFFVAATSFIFVQLAVAAQGPIVNLGIRYAAAPVGKLRW
FT                   QPPQAVQPPAHGMGAISAIDQPPVCPQSGAAGTPPSYGFNSGPGDEDCLFLNVYAAAGA
FT                   SDLPVLVWIHGGGYALFGATYDPSAMINTNDNQFIVVEIQYRLGAFGFLSSDEVKKHGR
FT                   PNAGLLDQRFALEWVQQHISKFGGDPSRVTVGGESAGGGAVMLQALAYGGRESHLFQNI
FT                   IAASPWSAPIYRYNDPEPTRHYDRFAELAGCGPGALRQGHHNTTFDCLVDAPTEALQNS
FT                   SGEVSTSGKIFGGFAFLPVIDGELLTMRPSQQLLHGHVSGQRLLVGNNANDGVPLSDPT
FT                   IVDRTTFNAHINLTFPHLTAHDKAALNRVYQTETTEPGNSGIRFDTLGDEGPTALNQSQ
FT                   MATGLQQTVFNIFAETSFDCSAQWLAEAYSIGSRKAWKYQYSATPAYHGADLGAYFSRD
FT                   TPSSGFNHAFQKIWGNFIIADTPIIPHSEATANMSNATAPADCQGNLAWPTFSLDEPWQ
FT                   MDLNTTGGTLKLHVETEHLKYWIRQGPGIVNVFRLIDAYSWEGGRGARCTWWRAVAGRV
FT                   PL"
FT   gene            54091..55290
FT                   /locus_tag="ANIA_07406"
FT                   /old_locus_tag="AN7406.4"
FT                   /product="integral membrane protein PTH11-like, putative
FT                   (AFU_orthologue; AFUA_5G13715)"
FT   mRNA            join(54091..54144,54192..54512,54590..54947,54984..55088,
FT                   55220..55290)
FT                   /locus_tag="ANIA_07406"
FT                   /old_locus_tag="AN7406.4"
FT                   /note="transcript_id=CADANIAT00000020"
FT   CDS             join(54091..54144,54192..54512,54590..54947,54984..55088,
FT                   55220..55290)
FT                   /locus_tag="ANIA_07406"
FT                   /old_locus_tag="AN7406.4"
FT                   /product="integral membrane protein PTH11-like, putative
FT                   (AFU_orthologue; AFUA_5G13715)"
FT                   /note="transcript_id=CADANIAT00000020"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000020"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000020"
FT                   /db_xref="GOA:Q5AWC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC4"
FT                   /protein_id="CBF78443.1"
FT                   /translation="MGRHIEAVDEEDVKTFMLGDYIFSHLYDFAIASTKLSVLALYHRI
FT                   FPKPVFRRIVILTAVFVVLWLMTMELVLGFQCRPIQRFWDQDVDGDCFNLVAFSYFTNI
FT                   TNLVTDMWILVLPLPTILRLQWIAEANEVRTCTVSAARLSVVVSQGSTDFTCKAITLLT
FT                   LLDDPYISGAGVPLGILSVWEPLGGILCANLPLSHKLVLSAFRKVTGRTSSERNHLSPT
FT                   GPRSWYRLENYLHRKANRNLETNSTEMGGIVVQRNFEQVSSYTGVDLLRQEEETGVPDI
FT                   RVRVDPKRPNSYIDAYREEKL"
FT   gene            complement(55606..56831)
FT                   /locus_tag="ANIA_07405"
FT                   /old_locus_tag="AN7405.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(55606..56049,56359..56467,56609..56639,
FT                   56825..56831))
FT                   /locus_tag="ANIA_07405"
FT                   /old_locus_tag="AN7405.4"
FT                   /note="transcript_id=CADANIAT00000021"
FT   CDS             complement(join(55606..56049,56359..56467,56609..56639,
FT                   56825..56831))
FT                   /locus_tag="ANIA_07405"
FT                   /old_locus_tag="AN7405.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000021"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000021"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000021"
FT                   /db_xref="GOA:Q5AWC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC5"
FT                   /protein_id="CBF78445.1"
FT                   /translation="MNKAELQKGLVTTLLPSAESVRTALHRSGAFRLAAPGSTRLLRDE
FT                   IFPDEWTPIRLHLLTSISQLLEPGTSLTGTALLDSATIGAHYYDSRALEIGAYFSPPHK
FT                   DSGTLTILFRSHVKNDGLEIANLDSTEEIDSDTVGRDASFIPIRTPSDEALKVIVLRAL
FT                   DFSACLEVSELGLVCTEYVVLAGEITIAADYND"
FT   gene            complement(59101..60499)
FT                   /locus_tag="ANIA_07404"
FT                   /old_locus_tag="AN7404.4"
FT                   /product="alpha/beta hydrolase, putative (AFU_orthologue;
FT                   AFUA_3G01280)"
FT   mRNA            complement(join(59101..59139,59224..60214,60351..60364,
FT                   60458..60499))
FT                   /locus_tag="ANIA_07404"
FT                   /old_locus_tag="AN7404.4"
FT                   /note="transcript_id=CADANIAT00000022"
FT   CDS             complement(join(59101..59139,59224..60214,60351..60364,
FT                   60458..60499))
FT                   /locus_tag="ANIA_07404"
FT                   /old_locus_tag="AN7404.4"
FT                   /product="alpha/beta hydrolase, putative (AFU_orthologue;
FT                   AFUA_3G01280)"
FT                   /note="transcript_id=CADANIAT00000022"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000022"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000022"
FT                   /db_xref="GOA:Q5AWC6"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC6"
FT                   /protein_id="CBF78447.1"
FT                   /translation="MNMRRIFDVCCNPSADAQVLPLSETPFRGKISKSPNGYSIDYSRP
FT                   NPSQHPKPLLLCHRSHPARPLRPSSRNFSGRRRCSVIIRRGRTSPAAVRKDTPLRPFWT
FT                   RHSEQCPPQLPPTPSAKPTAQSQGQAVAVATELGVVLENSGISSDTPLLLVAHSYGAIV
FT                   ARELLHLYSERVAGMVLVDASTERASEYFNVPDENIIAVMGDLSYARATGLRSETVLSD
FT                   EEWRVRAKEIIVSSRATAAEIASFYEVCETLKRMEQFRRQALGKRPLSVVRANTASDYR
FT                   AVHEKGVPAGNGREEQRAAFRTLLDQWEYIDKQLQEEQLRLSSNTHFFRLEGCGHNVHL
FT                   ARPDVIAQEPFGYSLPSRAYT"
FT   gene            60893..61907
FT                   /locus_tag="ANIA_07403"
FT                   /old_locus_tag="AN7403.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(60893..60979,61038..61907)
FT                   /locus_tag="ANIA_07403"
FT                   /old_locus_tag="AN7403.4"
FT                   /note="transcript_id=CADANIAT00000023"
FT   CDS             join(60893..60979,61038..61907)
FT                   /locus_tag="ANIA_07403"
FT                   /old_locus_tag="AN7403.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000023"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000023"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000023"
FT                   /db_xref="GOA:Q5AWC7"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC7"
FT                   /protein_id="CBF78449.1"
FT                   /translation="MYVEKLMPTTGVTKPYPIVFIHGQAQTGTNWLNKPDGGEGWASYF
FT                   LSQGYECYILDQTFRGRSPWFPGNGTVSTYSAELLQQRFTAPQQYNLWPQASLHTQWNG
FT                   MGVMGDPIFDTYYASTVEFLDSATYQQSTVQAAGAALLDLIGSPVVLLSHSQGGPIGWL
FT                   IADMRPNLVHSIVSIEPTGPPFQEAVFSNASARPYGLTDIPLTFSPPVTDPANDLVKKI
FT                   IPSNSSLYSDCVMQASSPSPRQLVNLAHVPVLVVTTESSYHAPYDWCTVQLLQQAGVSA
FT                   KHLKLADIGIHGNGHMVFMEKNSLQVAATLGQWIERT"
FT   gene            63484..65857
FT                   /locus_tag="ANIA_07402"
FT                   /old_locus_tag="AN7402.4"
FT                   /product="glucoamylase (Eurofung)"
FT   mRNA            join(63484..63503,63562..63812,63905..64194,64243..64339,
FT                   64408..65701,65824..65857)
FT                   /locus_tag="ANIA_07402"
FT                   /old_locus_tag="AN7402.4"
FT                   /note="transcript_id=CADANIAT00000024"
FT   CDS             join(63484..63503,63562..63812,63905..64194,64243..64339,
FT                   64408..65701,65824..65857)
FT                   /locus_tag="ANIA_07402"
FT                   /old_locus_tag="AN7402.4"
FT                   /product="glucoamylase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000024"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000024"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000024"
FT                   /db_xref="GOA:Q5AWC8"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008291"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC8"
FT                   /protein_id="CBF78451.1"
FT                   /translation="MPTTILKITLFPLIDSIFSVQLSPVRIAMLTLSKVLPVLALSHAV
FT                   AAAPQLSARATASLNTWLSTEASFALDGILTNIGANGAYAKTAKAGADYYTWTRDAALT
FT                   VKVLVDLFHNGDLSLQTILEEYTNSQAYLQTVSNPSGGLASGGLAEPKFYVDMTAFTGS
FT                   WGRPQRDGPALRATTLIGFGNWLIDNGYSSYASNNIWPIVRNDLTYVAQYWSKSGYDLW
FT                   EEVNSMSFFTVAVQHRALVEGSTFAHRVGASCPWCDSQAPQILCYMQNFWTGSYINANT
FT                   GGGRSGKDANTVLASIHTFDPDAACDDITFQPCSSRALANHKVYTDSFRSVYSLNTGIA
FT                   QGVAVAAGRYPEDSYYNGNPWFLTTLAAAEQLYDAIYQWQKARSISITSTSLAFFKDIY
FT                   SSAAVGTYASGSSAFTAIIDAVKTYADGYVSIVKAHAMANGSLSEQFDKTYGTCVSARD
FT                   LTWSYAALLTASMRRNGVVPPSWDAASANTLPSSCSTGSATGTYSTATVTTWPSTLTSG
FT                   SASATTTIMATSTATSSSTTTSTTTACTTPSTVAVTFNVIATTTYGENVYIVGSISQLG
FT                   NWDTGSAVALSASKNTSSNNLWYVDINLPGGTAFEYKYIRKETDGSIVWESDPNRSYTV
FT                   PSSCGVSTATESDTWRCTLETQSVRN"
FT   gene            complement(65999..67492)
FT                   /locus_tag="ANIA_07401"
FT                   /old_locus_tag="AN7401.4"
FT                   /product="beta-1,4-endoxylanase (Eurofung)"
FT   mRNA            complement(join(65999..66606,66817..66930,67005..67137,
FT                   67218..67374,67437..67492))
FT                   /locus_tag="ANIA_07401"
FT                   /old_locus_tag="AN7401.4"
FT                   /note="transcript_id=CADANIAT00000025"
FT   CDS             complement(join(65999..66606,66817..66930,67005..67137,
FT                   67218..67374,67437..67492))
FT                   /locus_tag="ANIA_07401"
FT                   /old_locus_tag="AN7401.4"
FT                   /product="beta-1,4-endoxylanase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000025"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000025"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000025"
FT                   /db_xref="GOA:Q5AWC9"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWC9"
FT                   /protein_id="CBF78453.1"
FT                   /translation="MFKLHSFTAALAAGLLTTIVSAAGLHEAALAAGLEYFGTATDNGE
FT                   LTDIPYVTQLNNTADFGQITPGNTQKWDSTEPSQGTFSFTKGDVIADLADANGQYLRCH
FT                   TLVWHNQLPSWVTSGSWTNTTLTAALRNHITNVVNHYKGRCIHWDVVNEEYGGAKAAGA
FT                   RAIVQLIKNAGVKIDGVGFQAHFSVGTVPSRSSLASVLQSFTSLGVEVAYTEADVRIQL
FT                   PTSATTLAQQSTDFQNLAGSCVDTAGCVGFTIWDWTDKYSWVPSTFSGYGAALPWDENF
FT                   VKKPAYDGLLVGLGGTVTTTTTTTATSTTTSATATSTATSPHWGQCGGIGWTGPTLCAS
FT                   PWTCTYVNDWYSQCL"
FT   gene            67903..68170
FT                   /locus_tag="ANIA_11557"
FT                   /old_locus_tag="AN11557.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(67903..68021,68071..68170)
FT                   /locus_tag="ANIA_11557"
FT                   /old_locus_tag="AN11557.4"
FT                   /note="transcript_id=CADANIAT00000026"
FT   CDS             join(67903..68021,68071..68170)
FT                   /locus_tag="ANIA_11557"
FT                   /old_locus_tag="AN11557.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000026"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000026"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000026"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCE3"
FT                   /protein_id="CBF78455.1"
FT                   /translation="MCWFPRALEIGGILKGAGSRRGLSVRGQRSFRAWLCILQVRCWNI
FT                   PVIRVLKKVDRKRTRAGVGLVEKEDGV"
FT   gene            complement(69915..71982)
FT                   /locus_tag="ANIA_07400"
FT                   /old_locus_tag="AN7400.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(69915..69976,70398..70570,70650..70872,
FT                   70975..71042,71103..71221,71283..71527,71835..71982))
FT                   /locus_tag="ANIA_07400"
FT                   /old_locus_tag="AN7400.4"
FT                   /note="transcript_id=CADANIAT00000027"
FT   CDS             complement(join(69915..69976,70398..70570,70650..70872,
FT                   70975..71042,71103..71221,71283..71527,71835..71982))
FT                   /locus_tag="ANIA_07400"
FT                   /old_locus_tag="AN7400.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000027"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000027"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000027"
FT                   /db_xref="GOA:Q5AWD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD0"
FT                   /protein_id="CBF78457.1"
FT                   /translation="MCKQPVRDKSWVAPAATIVTGSLALICVLVRVHDCLSRKEFKWAD
FT                   VCAVLTYIPAIILTKVAIVCFFMQVFPGPKFRMLCYGTIVWCFLFMISTTIAAILACVP
FT                   VEKLWTNWMGNNEGVCYDNNAFWWTHSAINIATDLWILGMPIPLLLKLQLKLKKKIYLL
FT                   LMFSVGTVITVISIVRFSGLLKYSTSANITLCCCMPAILSALRRTFPGVFDSQNQSLRY
FT                   NSSPFSSNAIQKMVTHEVTYMPRAANSDDAIELVSRGNGSGPKNSCKVMRVQPSYFCNP
FT                   LHTKETRLGRRESITSLRGINLATPLGAGLAFPLNGIFAGQRSSPRMEVFGKLSMLRCS
FT                   RLIKR"
FT   gene            73730..75415
FT                   /locus_tag="ANIA_07399"
FT                   /old_locus_tag="AN7399.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(73730..74789,74844..75415)
FT                   /locus_tag="ANIA_07399"
FT                   /old_locus_tag="AN7399.4"
FT                   /note="transcript_id=CADANIAT00000028"
FT   CDS             join(73730..74789,74844..75415)
FT                   /locus_tag="ANIA_07399"
FT                   /old_locus_tag="AN7399.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000028"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000028"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000028"
FT                   /db_xref="GOA:Q5AWD1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD1"
FT                   /protein_id="CBF78459.1"
FT                   /translation="MTADIKTLLLAALGAVAVAWLAQSFGKRSSLPLPPGPKPALLIGN
FT                   IHQLPKSLQWLHLYHLSKEYGPIMHFSMAGQPLIILSTHQVAHDLLNRRSGRYSDRPRM
FT                   VMAGELVTKNMHMLLRPYDERYKLHQRMEAPLLVLRSASNYRPLQDLESQQLLFDVLGE
FT                   WDKFGEKGVDFHHHFERAMASTIYCLNYGYRLQTGYEKELMDGKKVQAEFARTGQVGAY
FT                   LVDSFPSLNYLPKFLAPWKKEGEGLYELERQLHVGNLKKGLSNRGWNFTKYMKDSPEAV
FT                   TMPEEELAFDLGILADAGLDTSTVALDWFIVAWITSGSTWVKKAQQLLDEVVGKDRMPT
FT                   FEDRPKLAYIDAIASETLRWRPVVVSGVPHFTKVQDEYMGYHIPANSTVLPNAFAISHD
FT                   ESIFGEDVDSFIPERWLAEDPPSEPSIDACGFNTSALKDLPHIGFGWGRRICTGRFIAR
FT                   NQLFIQMARMLWAFDVDAGVVDEKTGRRHNVDDMDCTEGFVTLPKPFRAVMRPRGEWVR
FT                   QRILERGTTHGLDHAKILQNAKLGRS"
FT   gene            76923..77983
FT                   /locus_tag="ANIA_07398"
FT                   /old_locus_tag="AN7398.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(76923..76995,77119..77131,77186..77357,77419..77516,
FT                   77607..77615,77659..77732,77934..77983)
FT                   /locus_tag="ANIA_07398"
FT                   /old_locus_tag="AN7398.4"
FT                   /note="transcript_id=CADANIAT00000029"
FT   CDS             join(76923..76995,77119..77131,77186..77357,77419..77516,
FT                   77607..77615,77659..77732,77934..77983)
FT                   /locus_tag="ANIA_07398"
FT                   /old_locus_tag="AN7398.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000029"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000029"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000029"
FT                   /db_xref="GOA:Q5AWD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD2"
FT                   /protein_id="CBF78461.1"
FT                   /translation="MDVATILGKRASAAAGATGYPEWEVVFCCARYPRNSLDGNKVGLW
FT                   RNKHLGHLPRAHRLSCRSCRNCEQRKRSYGLWKAQHGARLGTMTKACDGSKIKSRTHGS
FT                   GSVQNPPARAGYGYPLIHTGSRFESVPDPLRVLRWPVTGNAQIRVGSFYGQQHFFKLE"
FT   gene            79910..82584
FT                   /locus_tag="ANIA_07397"
FT                   /old_locus_tag="AN7397.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(79910..80205,80239..82456,82540..82584)
FT                   /locus_tag="ANIA_07397"
FT                   /old_locus_tag="AN7397.4"
FT                   /note="transcript_id=CADANIAT00000030"
FT   CDS             join(79910..80205,80239..82456,82540..82584)
FT                   /locus_tag="ANIA_07397"
FT                   /old_locus_tag="AN7397.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000030"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000030"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000030"
FT                   /db_xref="GOA:Q5AWD3"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD3"
FT                   /protein_id="CBF78463.1"
FT                   /translation="MNEIIANDPNRAAYLNDLCRHLYTLHERTRNLQDPDVSSTAAPAT
FT                   LEDNPDRAVYLKNLSNDLAEKHERTGDLQALDAAIKKASLAVAATSKNHALHAIRYEET
FT                   GELPDLDATITNLNLEVSVSPSDKPDHAGHLKNLSVHLFRRYKRTGDPQDLNAAITHTS
FT                   QALSATPESNSNRPGRLNILSSYIARRYERARNLQDLEAAMPNASLAVATNPDDHPDRV
FT                   GYLSNHSIHLANRYKQTGSPEDLQAAIANTGLAVAATTHNKQPDYAICLYNISKHLFSL
FT                   FERTGNLQDLETAVTFANLAVGFTLDDHPDRALYLNNLSMHLCIRNLQTGNMQDLAMAL
FT                   QHFRASANLPNAVPLYRIRSARGAIRMLQKLQQDWRQEAAVLAEEAVQLLPLVCTRYLN
FT                   CEDQQHVVSQTAGLAADACSIFLQLRQPEKALQILEYGRALILGYLVDSCSDVDRLQED
FT                   YPDLAKEYDQLLFILWQRLDSVHAENRYQLLQQKRKVPLELEKCINKIRQQEGYEQFLL
FT                   EPSIQDLMSQATEGPIVIINITDFGSHAIIVQDQDICSLHLPEMLQTPKFALDDQLRQF
FT                   RNVGERGWNLRDIENEPGSFYATHYNDNSLNWLWTHCVKPVIRELNLEVPLSGALSRIW
FT                   WIGTGVASSLPFHAAGDYGQVTENTMSRAISSYIPTIKSLAYSRSQLAKLTPKNNPTSI
FT                   YIAAMPTTANEQPLPCVESEVNAIQQACSNICTVTLQKYPTPEAVLNAMEDTDIIHFAC
FT                   HGSSNPFNPSDSHLLLHCGGSTTPAVGILTVQQVANRAFSNARVAYLSACSTSHVTASK
FT                   FTDEAIHLASVFQLAGFAHVIGSLWPINCRIIAYSCVRGS"
FT   gene            complement(82958..85625)
FT                   /locus_tag="ANIA_07396"
FT                   /old_locus_tag="AN7396.4"
FT                   /product="beta-glucosidase (Eurofung)"
FT   mRNA            complement(join(82958..84269,84324..84486,84543..84792,
FT                   84845..85067,85126..85178,85245..85438,85502..85625))
FT                   /locus_tag="ANIA_07396"
FT                   /old_locus_tag="AN7396.4"
FT                   /note="transcript_id=CADANIAT00000031"
FT   CDS             complement(join(82958..84269,84324..84486,84543..84792,
FT                   84845..85067,85126..85178,85245..85438,85502..85625))
FT                   /locus_tag="ANIA_07396"
FT                   /old_locus_tag="AN7396.4"
FT                   /product="beta-glucosidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000031"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000031"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000031"
FT                   /db_xref="GOA:Q5AWD4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR026892"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWD4"
FT                   /protein_id="CBF78465.1"
FT                   /translation="MLTSWGKTGFVLALALGGRAAENVITSDTFFYGESPPVYPSPEGT
FT                   GAGDWASAYTKARAFVAQLSDDEKIQLTAGVSSNTACSGFIQPIDRLGFPGICMSDAGN
FT                   GLRGTDYVNGWSSGISVGASWNRDLAHSRGAYMGQEYRKKGVNMILGPVVGPLGRVALG
FT                   GRNWEGYAADPYLSGVLVSESVKGLQSQKVATSVKHFIANEQETNRNPTTDSERNVVQS
FT                   VSSNIDDKTMHELYLWPFQDAVLAGATNLMCSYNRVNNSYACQNSKLLNGVLKTELGFQ
FT                   GYVVTDWGAQHAGIASANAGLDVVMPRSSTWNSNLTTAIANGTMEASRLDDMITRLMAT
FT                   WYYLDQDTEFPSPGVGMPSSPSAAHQAVIATSPEAKPILLQSAIESHVLVKNTDGALPL
FT                   KSPKLISVFGYDAYAPLTYDLGNNFDFSSTRVRSDLYKNGTLYVGGGSGLNSPAYIDAP
FT                   IDAIKRRAYEDGSSVLWDFTSENPSVDYTSDVCLVFINAYATEGYDRQALSDTHSDSVV
FT                   ENIAGNCSNTIVVVHNAGIRTAEAWVDHANVTAIIYAHLPGQDIGRALVRLLYGESNFS
FT                   GRLPYTVAKNSSDYGSLLEPSQPEGKYQYFPQSDFSEGVYIDYRAFDKDGIVPQYAFGY
FT                   GLSYTTFEYSDLKISKNSDGVPSIYPAKASILPGGNPHLFDELVTVTAKIRNTGNVDGQ
FT                   EVAQLYVGIPDGPVRQLRGFDKVLIESGSSATVTFSLTRRDLSTWDANAQEWSLQRGTY
FT                   KIFVGRDSRDLPLEETLVF"
FT   gene            86103..86414
FT                   /locus_tag="ANIA_11556"
FT                   /old_locus_tag="AN11556.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(86103..86236,86279..86414)
FT                   /locus_tag="ANIA_11556"
FT                   /old_locus_tag="AN11556.4"
FT                   /note="transcript_id=CADANIAT00000032"
FT   CDS             join(86103..86236,86279..86414)
FT                   /locus_tag="ANIA_11556"
FT                   /old_locus_tag="AN11556.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000032"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000032"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000032"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCE9"
FT                   /protein_id="CBF78467.1"
FT                   /translation="MCRRDSPCGKTKYEHLGQLASLSVTLHKSRLTSVGYILSTAYHLN
FT                   PCSYYPEVTWCAGPYVPAHDAWKCPACNTPLHATLNPFSAIPES"
FT   gene            92817..94207
FT                   /locus_tag="ANIA_07395"
FT                   /old_locus_tag="AN7395.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G00840)"
FT   mRNA            join(92817..92825,92942..93079,93131..93167,93214..93718,
FT                   93771..93838,93891..94207)
FT                   /locus_tag="ANIA_07395"
FT                   /old_locus_tag="AN7395.4"
FT                   /note="transcript_id=CADANIAT00000033"
FT   CDS             join(92817..92825,92942..93079,93131..93167,93214..93718,
FT                   93771..93838,93891..94207)
FT                   /locus_tag="ANIA_07395"
FT                   /old_locus_tag="AN7395.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_5G00840)"
FT                   /note="transcript_id=CADANIAT00000033"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000033"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000033"
FT                   /db_xref="GOA:Q5AWD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD5"
FT                   /protein_id="CBF78469.1"
FT                   /translation="MHSRYPQADPGTIIPFAIATILFVIRMVTKAMHLGGGWGSDDYTL
FT                   MVAYALGIVVFSVNISMIDHGFAKNIWDIYPQENITIAYKVRLAVPAPVDKSSFLAQRF
FT                   YGFVLAYKALISLAKISVCLFLLRIFRSSTFRWVGYIMIGINSAIAITWMLLDSFHCIP
FT                   VHLAWTQWEGVEQGKCINFIAATYANGIVNIIVDVVMVAMPIYEVSKLNLSQRKKIGVA
FT                   VMFASGLVLTIIGIVRVIVFSQNSSNDNPTYEMEALNRWSVIECQIAIICACLPATRAM
FT                   LASFSPGIVGESTGEASAGLQNQYNGPSRSNHSMKVPLQKVNISKTVSYSVDYVGKSPR
FT                   RSSNGFLQLDDRGSERD"
FT   gene            complement(94445..95861)
FT                   /locus_tag="ANIA_07394"
FT                   /old_locus_tag="AN7394.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(94445..94813,94864..95071,95169..95573,
FT                   95854..95861))
FT                   /locus_tag="ANIA_07394"
FT                   /old_locus_tag="AN7394.4"
FT                   /note="transcript_id=CADANIAT00000034"
FT   CDS             complement(join(94445..94813,94864..95071,95169..95573,
FT                   95854..95861))
FT                   /locus_tag="ANIA_07394"
FT                   /old_locus_tag="AN7394.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000034"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000034"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000034"
FT                   /db_xref="GOA:Q5AWD6"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD6"
FT                   /protein_id="CBF78470.1"
FT                   /translation="MACFNYNGDTVDLENAKFCNITVQYTHPGYNDTITVEAWLPASVP
FT                   AQSFTKFTSTLCYPLLMRVWHNVDPLVCELDFLTNEAIAYYDPRNGVVDGLISNMGGSN
FT                   YDPYTTVKKTFICDSLNRTIALSQGAALITNAACSLATAVKDEWFNLFVARNISFNTAG
FT                   LSHEEYEEFFNLITPEYGSYWNANNTDLHAFKNAGGKLRTYDGMSYEWNSHIALSPSRP
FT                   IQVSSPRVQYMSNKSRVLFPDNHDFWRFFESSGLGHCAGGLGGQPTTVLKALQRWVENG
FT                   IAQKPCPYPCQIEYIGGNITLAESFRCTQAIWTTRPLRLLWLVFAPST"
FT   gene            97549..98241
FT                   /locus_tag="ANIA_07393"
FT                   /old_locus_tag="AN7393.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(97549..98037,98173..98241)
FT                   /locus_tag="ANIA_07393"
FT                   /old_locus_tag="AN7393.4"
FT                   /note="transcript_id=CADANIAT00000035"
FT   CDS             join(97549..98037,98173..98241)
FT                   /locus_tag="ANIA_07393"
FT                   /old_locus_tag="AN7393.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000035"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000035"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000035"
FT                   /db_xref="GOA:Q5AWD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD7"
FT                   /protein_id="CBF78472.1"
FT                   /translation="MLASLVAAVLATTSCASAALTWSLDKSANPSDDESDAYSRIEAAM
FT                   EAAVARYARLGDASKSIYVYYVPGVPTAEASYDGTIRFGSDRAYMNERTALHEISHTLG
FT                   VGQTAAFDQQCADGDWPTALPLLRSWDGADAVINCGGGHFWPYGLNYNDEWSETNGDRN
FT                   LLTAFIPPYYVSRIPENNCVVR"
FT   gene            complement(98554..100322)
FT                   /locus_tag="ANIA_07392"
FT                   /old_locus_tag="AN7392.4"
FT                   /product="choline transporter, putative (Eurofung)"
FT   mRNA            complement(join(98554..99285,99343..99698,99865..100198,
FT                   100257..100322))
FT                   /locus_tag="ANIA_07392"
FT                   /old_locus_tag="AN7392.4"
FT                   /note="transcript_id=CADANIAT00000036"
FT   CDS             complement(join(98554..99285,99343..99698,99865..100198,
FT                   100257..100322))
FT                   /locus_tag="ANIA_07392"
FT                   /old_locus_tag="AN7392.4"
FT                   /product="choline transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000036"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000036"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000036"
FT                   /db_xref="GOA:Q5AWD8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD8"
FT                   /protein_id="CBF78474.1"
FT                   /translation="MKTTKEISVSLAQDASDMDADERERNADRPGHKQELERHFSIVSL
FT                   IGLASTTTISWTGLGLSIVTEINAGGPSAIIYGFILVTIMQSFLGASLAEFVSSYPTEG
FT                   GMYHWIAAIAPRRLSAFLSFVTGWLTVAGLQALYSLYHADVAIQTWQTFIIYQILNILT
FT                   ASVVLFGNRIIPSLNKFSLFYLQIGWFVVLVTVVACAPTHQSKEFVFRTWINNTGWDNN
FT                   AICFITGLVNPLYSLGGLDGITHITEEMTNPSRNAPLAIGITLTIAFITGLSYLIALMF
FT                   SVQDFAALSDTKTGLPLTELFRQVTESVGGAFGLTFILFIALGPCVISSQLSSSRVLWA
FT                   FARDSAMPFSNTWARVSKRFGIPFNAQLLVAAAIAALGCLYLGSSTAFNSMLGAAVTIN
FT                   NVAYLIPISTNMLTSRANMHRGSFHMGKWGWLVNSVTVGWLLFAIIFFSFPYNMPVTVE
FT                   NMNYTCVVVGGIPILILVWWFIGNKQYKDKIARAKEE"
FT   gene            100634..102376
FT                   /locus_tag="ANIA_07391"
FT                   /old_locus_tag="AN7391.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(100634..101005,101064..102235,102286..102376)
FT                   /locus_tag="ANIA_07391"
FT                   /old_locus_tag="AN7391.4"
FT                   /note="transcript_id=CADANIAT00000037"
FT   CDS             join(100634..101005,101064..102235,102286..102376)
FT                   /locus_tag="ANIA_07391"
FT                   /old_locus_tag="AN7391.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000037"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000037"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000037"
FT                   /db_xref="GOA:Q5AWD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWD9"
FT                   /protein_id="CBF78476.1"
FT                   /translation="MLAKARWLLPLLGASAVQCAHLNLHAQSLLDESMTLQDAIYDPAA
FT                   SYLRYIYFPFAAGPHETRSSVWYSVGLLQRNQGSDAEEAFKILRNVIGDQEKNEIVQWY
FT                   GDYTKYPEQPTVGTAAYPPVIYNSWDPNWRGFIGTALIIIYEEFQHLLPPDLSDLILES
FT                   VYNSTKGDSYRVGGVNEDNLYPAYSNAWLMRTVTSSWTGRHLNDANMTAAGDADASDFL
FT                   DLFDRNHTLSEFNGPTYAGVSLYALTIAAKYMGSTNATIGRNAARLIQQIWEYESIFWN
FT                   PYMRNFAGPWDRSYGYDMNNYVAIMSLWVWALVGKESAWNTTFPIWTLAHADDFEVAPV
FT                   IAVLSEFHKALIPDTAISRLTAFSGERTYHGHVYAPPADHEPRNVTTWVSANLSIGTQS
FT                   FNQSVVGGFSKDSSSFSPSVVQWLRPDESIGYFNLYPTETALKAEVRPYSLNLTYPLGN
FT                   ASSTFTFVLAANPLGKKRDIRSLADVDGLSIKVGGTVDPIPQISFCGLLGGACDVIHGF
FT                   EFWNATFSMPANTSDVPRIEFQFELTM"
FT   gene            complement(102558..104331)
FT                   /locus_tag="ANIA_07390"
FT                   /old_locus_tag="AN7390.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(102558..103522,103574..103727,
FT                   103792..104331))
FT                   /locus_tag="ANIA_07390"
FT                   /old_locus_tag="AN7390.4"
FT                   /note="transcript_id=CADANIAT00000038"
FT   CDS             complement(join(102558..103522,103574..103727,
FT                   103792..104331))
FT                   /locus_tag="ANIA_07390"
FT                   /old_locus_tag="AN7390.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000038"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000038"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000038"
FT                   /db_xref="GOA:Q5AWE0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE0"
FT                   /protein_id="CBF78478.1"
FT                   /translation="MSDREIQQALENHYRAPSEKEGNPDYGGTPDAPIIPDTRIERAER
FT                   EHAAIEKESVRSDGKRELKEYECYEKLGYCWPTWKKWTYLVAVAFVQVSMNFNTSVFPN
FT                   AVKPLSEAFNISEQHARTAQMAYLVTYSIGCELWAPWSEEFGRWPILQLSMFLINIWQI
FT                   PCALAPNWGTIVVCRALGGVSTAGGSVTLGLIADLYEKETQQFPLAFIVLSSCIGTSIG
FT                   GVIGGPIQRFLHWKWFFWIQLIFGGVTQAIIFFMPESRSTIIMDKEAKRMRKSGEDPNV
FT                   YGPNELKKPRVSLKEAFHIWIRPFHMLLTEPIVFCLSLLSGFSDALIFTFLESFAIVYE
FT                   QGWGFGILGQAWAVIPINLAYFLAYFSYLPFFWRDRYLRTKIEGDDMPPERRLKWLLWL
FT                   APLEPIGLFGFAWTSFGRERGIPWIASMIFSTCVGVANYAIYLSTVDYMVAAYGVYSAS
FT                   ATGGNAFARDLLAGISAMYATPMYTNIGDKWHVEYASTVLACLSCLVVIPIYVFYWKGP
FT                   QIRASSKFAQALEAENKTNQGRRVSRMSSQGWGSV"
FT   gene            107863..109659
FT                   /locus_tag="ANIA_07389"
FT                   /old_locus_tag="AN7389.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(107863..108120,108175..109659)
FT                   /locus_tag="ANIA_07389"
FT                   /old_locus_tag="AN7389.4"
FT                   /note="transcript_id=CADANIAT00000039"
FT   CDS             join(107863..108120,108175..109659)
FT                   /locus_tag="ANIA_07389"
FT                   /old_locus_tag="AN7389.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000039"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000039"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000039"
FT                   /db_xref="GOA:Q5AWE1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE1"
FT                   /protein_id="CBF78480.1"
FT                   /translation="MHAIYGSLALLLGLAVSSRASTVRHDHSFQPDHILRVTADIYNEA
FT                   CSERYSVLVNGSSPGPELRLREGEVSWIRVYNDMTDANTTIHWHGLTAFTAPFSDGSPA
FT                   ASQWPIPPGHFFDYEVKPEPGSAGSYFYHSHVDFQSVTAKGPLIVDSSEPAPYHYDEER
FT                   TVMISDYFSEPDDEIVDGLVSTNFTWSGETEAILVNGQSRPATNATGACKLAAISVEAG
FT                   KTYRLRFIGATALSFVSLAIESHHMHIIEADGHYTKPLETDFLQIGSGQRYSVLLTAKG
FT                   EDELKALDRRQFYLQITTLERPAVLTSFAVLDYTSDAAPDLTTVPSPPPLPVATTVQGW
FT                   LDYELEPAHPNEDFPTLDEVTRRIVIDVHQNVSDRTIWLQNGYDWVESFPKSPYLVDIY
FT                   QDRLDLDASYHRALTRGNGFDNITRTFPARVGEVLEIVWQNRGTVENGGVDAHPFHAHG
FT                   RHFYDIGGGDGLYNATANEIRLRGTHPIQRDTSVLYRYRSKTSQLVPSGWRAWRIRVTN
FT                   PGVWMYHCHVLQHMIMGMQTVFTFGDREDILAKTGQVDDGYLTYGGSAYGNGTWDPMVQ
FT                   DFDV"
FT   gene            complement(112306..114525)
FT                   /locus_tag="ANIA_07388"
FT                   /old_locus_tag="AN7388.4"
FT                   /product="Catalase-peroxidase (CP)(EC 1.11.1.6)(EC
FT                   1.11.1.7)(Peroxidase/catalase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q96VT4]"
FT   mRNA            complement(112306..114525)
FT                   /locus_tag="ANIA_07388"
FT                   /old_locus_tag="AN7388.4"
FT                   /note="transcript_id=CADANIAT00000040"
FT   CDS             complement(112306..114525)
FT                   /locus_tag="ANIA_07388"
FT                   /old_locus_tag="AN7388.4"
FT                   /product="Catalase-peroxidase (CP)(EC 1.11.1.6)(EC
FT                   1.11.1.7)(Peroxidase/catalase)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q96VT4]"
FT                   /note="transcript_id=CADANIAT00000040"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000040"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000040"
FT                   /db_xref="GOA:Q96VT4"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96VT4"
FT                   /protein_id="CBF78482.1"
FT                   /translation="MGSNECPYSRQNANIGGGGQNNRDWWPDDLKLNILRQHNSVSNPL
FT                   DKGFDYTAAFNSLDYFGLKRDLEALMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRVFD
FT                   GRGGGGQGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGSKISWADLLILAGNVALESM
FT                   GFKTFGFAGGRSDTWEADQSVFWGGEKEWLGNDVRYLNGELDNPLAASHMGLIYVNPEG
FT                   PNKNPDPVLAAKDIRITFGRMAMNDEETVALIAGGHTFGKTHGAGPATHLGKEPHGAGI
FT                   ELQGLGWESGFESGTGRHAITSGLEVIWTKTPTKWSNQFFEYLFKYDWELTKSPAGAHQ
FT                   YVAKGVEPFIPDPFDPSIKHPPRMLTTDLSLRYDPEYEKISRRFLENPDQFADAFARAW
FT                   FKLTHRDVGPRVLYQGPEVPSEVLIWQDPVPPLDHPVIDNDDIATLKKAILNSGISHTD
FT                   LFSTAWASASTFRGSDKRGGANGARIRLSPQKNWKVNSQPWLSESLAALEKIQKQFNDA
FT                   QSTDKRVSLADLIVLAGAASLEKAARDAGHNVSVSFTPGRTDATQEQTDVDSFNNLEPI
FT                   ADGFRNYGRGTPRVLTEDFLIDKAQLLNLSPPELTVLIGGLRVLNNNYDRSNLGVFTKR
FT                   PGQLTNDFFVNLLDMGVQWKPADDTNEIFIGSDRKTGQARWKASRADLVFGSHAELRAI
FT                   SEVYGSSDGEAKFVKDFVAAWEKVSNLDRFDLKQTGLAQRIKPQL"
FT   gene            115059..116157
FT                   /locus_tag="ANIA_07387"
FT                   /old_locus_tag="AN7387.4"
FT                   /product="Pyrroline-5-carboxylate reductase (EC 1.5.1.2)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q96WX7]"
FT   mRNA            join(115059..115745,115803..116157)
FT                   /locus_tag="ANIA_07387"
FT                   /old_locus_tag="AN7387.4"
FT                   /note="transcript_id=CADANIAT00000041"
FT   CDS             join(115196..115745,115803..116104)
FT                   /locus_tag="ANIA_07387"
FT                   /old_locus_tag="AN7387.4"
FT                   /product="Pyrroline-5-carboxylate reductase (EC 1.5.1.2)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q96WX7]"
FT                   /note="transcript_id=CADANIAT00000041"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000041"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000041"
FT                   /db_xref="GOA:G5EB79"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB79"
FT                   /protein_id="CBF78484.1"
FT                   /translation="MPALQSSKLAFIGGGNMASAIIGGLLSQGINKQNITVSEPWEVNR
FT                   NKIADLGVKTTTSNVVAGGEADLVIIAVKPQVTKAVCEELADAWSKRETLPVVVSIAAG
FT                   ITLGSLQQWLKTSDGRTTHLVRVMPNTPALVGEGASGLFASADVTAEEKELVNALLGSV
FT                   SKATEWVDKEELIDVVTGLSGSGPAYFFAMVEHLIASATALGLPAEQATRLAAQTCLGA
FT                   GKMLTESSDSPTQLRKNVTSPNGTTHAALETFNAQHFDQVVDKAVKAATSRAAELGNTL
FT                   GK"
FT   gene            complement(116271..117358)
FT                   /locus_tag="ANIA_07386"
FT                   /old_locus_tag="AN7386.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(116271..116579,116665..116872,
FT                   116933..117358))
FT                   /locus_tag="ANIA_07386"
FT                   /old_locus_tag="AN7386.4"
FT                   /note="transcript_id=CADANIAT00000042"
FT   CDS             complement(join(116371..116579,116665..116872,
FT                   116933..117358))
FT                   /locus_tag="ANIA_07386"
FT                   /old_locus_tag="AN7386.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000042"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000042"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000042"
FT                   /db_xref="GOA:Q5AWE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE4"
FT                   /protein_id="CBF78486.1"
FT                   /translation="MSHSFTTITNRAHELIARSPILSNLHQRSYNRSHLLKIALEATIL
FT                   ALLIPAAYRDYQAYLALGPGGPPYNVVGWLCVKLFFNPLRREMFGTRIYDQKIAGGDDS
FT                   GFLAEQELPPRKGERPAMAEFAVPQRQINQVPGRAIQEKLMAEYAAFLDRNAHLVDRVP
FT                   SILERYTDAAHVCGRIQLTPIAREMRREICHVHGTSDHSVHVTLSPADCKRVIDAGWGQ
FT                   RFPLAGSSILRNVTFGRLGILPTEYLFIYAPRNEKEIEVVLRIIKASVQYVTGARDVR"
FT   gene            119376..120596
FT                   /locus_tag="ANIA_07385"
FT                   /old_locus_tag="AN7385.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            119376..120596
FT                   /locus_tag="ANIA_07385"
FT                   /old_locus_tag="AN7385.4"
FT                   /note="transcript_id=CADANIAT00000043"
FT   CDS             119376..120596
FT                   /locus_tag="ANIA_07385"
FT                   /old_locus_tag="AN7385.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000043"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000043"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000043"
FT                   /db_xref="GOA:Q5AWE5"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE5"
FT                   /protein_id="CBF78488.1"
FT                   /translation="MTGALIAHAPGVNEPAQAQFVPDLQGAANDYEPLVRALEIWVTSD
FT                   LARKQSFDTAIRTAQSYNVPEMQRLESLDDYLQVINDLLRWVPAEAVRPRDLLLHTATM
FT                   WFVLDQPSVVQYQGSNRPMIGAYNEPSPGLTWLSRWIVSFSNQFGRCMDTPASAAKLDT
FT                   FRSNPAYRIDDYIEPHGGWKTFNEFFARQVKPSRRPIEGIADSMVVTSTADFKFVEMHR
FT                   ITAESTATIKGSSWTITQMLAGSPYKERFANGIWLHGRLNVEDYHRVHAPVAGTVLESQ
FT                   TIHGQSYMQIKSPSLGDPTGLTDNELTVINELGRYFCQSRGLVVIDTGFGLVAVVPVST
FT                   AILPSVILTVEVGTEMHKGEELGYFHFGGSDVVLIFEDQLNFSNGMEEGKQYQMGTRIG
FT                   RFELSRE"
FT   gene            complement(120688..121574)
FT                   /locus_tag="ANIA_07384"
FT                   /old_locus_tag="AN7384.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(120688..120735,120869..120970,
FT                   121030..121476,121527..121574))
FT                   /locus_tag="ANIA_07384"
FT                   /old_locus_tag="AN7384.4"
FT                   /note="transcript_id=CADANIAT00000044"
FT   CDS             complement(join(120688..120735,120869..120970,
FT                   121030..121476,121527..121574))
FT                   /locus_tag="ANIA_07384"
FT                   /old_locus_tag="AN7384.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000044"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000044"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000044"
FT                   /db_xref="GOA:Q5AWE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE6"
FT                   /protein_id="CBF78490.1"
FT                   /translation="MKFPAAVALFSTISAVAAAYVGSPSAYTYTSVPEFEIEVSPNKTI
FT                   IARGTIEQIREQALAHNPNWDEEYYAPAQKLAEERYQLVPAGADANSTGSTPSLEKRRA
FT                   EDFDSLRITCGRPWHAVSYEGALKEALRLYGVKGTPQNGPGPGNCGRVGCSYGTAIIWC
FT                   NDDTETKTLSSFDEIADGAFAIMQKCAHDKHGEGTKAQSTGSTAPDAATLN"
FT   gene            124285..125802
FT                   /locus_tag="ANIA_07383"
FT                   /old_locus_tag="AN7383.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            124285..125802
FT                   /locus_tag="ANIA_07383"
FT                   /old_locus_tag="AN7383.4"
FT                   /note="transcript_id=CADANIAT00000045"
FT   CDS             124285..125802
FT                   /locus_tag="ANIA_07383"
FT                   /old_locus_tag="AN7383.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000045"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000045"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000045"
FT                   /db_xref="GOA:Q5AWE7"
FT                   /db_xref="InterPro:IPR011483"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE7"
FT                   /protein_id="CBF78492.1"
FT                   /translation="MRLTHCLCMLSLLATATATAYTNRSSMPRTVVTTDLEQDDLASLI
FT                   RYLLYTNEIDTHGIIYSSSRYHWSGDGNGTRFFLPDREYETTQWTWRWTGTRTVQDIVL
FT                   KAYAEVWPNLNIHDPFYPSPDELLAMVKIGNIDFEGEMEKDTEGSDFIRELLLDDSDSR
FT                   TLYLQAWGGTNTIARALKSIEYEYSSSSTWNETRAAVSRKAVILASGFQDNTYVDYIAP
FT                   NWPALRVEDFSAAYSLWAYNCEKGEGNTLGLPDNNVYFTGNWTKAYVQKGPLGSLYRSW
FT                   LDGQRMPGDLLDVFGNLAWYAGTKQRCYPLEPYAFLSEGDNVVFNPLINTGLQDPANPA
FT                   LASWGGRSKQKSSSPDLWVLVDDEKNATGAADSEYTYTRWIAPIQNDFAARIQWTLEAN
FT                   YTRANHAPEVRILNGTYVSAPPGSTIILAGEVSDPDDDTVKTSWWQYLEEGTYEDSVEV
FT                   TELAGHQASVAIPEDASKGQTISIILQGTDDGEFPLTRYARVFIHVG"
FT   gene            complement(126026..127405)
FT                   /locus_tag="ANIA_07382"
FT                   /old_locus_tag="AN7382.4"
FT                   /product="salicylate hydroxylase, putative (AFU_orthologue;
FT                   AFUA_3G01460)"
FT   mRNA            complement(join(126026..126436,126548..127405))
FT                   /locus_tag="ANIA_07382"
FT                   /old_locus_tag="AN7382.4"
FT                   /note="transcript_id=CADANIAT00000046"
FT   CDS             complement(join(126026..126436,126548..127405))
FT                   /locus_tag="ANIA_07382"
FT                   /old_locus_tag="AN7382.4"
FT                   /product="salicylate hydroxylase, putative (AFU_orthologue;
FT                   AFUA_3G01460)"
FT                   /note="transcript_id=CADANIAT00000046"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000046"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000046"
FT                   /db_xref="GOA:Q5AWE8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWE8"
FT                   /protein_id="CBF78493.1"
FT                   /translation="MSSPSDKQFTVAIIGGGIGGLSLAAGLLRRSVPVQIYEAAAEFKE
FT                   VGLGLTIGPAAHRAMPLIDPKIREIYDALITTHADSPGYERFKETWFEVVRASDDDELD
FT                   GRLVLDLKAKPSGQTTVRRADFLDALVRLVPEGIAHFGKRLAALVETGDGVEMRFEDGT
FT                   AARASVVIGCDGIHSKVKQFVLGADEYAATQPRYSGMYGYRAVLDMETMVEAVGDHRAR
FT                   VSTMYVGDGAYAVTYPIKRAKKVNVGIYPLHSEWDRESWVRPASKEDMHNDFKHMGRLI
FT                   NSLIEWALYEHPHISTYARARVAILGDAAHASTPHQGAGAGQAIEDAHVLAELLGDARV
FT                   ATADDVAAAFKAYDQVRRPRSQRVVTSSAENAYLLCLRLDGVGSDEEKLKKTLQERLAW
FT                   LWNEDVHEQAERARRIMLEMIGQ"
FT   gene            complement(128664..130243)
FT                   /locus_tag="ANIA_10933"
FT                   /old_locus_tag="AN10933.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(128664..128690,128910..128972,
FT                   129222..129289,129339..129572,129631..129798,
FT                   129854..130084,130137..130243))
FT                   /locus_tag="ANIA_10933"
FT                   /old_locus_tag="AN10933.4"
FT                   /note="transcript_id=CADANIAT00000047"
FT   CDS             complement(join(128664..128690,128910..128972,
FT                   129222..129289,129339..129572,129631..129798,
FT                   129854..130084,130137..130209))
FT                   /locus_tag="ANIA_10933"
FT                   /old_locus_tag="AN10933.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000047"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000047"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000047"
FT                   /db_xref="GOA:C8VCG4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCG4"
FT                   /protein_id="CBF78495.1"
FT                   /translation="MTSPRAFDFTDEVAIVTGAGSRLAGEIGNGRATAILLARQGAKVA
FT                   LVDYNVDWAQETKRMIDLDGGQSIVIQADVTDEESCKKAVAQTIGAFGTVNILVNIVGV
FT                   GGAMGDATRLDLAAWDRDFRINVTSMVLMSRYVIPEMRKNGRGAIVNMSSVSGLLGGNP
FT                   SLLYPTTKGAIIQMTRAMAAQHGPENIRVNCVCPGMVFTPMVRGRGMTDEMRQARINQN
FT                   LLKQEGTGWDVGYAILFLCSKEAKWITGLIMPVDGGCSLSTFCKDIMVSKSSAMKQIDM
FT                   SDIFGR"
FT   gene            complement(130994..131906)
FT                   /locus_tag="ANIA_10939"
FT                   /old_locus_tag="AN10939.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(130994..131181,131233..131345,
FT                   131404..131573,131625..131906))
FT                   /locus_tag="ANIA_10939"
FT                   /old_locus_tag="AN10939.4"
FT                   /note="transcript_id=CADANIAT00000048"
FT   CDS             complement(join(130994..131181,131233..131345,
FT                   131404..131573,131625..131906))
FT                   /locus_tag="ANIA_10939"
FT                   /old_locus_tag="AN10939.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000048"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000048"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000048"
FT                   /db_xref="GOA:C8VCG5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCG5"
FT                   /protein_id="CBF78497.1"
FT                   /translation="MSSSNNTPSCDGWLAVPSGPCCRKGTLHKGTPRGQFVTVAELDTY
FT                   LSRPRRRQSNGHILLYFPDVWGMFPNGLLVMDAFADAGYLVLGVDYFRGDPVWKHRRNR
FT                   HDRSNPDFDYEAWKKKHMKFADEAVPRWIDEVKRTYGLPSTKYACVGYCFGAPYVCSEL
FT                   AKNTVNAGAFAHPAFLKNHHFANIKKPLYLSCSEEDHTFDQDSRRTALQILQAGKKTYH
FT                   LQLFSGVEHGFALRGNMDNAYERECCSL"
FT   gene            132317..134165
FT                   /locus_tag="ANIA_07380"
FT                   /old_locus_tag="AN7380.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(132317..132400,132470..132532,132588..132756,
FT                   132825..133779,133846..133979,134038..134165)
FT                   /locus_tag="ANIA_07380"
FT                   /old_locus_tag="AN7380.4"
FT                   /note="transcript_id=CADANIAT00000049"
FT   CDS             join(132317..132400,132470..132532,132588..132756,
FT                   132825..133779,133846..133979,134038..134165)
FT                   /locus_tag="ANIA_07380"
FT                   /old_locus_tag="AN7380.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000049"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000049"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000049"
FT                   /db_xref="GOA:Q5AWF0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWF0"
FT                   /protein_id="CBF78499.1"
FT                   /translation="MRIEQAAFVEGGPRPDDIEEAKASSVFEENAVGYKEYREGLSIEL
FT                   TAQDTQNSRVRWKIDLVVLPIFLVTQALQFMDKTALNYANLFGYQQTLGLHGQQFNYLS
FT                   AMVYAGYFFGQYPCGWLVGRFPAQRVLGLSCLLWGLTVIIMTQCRTFSSALAVRFIMGL
FT                   FEAAVTPGLTLMTGFWYTRQEIPLRQCIWYSALGWGGIIGSYISFGISKLPMDFSPPRW
FT                   ELLFYILGAATCLWAAVIFFILPDSPSTAFFLTKSERIIAVKRVAANQTGIKNKSFDTR
FT                   QGLVALTDPKAILIFISVFAAAIPNGVVNSFSTIIIQDMGFSTTKTTQLKSVGDAVLIV
FT                   ALVIGGTITLTVPNSRLLTSTAANILCTVAAACMAYLPREKTWARLACFWLVNTQSVGF
FT                   TISLVTISSNMAGYTHRAMANALVFTAYCWGNFAGPFVVKPSEAPEYKGATIGLLAGYA
FT                   IKAGCHLGLFTYMFLVNRHRDSHYGPADRARSDEAGMQDRTEFENKDFRYVL"
FT   gene            134494..136722
FT                   /locus_tag="ANIA_07379"
FT                   /old_locus_tag="AN7379.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            134494..136722
FT                   /locus_tag="ANIA_07379"
FT                   /old_locus_tag="AN7379.4"
FT                   /note="transcript_id=CADANIAT00000050"
FT   CDS             134494..136722
FT                   /locus_tag="ANIA_07379"
FT                   /old_locus_tag="AN7379.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000050"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000050"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000050"
FT                   /db_xref="GOA:C8VCG7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCG7"
FT                   /protein_id="CBF78501.1"
FT                   /translation="MARRQKVVCSSCRHRKTKCDGASPSCSACVASASPCQYEKAPSLA
FT                   YVRSLQARIRELEAKVKDSDSSPSAVVLSSVFNGHDGDSISFHAEGNLSYHNQTSAIHE
FT                   GPPYTSRQLPQAAPQSPASRATQQSTDSIRHSLVANAVAQKNLELLNASAISPQADVPP
FT                   EVTAILLQLHWCWLHPSFLFVYRPAFTRDMLQSAHHGQKPKYWSATLFKVLCAHSCRFI
FT                   RAPEAFWSPEDYTESFSQFSNRLMSEAKALLALETLNPPSVPTIQALLQQSARDIACGR
FT                   SSAAWLYSGMAFRMAIDLGLHVSPDDLQRHSTSLSAEDVEIRKRLFWSLYAWDKHISLY
FT                   LGRMPNFTMGAENVSLEFLDDFTEEDLWEPYYGPEPASAERRSYPPTPGHIVSCFTQLC
FT                   KLCILISRVMLDLYSPQPTSHPSSSLDARAAAFVTINRDLHEWYKALPSFLQIPSDKIP
FT                   EISPPPHITSLNLMYHTTLILLHRPYVVSGHARDSDAARKSWKVCRSSTTTIYHLLQMY
FT                   TKTFGFQHITYMNSYCTYTAATTAVYQLETSDGEPRVSDQVVWTELKFLLDILQRTSTT
FT                   MPGLNRSIDIIRSRIKKILDRQVTKQLDSLFPGSNAPAGGQRYASPGPFRTQTVVGGED
FT                   LTTDHALDPTFPHPSSSFSPRRDLLTEDWRILDDWLPAFPGQDVSFGSEVVLDMPENLS
FT                   PRTRSALMGSNLYPHMQLNFSMPDDPTFDYTPFSGTSSGPRPCDHHSL"
FT   gene            complement(137121..137829)
FT                   /locus_tag="ANIA_07378"
FT                   /old_locus_tag="AN7378.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(137121..137339,137417..137653,
FT                   137707..137829))
FT                   /locus_tag="ANIA_07378"
FT                   /old_locus_tag="AN7378.4"
FT                   /note="transcript_id=CADANIAT00000051"
FT   CDS             complement(join(137286..137339,137417..137653,
FT                   137707..137829))
FT                   /locus_tag="ANIA_07378"
FT                   /old_locus_tag="AN7378.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000051"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000051"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000051"
FT                   /db_xref="GOA:Q5AWF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWF2"
FT                   /protein_id="CBF78503.1"
FT                   /translation="MKIFALLTLAATALAQNAGLNLPGGTNLTAGSDIIVQVTRVNSLT
FT                   GSTELAVAIGLQTCPKGNCIPADEMLGTAQLYHGDFNPQFHEDYPSPYENFTVTIPAST
FT                   PKGKAVVAVAHAALVGASNEPLFEVLNSTVTIA"
FT   gene            complement(139568..141016)
FT                   /locus_tag="ANIA_07377"
FT                   /old_locus_tag="AN7377.4"
FT                   /product="RTA1 domain protein, putative (AFU_orthologue;
FT                   AFUA_3G00480)"
FT   mRNA            complement(join(139568..139713,139904..140947,
FT                   140998..141016))
FT                   /locus_tag="ANIA_07377"
FT                   /old_locus_tag="AN7377.4"
FT                   /note="transcript_id=CADANIAT00000052"
FT   CDS             complement(join(139568..139713,139904..140947,
FT                   140998..141016))
FT                   /locus_tag="ANIA_07377"
FT                   /old_locus_tag="AN7377.4"
FT                   /product="RTA1 domain protein, putative (AFU_orthologue;
FT                   AFUA_3G00480)"
FT                   /note="transcript_id=CADANIAT00000052"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000052"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000052"
FT                   /db_xref="GOA:Q5AWF3"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWF3"
FT                   /protein_id="CBF78505.1"
FT                   /translation="MANGEPILWSLYVYSPNKGAPVFFTIAYVASAAAHIWQCQYVHFT
FT                   FEPIGHLLTAVTLFSRYRSWRLLGLYPLCGVLFALGYALREYGAYHYLYDEENSTVLIA
FT                   FILSQVFIYVCPFVDYSWVTITRTNPLTDLPRPLLELANYHVLGRIFHYVPHLTPLPPN
FT                   RVTSTFGALMALIELLNALGVSLSSNPSSSTSQQNIGSHLTIAALAMQLAVILSFVVLA
FT                   GIFHWRLTKEVIPTRKAILPLYTLYMSMSLIFIRCIYRLIEHTGHTTVDINDMEVLKSL
FT                   TPVLRYEWFFYVFEATLMLLNMVLWNVWHPGRYLPANVRVYLGRDGREAVREEGEDTRT
FT                   VLAKTVSALSFGVLSKRVWRWYLDMLRKRVVPVPGQGQYKKQQLPKSALGSSSIYGVTE
FT                   IET"
FT   gene            141489..142785
FT                   /locus_tag="ANIA_07376"
FT                   /old_locus_tag="AN7376.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(141489..141535,141596..141614,141670..142785)
FT                   /locus_tag="ANIA_07376"
FT                   /old_locus_tag="AN7376.4"
FT                   /note="transcript_id=CADANIAT00010518"
FT   CDS             join(141489..141535,141596..141614,141670..142785)
FT                   /locus_tag="ANIA_07376"
FT                   /old_locus_tag="AN7376.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010518"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010518"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010518"
FT                   /db_xref="GOA:C8VCH0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCH0"
FT                   /protein_id="CBF78507.1"
FT                   /translation="MLRRSHKKSRDGCVECKRRHVKCDEQRPRCLLCTMSSRECSFASE
FT                   ALTPAEPSSTALRSPRPSPSWDQNEGQGNARAQSIEDPINLQHTELLIHLTSSRATDVF
FT                   SLGDGFEPYQATVSVVLGIGLTSPYLLYQLLAFSARHLAYLRPDKRAYHLHQATSLQTQ
FT                   ALSLFNAGKVQITASNCVAVCLFSVVLGHHLLTDTLTLALSVSDQPPGCRGIGLDSFLN
FT                   RYIQCLETHRGVYTVAMGGWPLLMETELAPVLSRSRAFTSQEPKGDECQQLQALIVSSV
FT                   SLEQEEKEACQQAIRYLQLGFDALSTGENENMRYQMLFLWNVLVPSEFSSLLAKKRAQA
FT                   LVILAYYALLLHHGRHIWQVGEAGQHILGMIEEYLGPEWSPWLEYPRLGMRFG"
FT   gene            complement(142804..144790)
FT                   /locus_tag="ANIA_07375"
FT                   /old_locus_tag="AN7375.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(142804..143226,143285..143393,
FT                   143441..144564,144616..144790))
FT                   /locus_tag="ANIA_07375"
FT                   /old_locus_tag="AN7375.4"
FT                   /note="transcript_id=CADANIAT00000053"
FT   CDS             complement(join(143044..143226,143285..143393,
FT                   143441..144564,144616..144732))
FT                   /locus_tag="ANIA_07375"
FT                   /old_locus_tag="AN7375.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000053"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000053"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000053"
FT                   /db_xref="GOA:Q5AWF5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWF5"
FT                   /protein_id="CBF78509.1"
FT                   /translation="MSEEKKSVELSGDIDFIETPPAKASQFETGEDCGIEVTKAAAIPN
FT                   PPLAVDGPGNESFSNYLLGGTLVGLPAFLTWFFGGGAKTFVFFFLLSVLPVLVAFWTYA
FT                   STFSPRTNEKVKLPGRPVEHYITFKREEDKAKWHGKNKIPMQTFAEMYLDGLVDFNGDT
FT                   LDVMEYRHDWANFSFTWDLFKFIVGTFFVDVLFHTKAQDEEQVRPNYDSGNDHYAWFLG
FT                   PRMIYTSGIISDPEKEETLEEMQDNKMAIVCEKIGLKEGETMLDIGCGWGTLARFASLN
FT                   YGAKVTGLTIAENQTAWGNDALRKAGIPEEQSKILCMDYRDAPRTKFDKITQLEMGEHV
FT                   GIRRLTGFFRQCYDMLKDDGAMYVQLSGLRQAWQYEDFIWGLYLNKYIFRGADASTPLW
FT                   YYVKCLEQAGFEVKGIDTVGVHYSGTLWRWYRNWVGNVEAIKAKYGPRWYRIWELFLAW
FT                   SVIASRQGSATCYQMVVVKNLNSTHRINGVASQFGLAGALAASRAAGKSRLP"
FT   gene            145049..145858
FT                   /locus_tag="ANIA_07374"
FT                   /old_locus_tag="AN7374.4"
FT                   /product="acetyltransferase, GNAT family family
FT                   (AFU_orthologue; AFUA_8G05690)"
FT   mRNA            join(145049..145552,145620..145858)
FT                   /locus_tag="ANIA_07374"
FT                   /old_locus_tag="AN7374.4"
FT                   /note="transcript_id=CADANIAT00000054"
FT   CDS             join(145159..145552,145620..145858)
FT                   /locus_tag="ANIA_07374"
FT                   /old_locus_tag="AN7374.4"
FT                   /product="acetyltransferase, GNAT family family
FT                   (AFU_orthologue; AFUA_8G05690)"
FT                   /note="transcript_id=CADANIAT00000054"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000054"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000054"
FT                   /db_xref="GOA:Q5AWF6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWF6"
FT                   /protein_id="CBF78511.1"
FT                   /translation="MEFAIEPVLPEDAPRITEIYFSAFTNSLSQRIMPRTKESEAFQTA
FT                   RFRKSAEEAQSGQGKDMIKIVATEPDQEPVIAGFALWNFYSGTSDSNEHEKEKVEWPSS
FT                   SDSELCERFFSGVERERQTAIGDQPHYCLYMLAVDPAFARRGLGAKLLKWGLHRADERR
FT                   LITFISASPAGRGLYEKHGCRALNSYEVVPGYHETSMVRPVAGLSRG"
FT   gene            complement(145918..148195)
FT                   /locus_tag="ANIA_07373"
FT                   /old_locus_tag="AN7373.4"
FT                   /product="solute symporter family transporter
FT                   (AFU_orthologue; AFUA_6G03200)"
FT   mRNA            complement(join(145918..147677,147777..147951,
FT                   147998..148195))
FT                   /locus_tag="ANIA_07373"
FT                   /old_locus_tag="AN7373.4"
FT                   /note="transcript_id=CADANIAT00000055"
FT   CDS             complement(join(145918..147677,147777..147951,
FT                   147998..148162))
FT                   /locus_tag="ANIA_07373"
FT                   /old_locus_tag="AN7373.4"
FT                   /product="solute symporter family transporter
FT                   (AFU_orthologue; AFUA_6G03200)"
FT                   /note="transcript_id=CADANIAT00000055"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000055"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000055"
FT                   /db_xref="GOA:C8VCH3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCH3"
FT                   /protein_id="CBF78513.1"
FT                   /translation="MISTSSLSEELCTVKRQFAMSSTVAPVLPQGAGYGVVVGIGLFFA
FT                   LLMACVSYLQNRYTQYSTKTSEEFNTASRSVKPGLIANGVVSAWTWAATLLQSSTVAYE
FT                   YGISGPFWVDAAGSTVQIFMFSVLACKVKQNAPYCHTFLEIVYHRYGQATHLVFVFFAL
FT                   MTNTLVASQLLLGGSAVVTALTGMNVYAAVFLIPLGVCIYVVLGGLRATFLCDYTHTVI
FT                   VMVIILYFMFDVYTRNELIGSPSQMYDLLKTAAVERPVEGNIEGSYVTLKSNSGLVFGV
FT                   IELCTGLSTVFLDQGYWQRAIASRPTTAVRAYIMGGLSWFAIPFGFATTLGLAAVALTN
FT                   NPRFPTYPNNMTSSQISAGLAAPFGATALAGKGGATALLLTLFMAVTSSASSQLIAVSS
FT                   ILTFDIYKTYLKPKATPQQLIFVSHIMICIFGVVMACVACLWNGIGIDLGWLFLVMGLL
FT                   IGGAVFPAAFTILWKGQTRLGAVCGAIGGLAAGLIAWLVEAKVYYGELTVATTGANYPT
FT                   LAGNMASVLTGLILTVGISLLKPDDFNWEKTRAINAPATYNPEPVIESKPPMAIKTTRV
FT                   DQSEKTADSAVIEDPKALQKTFVMAVVVSAVLSLIMDIIIPIPMFLSHYIFSKGFFTAW
FT                   VVISFLWVFAAFFLCGILPVVETRRFWGMLFKRMFGKKVVLDAQVQQGQSSEDDAQRAS
FT                   KDSIA"
FT   gene            148831..150283
FT                   /locus_tag="ANIA_10932"
FT                   /old_locus_tag="AN10932.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(148831..148958,149007..149265,149319..150283)
FT                   /locus_tag="ANIA_10932"
FT                   /old_locus_tag="AN10932.4"
FT                   /note="transcript_id=CADANIAT00000056"
FT   CDS             join(148831..148958,149007..149265,149319..150278)
FT                   /locus_tag="ANIA_10932"
FT                   /old_locus_tag="AN10932.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000056"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000056"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000056"
FT                   /db_xref="GOA:C8VCH4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCH4"
FT                   /protein_id="CBF78515.1"
FT                   /translation="MFRNAIRARVSLLPGRLPAALACRWNSSVPAAQNLRINGDRLWND
FT                   IHFTAQYSAPSPGGVTRLCADENDKFARDWFRDQVLQLGAEYKVNATGSQFAVFGGEDY
FT                   TVPPIAMGSHLDTVATGGKFDGPLGVLSGLEVIRSFKEQGIKTRAPLALINWTNEEGAR
FT                   FFPPLGSSTVYAGQTGVEQAHASLSNDGSGITMGDGLRKIGYVGDGPNTFEEFPISAHF
FT                   EVHVEQATDLEKAGKPVGWVEGWHGITYYEVTFSGEDGHANTYPMYGRRDALTGAAKLI
FT                   TQLETLAYTKNGYTTVTNIQSGPWGACNIQSKTKVVFCLMHREGEGLEDMGADIVRSIK
FT                   GIASLHGLEYKLSRPVHLLPGNFWPEAVDCVRRACGDRGIGSRTGTGHDSTMTRLKCPT
FT                   AMIFVRGKDGISHCAKEWSDKEDCEEGALVLGKAVLNFDAYLEDHAAKL"
FT   gene            150478..152919
FT                   /locus_tag="ANIA_10935"
FT                   /old_locus_tag="AN10935.4"
FT                   /product="hypothetical protein"
FT   mRNA            150478..152919
FT                   /locus_tag="ANIA_10935"
FT                   /old_locus_tag="AN10935.4"
FT                   /note="transcript_id=CADANIAT00000057"
FT   CDS             150478..152919
FT                   /locus_tag="ANIA_10935"
FT                   /old_locus_tag="AN10935.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000057"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000057"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000057"
FT                   /db_xref="GOA:C8VCH5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCH5"
FT                   /protein_id="CBF78517.1"
FT                   /translation="MEGHVFETHPRANPGAVVQGAQYRFTLLSERLIRFEWAEDGQFED
FT                   RASTFAIDREFPVPRFRIVDGDELEIITEYFHVSYTKQKFSPESLVFHFSGKSVKYGTP
FT                   WRFGTPTEFNLGGTARTLDGVDGRCDMGQGVLSKAGYAVLDDSKSMLFDGKGFVAPRQA
FT                   GDRADWYLFCYGRDYKAAIKAFYAVSGKQPVVPRFVLGNWWSRYYAYHQDEYVALVDKF
FT                   LEHSIPLSVAVLDMDWHYVSDERVPHAGWTGYTWNEKLFPNPKKFRRDIHQRQLRITMN
FT                   DHPHGGIHAHEAAYERMALFLDHDTRDRNPILFDPASPKFMEAYLSILHHRLELDACDF
FT                   WWIDWQQGPYSKIPGFDPLWLLNHFQYLESKHYGSVPLIFSRYGGPGSHRYPIGFSGDT
FT                   VVTWESLAFQPEFTATASNIGYGWWSHDIGGHIRGIRDDELLIRWTQLGVFSPVMRLHS
FT                   TSSRWNSKEPWLYGDECFRVMARFLRFRHRLVPYLYTQNVSGSFNDEPLVQPMYWSWPN
FT                   EPNAYEVPNQYFLGSELLVAPIVQPRDKRTNLASVKAWLPPGKRFVDIFCGTVYDGGRM
FT                   VTLYRPIDKYPVLAPEGSIVTLTSEACPGNGCLNPSGIEALVIVGKDGRARLIEDVVDD
FT                   DFFKERVAPAPNLRVAWNIEFIQATGKLTARIPAGKLNLNLRFLGMNLKPQDFRLLGNG
FT                   RDLKNDGIDVRLAQYGNKPCLSVFFSDFVSLQPTTITISLGPDPQLEVVDHTASLEELI
FT                   RGYQAEVRMKDQLWNAIEEGKGRPLCIISSLLALGYDEAIVGPLVELITADSRPCPGWM
FT                   S"
FT   gene            complement(154602..156110)
FT                   /locus_tag="ANIA_07371"
FT                   /old_locus_tag="AN7371.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(154602..155143,155192..156110))
FT                   /locus_tag="ANIA_07371"
FT                   /old_locus_tag="AN7371.4"
FT                   /note="transcript_id=CADANIAT00000058"
FT   CDS             complement(join(154602..155143,155192..156110))
FT                   /locus_tag="ANIA_07371"
FT                   /old_locus_tag="AN7371.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000058"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000058"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000058"
FT                   /db_xref="GOA:Q5AWF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWF9"
FT                   /protein_id="CBF78519.1"
FT                   /translation="MTQTPPSHSVDDGQRPDNQDTEMPDADSPRGLADRRTDISGRVHH
FT                   PAHTAVIAATAISEKFAATFWGKPEVKASCAPPPPPHRILRMPDPAQNPTDEYSDTTQP
FT                   VGNAEVDPSFKDDEAACRVLAEEMRQRIEQLESDLANAPSPDSVRALERSLQAESAQRE
FT                   RLQQELRQKHSELDVLRKHWKQAALELDKARSQSQGFYQVTDNYLIELTTRLRYNIKNF
FT                   AFQYFDGEMKGQRPRFDKPKIWDKYMQTITPDPLDCEVLMLSERRPSAVQAFIWRFLVG
FT                   DVFDRFRWAGELGVTLRRMCLELRPGQYQDSMCPIVPDEERKFQMWLASTTAMVLDAGS
FT                   APNKSRVFTEKVHRNNDTLTRKMRGVLDHYLVVDDPAYPLELARIVEEAVKFDTEISRQ
FT                   VARVEWVFPAAGNEILFDPEIMRLGTGEMGAKEKQKQLVQLVVCPAMRKRGKSTGDDFG
FT                   LPSTLLVPMEVSCEAVKRNEASARKATA"
FT   gene            156887..159206
FT                   /locus_tag="ANIA_07370"
FT                   /old_locus_tag="AN7370.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(156887..156996,157041..157647,157693..157759,
FT                   157805..158072,158118..158217,158261..158623,
FT                   158678..158815,159081..159206)
FT                   /locus_tag="ANIA_07370"
FT                   /old_locus_tag="AN7370.4"
FT                   /note="transcript_id=CADANIAT00000059"
FT   CDS             join(156887..156996,157041..157647,157693..157759,
FT                   157805..158072,158118..158217,158261..158623,
FT                   158678..158815,159081..159206)
FT                   /locus_tag="ANIA_07370"
FT                   /old_locus_tag="AN7370.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000059"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000059"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000059"
FT                   /db_xref="GOA:Q5AWG0"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG0"
FT                   /protein_id="CBF78521.1"
FT                   /translation="MTFTPSDGILAYRPKIATPSEDDEDDVMVIGIDFGTTYSGVAWAT
FT                   VADFASDQINLITSWPGTGREEGKAPTELFYEDDQIFWGYEIPDDADPVRWFKLLLVKD
FT                   EDLSEETRSSEFLLRGRKMLKETGKTAVGLIADYLRLLWAHILESVKKSRGEYVIDALR
FT                   FHVVITVPAIWKGYARQGMEEAARQAGILSSRPAGETMLSFVPEPEAAALSTLCEPGRR
FT                   TQPGDVYVICDAGGGTVDLISYEIASVSPIAMHEAVEGTGGLCGGIFIDEAFEHACKSR
FT                   LGRRWDHLSKAGIKEILKGEWEHAIKPQFKPQSSKKEYIVSIPAEAFGKNSLDDMSREP
FT                   FIKKGRIHFSGSHIQDAFTESFAGIDKLVDGQVYKARSQGLDVKGIILVGGLGASPYLY
FT                   EHLKERHSSAGIIILQSGGMRPRTAICQGAVYKGFLDGGSDNSGTQQNGYGVAAPISVT
FT                   SSISRTSIGIVYHAPFDPAKHLDEDKAWYPDEGEWRANNQLNWYLRRGDNVSTTDPVRY
FT                   NFYRLYRKDPGPQFSVELYECEDHDPPTRLEKSVACLLWNPIYSHSGGYPSRTLVRATF
FT                   TINSPSFEAYAVPAEA"
FT   gene            159384..160422
FT                   /locus_tag="ANIA_10938"
FT                   /old_locus_tag="AN10938.4"
FT                   /product="DSBA-like thioredoxin domain protein
FT                   (AFU_orthologue; AFUA_7G06250)"
FT   mRNA            join(159384..159431,159506..159650,159712..160195,
FT                   160311..160422)
FT                   /locus_tag="ANIA_10938"
FT                   /old_locus_tag="AN10938.4"
FT                   /note="transcript_id=CADANIAT00000060"
FT   CDS             join(159384..159431,159506..159650,159712..160195,
FT                   160311..160422)
FT                   /locus_tag="ANIA_10938"
FT                   /old_locus_tag="AN10938.4"
FT                   /product="DSBA-like thioredoxin domain protein
FT                   (AFU_orthologue; AFUA_7G06250)"
FT                   /note="transcript_id=CADANIAT00000060"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000060"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000060"
FT                   /db_xref="GOA:C8VCH8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCH8"
FT                   /protein_id="CBF78523.1"
FT                   /translation="MAVISIEIISDVICPWCFIGYRTLQKAIALYKKTYPGGSENEFVI
FT                   EWKPYFIDQVAPETSVLINDRMARRMTRSQIEAAQKRLKRIGSTVGISFKFGGYIGSSR
FT                   LAHRALHLALDKGGSQMQCTVADTLFQYQFELEKDVSQMHTVVEAAEKAGMDGDLVREY
FT                   LEGDGGKEEIETAERKARKRGVKGVPCLCIGVGGRVGEQVVDGAGDMEEVFEALVRAQP
FT                   RGSVKATLHHTPRVYPSSLGDYNLPSTTHVTRSLRSKSPV"
FT   gene            160794..162277
FT                   /locus_tag="ANIA_10937"
FT                   /old_locus_tag="AN10937.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_7G00740)"
FT   mRNA            join(160794..161080,161136..161692,161739..162277)
FT                   /locus_tag="ANIA_10937"
FT                   /old_locus_tag="AN10937.4"
FT                   /note="transcript_id=CADANIAT00000061"
FT   CDS             join(160794..161080,161136..161692,161739..162277)
FT                   /locus_tag="ANIA_10937"
FT                   /old_locus_tag="AN10937.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_7G00740)"
FT                   /note="transcript_id=CADANIAT00000061"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000061"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000061"
FT                   /db_xref="GOA:C8VCH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCH9"
FT                   /protein_id="CBF78525.1"
FT                   /translation="MDSSSTISCGFSSESPSLSRSRSQSFSESLSSIGPDSNPGTKLQL
FT                   VERIIEPLAYYSTRRFHPVHLMDTFKDSRYRVIRKLGYGSFSTVWLARDTKLGRYVALK
FT                   VGQAEDQSSSAPIEETRIYQLLAKTKFPSHPGRDHYLPLLDQFRYTGPNGTHQALVYEP
FT                   MSASVTEVKEALFPNGPFPFQMAKAILWQTLLGLDFLLANGVVHGDVQPRNLLFTLEDL
FT                   KDVPEDQLVQDKDKSITLCVDTELKGGVKGPEYLVPAHSLMQYLNISKPFTVKVSDLGG
FT                   SFLTSHPPSAPSPPLHLRGPETLFQRCISANQDMWSFGCLIFEFITGFALFDLSDHPVT
FT                   GITDDMHFIDMYNILGFPKDEALRNQHWPNWRRFFRSNGEPIDHFIRRRDRDFDITGRP
FT                   TSHTLEELLEEAVGEGLSPEEINITKQLLRGLLEFEVEKRFTTKDVLRHQWFVEQRRDI
FT                   CI"
FT   gene            162504..164512
FT                   /locus_tag="ANIA_10931"
FT                   /old_locus_tag="AN10931.4"
FT                   /product="GMC oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_2G15020)"
FT   mRNA            join(162504..162829,162957..163833,163882..164383,
FT                   164427..164512)
FT                   /locus_tag="ANIA_10931"
FT                   /old_locus_tag="AN10931.4"
FT                   /note="transcript_id=CADANIAT00000062"
FT   CDS             join(162504..162829,162957..163833,163882..164383,
FT                   164427..164512)
FT                   /locus_tag="ANIA_10931"
FT                   /old_locus_tag="AN10931.4"
FT                   /product="GMC oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_2G15020)"
FT                   /note="transcript_id=CADANIAT00000062"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000062"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000062"
FT                   /db_xref="GOA:C8VCI0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCI0"
FT                   /protein_id="CBF78527.1"
FT                   /translation="MLCSFLPIVLLLALRALCKTYDYIIVGGGTSGIPLAVRLAQSHSV
FT                   AIVEAGTYYEISYPFAKTPGADVLPVGSDPDTSCKADWGFVTTPQKGANGRRVHFARGK
FT                   CLGGSPTKEALDTWAEAVDDLSYAFDNIFPYYQRSVAFTPPDHVQRLANATALYNSSAF
FT                   DPAGGPLQVSFADFVQPFSTWVARGMKAIGLHQTSAFNSGELNGYHYCTSTIRPQDQSR
FT                   STSESSFLPGLSTLNPNIYQKTMAKRILFDENKNAIGVEVNSFGISKTLMASREVIVSA
FT                   GVFQSPQLLMVSGIGPREHLEQHNITVVSELPGVGQGMLDHPFFGPSYRVGVETLTRLA
FT                   NDPKSQVKEYIRWLTKHEGVLTSPVAEFLAWERIPDSLRAGFSEDTRRNLSLFADGWPE
FT                   VEYMSGAGFLGNISNFYSIQPDDGYEYASILGVLIATTSRGTVTLASNDTSDPPIINPN
FT                   WLDTESDQQLAVAAFKRIRQAFASEEMRPVVIGEEYYPGPQVQSDEEILDWIRNNMMTL
FT                   WHPSCTCKMGRADDRMAVVDSQARVFGVNRLRVVDASAFPFLPPGHPQSTCYMLAEKIA
FT                   EDILEQSGKTEETVRMDLRR"
FT   gene            complement(164652..166331)
FT                   /locus_tag="ANIA_07368"
FT                   /old_locus_tag="AN7368.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(164652..164822,164889..166331))
FT                   /locus_tag="ANIA_07368"
FT                   /old_locus_tag="AN7368.4"
FT                   /note="transcript_id=CADANIAT00000063"
FT   CDS             complement(join(164652..164822,164889..166331))
FT                   /locus_tag="ANIA_07368"
FT                   /old_locus_tag="AN7368.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000063"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000063"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000063"
FT                   /db_xref="GOA:Q5AWG2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG2"
FT                   /protein_id="CBF78528.1"
FT                   /translation="MYPIQACSRTQSGTVTFTSSTTKLSTHARTLRCLTRLNQLLAPFP
FT                   AVPTTACEANETLGIKIKRVGFINANGNITDQMDADVELAFEPAAFRPLKRSGFRMHHC
FT                   CEHDRIDLDSMGLAHLRVKDEGKTKFGGDSGLKIRSFVKSSNQHQYEQRTHYNNYKTPA
FT                   TPRLQPVLDASCSSSNTPSDISTVDLNAHKHGSGTETVTETEKGTSRYENGSQCQSQSQ
FT                   SQEQGNCMVQSYTTDDPDGHGVYVGVREVEEGNGSYETQHRRQLAHLNNYQPKTSLFTP
FT                   PLCSCTTKSSTMTTSETNASYYRNADMSTLNQDRLSGVELFLNEELPNSSKDHDAWITG
FT                   TETPAAIKIMTTAPLFLPTVPPIFRPNPGQILLRNASRLCQQIEGAVESDSTRSSLSIG
FT                   NLGYFEESGYYQYPWKVQDVYVDYVDFRSGNTRANPIATVLVGAGGTDDSICIAELKAA
FT                   VGVLLWWYEHSNEVESAGEGETAVLILSYIGSGHGRILQAHHDGWTMVVQHSSLMTFDM
FT                   GDYFAESAFVRYTAGRPVAV"
FT   gene            167615..168753
FT                   /locus_tag="ANIA_07367"
FT                   /old_locus_tag="AN7367.4"
FT                   /product="nitrilase (AFU_orthologue; AFUA_6G13450)"
FT   mRNA            join(167615..168088,168138..168462,168509..168753)
FT                   /locus_tag="ANIA_07367"
FT                   /old_locus_tag="AN7367.4"
FT                   /note="transcript_id=CADANIAT00000064"
FT   CDS             join(167615..168088,168138..168462,168509..168753)
FT                   /locus_tag="ANIA_07367"
FT                   /old_locus_tag="AN7367.4"
FT                   /product="nitrilase (AFU_orthologue; AFUA_6G13450)"
FT                   /note="transcript_id=CADANIAT00000064"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000064"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000064"
FT                   /db_xref="GOA:Q5AWG3"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG3"
FT                   /protein_id="CBF78530.1"
FT                   /translation="MSKLKVAISQSHTRQTLADTLIALKHTALAAAARGADILLFPEAY
FT                   LGGYPRTATFGTRFGFREAHGREQFLHYFNGAVDLGDTPAGAGDDWVDKKLPVAKGKQY
FT                   RGDGTRETLEQIANETGLLIIVGVIERAGGSLYCSALYVDPQRGVLGKRRKVMPTGSER
FT                   LVWAQGSPSTLKAVTTEIKGVKLTLAAAICWENYMPLLRQSLYSQNVNLYLAPTVDSRE
FT                   TWLPLMRTIALEGRTVVLSASQSGRHKELPSWVTQAPEGEKIDADPEEWTSGGGSCIVG
FT                   PLGEILAGPIWNVNDDSDPDTALQIVEVDFDDCVRGRLDLDVAGSYSRNDSFTLKVEGL
FT                   DLSPPAL"
FT   gene            complement(170348..171746)
FT                   /locus_tag="ANIA_07366"
FT                   /old_locus_tag="AN7366.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(170348..170811,170863..171012,
FT                   171063..171474,171528..171746))
FT                   /locus_tag="ANIA_07366"
FT                   /old_locus_tag="AN7366.4"
FT                   /note="transcript_id=CADANIAT00000065"
FT   CDS             complement(join(170348..170811,170863..171012,
FT                   171063..171474,171528..171746))
FT                   /locus_tag="ANIA_07366"
FT                   /old_locus_tag="AN7366.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000065"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000065"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000065"
FT                   /db_xref="GOA:Q5AWG4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG4"
FT                   /protein_id="CBF78532.1"
FT                   /translation="MKSVFSLTALQLLASYVAAHPVKGTVLSTFTDRSFPWHIGVPKPS
FT                   SSDSHSKRDVTLPSTWDPPSDLVTPLQEVWDHEVETYSDALGFQNYGFDQVIAAGGKIN
FT                   YCVRWDSSQSVTAEQRSQIAQAASRSYNKWIAGLAGFDGWPYDTVEVNVVGWAVTKESL
FT                   LEGDTSGIDIYTDTDADGIPQCAEACGRFFHQDGDYSGCAAGEDRHYDNSLWLTDGFEG
FT                   GTGGDWGQRVGTDYFLQNLETENIHIYLHEIGHTFALDDFYDWTPTGVASFIMLSGSAT
FT                   EITEFDYWMLRDWWRNLKDRYDLSSVSSSDSTSSSRSAATSSTPVYVPTTTAAATSAPA
FT                   GYVSLPTEVAAVEPSTSTSAVPTAPTIPVATITGAGSESGNENPWSGSGWEQPSQGHPW
FT                   WAGNSWWRQRAESRS"
FT   gene            172366..173290
FT                   /locus_tag="ANIA_07365"
FT                   /old_locus_tag="AN7365.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(172366..172599,172650..172897,172948..173290)
FT                   /locus_tag="ANIA_07365"
FT                   /old_locus_tag="AN7365.4"
FT                   /note="transcript_id=CADANIAT00000066"
FT   CDS             join(172366..172599,172650..172897,172948..173290)
FT                   /locus_tag="ANIA_07365"
FT                   /old_locus_tag="AN7365.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000066"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000066"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000066"
FT                   /db_xref="GOA:Q5AWG5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG5"
FT                   /protein_id="CBF78534.1"
FT                   /translation="MRQASQLLKKLTRKQADPCLYTYPFSVQSLVVHFAIVLALRAKHR
FT                   PSRELTQLGYRLVNVDRNENLREWYLKVNPYGRVPTLTYSGLPSPLTDALSIVYWICDQ
FT                   CPSLLPKAHQTEICRLLSQLHEALDRYGAANPTVDDLLTNHDITPSHRQALEYKRDCQR
FT                   KQRELVSMNLSDGQSMTAQSIAFLNEIVELREKYSKGGTWIFGDKVGPTVLDAHVVPFV
FT                   TRLDDIHLDDLVPDQLRKYAQKIRRLPLGKEAMGQRPTVWDASLGPIDEIRL"
FT   gene            complement(173419..174759)
FT                   /locus_tag="ANIA_07364"
FT                   /old_locus_tag="AN7364.4"
FT                   /product="beta-1,4-xylosidase (Eurofung)"
FT   mRNA            complement(173419..174759)
FT                   /locus_tag="ANIA_07364"
FT                   /old_locus_tag="AN7364.4"
FT                   /note="transcript_id=CADANIAT00000067"
FT   CDS             complement(173419..174759)
FT                   /locus_tag="ANIA_07364"
FT                   /old_locus_tag="AN7364.4"
FT                   /product="beta-1,4-xylosidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000067"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000067"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000067"
FT                   /db_xref="GOA:Q5AWG6"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG6"
FT                   /protein_id="CBF78536.1"
FT                   /translation="MPELSLGRLSALTQTRYVIHLSDGKRLVLFRLPTIDAGGRSRAQN
FT                   ESGDGWSYYAMEAECPHAGGPMEAAQIDIEDSAYIASCPWHAYDFNVETGESSVGIKAC
FT                   TFPIDVQEDAVTLTYPSDGVSIEKLEPVSEKIKLKTPCSGTAAASAEPASTLAAAAPYL
FT                   DEDATLCDWCAHILNTSNPEHKIELTAHLFSTFTEREGTPSPMTIIRGSPASLPPMPPR
FT                   ENLVEVRPSAMPKPGRGGSLKSRIAMLHALANIEQWAIDLAIDICVRFAEFQTSPTAQE
FT                   SARQLPRTFFHDWLKVANDEAKHFSLLRTRLEEMGSYFGALPVHHGLWESATKTAHDLR
FT                   ARISIISLVHEARGLDVNPMTIAKFRNARDDESVQALEIIHNDEITHVTTGHRWLTWIC
FT                   EQEHTDPVEVFRSNVRKYFVGGLKEPFNRDARAMAGMDGRYYDNLVY"
FT   gene            176882..177316
FT                   /locus_tag="ANIA_11555"
FT                   /old_locus_tag="AN11555.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(176882..177074,177135..177175,177293..177316)
FT                   /locus_tag="ANIA_11555"
FT                   /old_locus_tag="AN11555.4"
FT                   /note="transcript_id=CADANIAT00000068"
FT   CDS             join(176882..177074,177135..177175,177293..177316)
FT                   /locus_tag="ANIA_11555"
FT                   /old_locus_tag="AN11555.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000068"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000068"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000068"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCI6"
FT                   /protein_id="CBF78538.1"
FT                   /translation="MKAPAITATFLALTFTLLPCVTAQGVTVNSPCTGAGYACLSGNHA
FT                   IASCDGRRWQLAAECGTQCLRCFMGGVEWDWRTGFAEHSS"
FT   gene            complement(178187..180978)
FT                   /locus_tag="ANIA_07363"
FT                   /old_locus_tag="AN7363.4"
FT                   /product="Pfs domain protein (AFU_orthologue;
FT                   AFUA_1G00560)"
FT   mRNA            complement(join(178187..180907,180967..180978))
FT                   /locus_tag="ANIA_07363"
FT                   /old_locus_tag="AN7363.4"
FT                   /note="transcript_id=CADANIAT00000069"
FT   CDS             complement(join(178187..180907,180967..180978))
FT                   /locus_tag="ANIA_07363"
FT                   /old_locus_tag="AN7363.4"
FT                   /product="Pfs domain protein (AFU_orthologue;
FT                   AFUA_1G00560)"
FT                   /note="transcript_id=CADANIAT00000069"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000069"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000069"
FT                   /db_xref="GOA:Q5AWG7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG7"
FT                   /protein_id="CBF78540.1"
FT                   /translation="MATQTGHLLLRSLAIFREIADYLQNEEGDDELGKFFGHINAYAVI
FT                   LIDCLSPLDHSRSRSSDLEPLLHLLLLKLTTFFRCSVLHEYESTLPPSNHFRRLTALVY
FT                   YWGSAEEHREKLSHTQQCLDFTSQEQRAEMTLLLRGCVATLLSQSSDEPPVAAEHRARP
FT                   KGGDKPSSVYLSAGTVFQALAASSRACSEVHNHNCAARLRLSTHHKQESEQDEFEALIT
FT                   LSLSCHIWQETRIQAVAPGLPATRKAAVRFALPETSCEKSQNRRRRRLAIIRLCEQIEK
FT                   LKSKPLMRLNLVVEDGKLWKDQSSRIERPVNQSDTQLSLADIIKYRPASMTEKVKRVLA
FT                   VLLAYSVLHLHATPWMRSSNFRADDILFFGTSATIPLKPYLQSELNETHYDSAHPIDAD
FT                   ELDPDDLPSHPFPDIVMLAILLMEIYLIQPVESLAEQVGMDFEDWELVDDNTRYSIAIA
FT                   VYDRFKVDFPDNYRQAIDRCLDPNLGFDENDEELSPDGLKMLIYDEIVQPLEEELDQGF
FT                   GNTIQIEKLDEVAQTMDLSRWGQMRQLKPVSPMSTAPSTPDQSTVSPEGSISISRTSTF
FT                   WASSERLVSSTGSIMSHRDYTVGWICALPKELAAAQALLDELHPPLPQDPSDLNNYTLG
FT                   RMGAHNVVMACLPSGLMGTVSAARVASHMRSTFKWLRFGLMVGIGGGVPGEKDIRLGDV
FT                   VVGEPNGPFGGVIQYDFGKTVQNGEFRRTGFLNRPPDLLLTAISRLKADHYRNRADLSR
FT                   HLSDMFERYPHLSRDFSYPGAEYDILFESNYDHAGVRSSCDSCDSSRLLHREPRKSHSP
FT                   HIHYGLIASGNQVMRDGKTREQLRNDLNVLCFEMEAAGIVDVFPCLVVRGICDYSDSHK
FT                   NKIWQGYAAATAAAYAKELLGVISGSQINNAERLGSFQP"
FT   gene            181221..184431
FT                   /locus_tag="ANIA_07362"
FT                   /old_locus_tag="AN7362.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(181221..181491,181550..182281,182380..182596,
FT                   182683..183676,183790..184109,184173..184431)
FT                   /locus_tag="ANIA_07362"
FT                   /old_locus_tag="AN7362.4"
FT                   /note="transcript_id=CADANIAT00000070"
FT   CDS             join(181221..181491,181550..182281,182380..182596,
FT                   182683..183676,183790..184109,184173..184431)
FT                   /locus_tag="ANIA_07362"
FT                   /old_locus_tag="AN7362.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000070"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000070"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000070"
FT                   /db_xref="GOA:Q5AWG8"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG8"
FT                   /protein_id="CBF78542.1"
FT                   /translation="MEIVWQDATISQCANICLQSFNDCLAQFHLLSPRQQSAVDDQLGR
FT                   FSIWVSNIGVFAPTRGSLDYRLREAPDIQRLVRRLLRTLNDYIQQYLSQLDYIHPSSDS
FT                   TCGSPESMSDSLDPIVGGIAEEITLMHQLSNTIRKASRESQNVRAATSFRILNEDGNDI
FT                   EHWFLDLFALGIIQRRFPGCNETLQKRLAVAMLIRRKRILYRRSRYWKSSTQVLSATAK
FT                   AIPLPSKEDVTNQEQTLVPEKPEPTLTQREGSIASSRAVTATTLNLEHWKKASAPSVVS
FT                   RAKTIHWSSHEQLDFPPPPLGPIRRRLKDLRERHLAEHEERLKLLTKPLCQYIRCAFNH
FT                   DLNAILFHGSSSASSMQIDSKSFLEEELERKIENDRIACNNGSMEVVCPYCCCSLSSSI
FT                   VTNKLKWIDHVKYDLDPYVCLFDECDSPNELYNHSEDWLNHMRHHSLRWRCTAKSHGVI
FT                   VFHTRDDYEDHMSSKHKSTKSQLKILAERSSRSSGPLFEYCPLCGESTGHSLEEHVASH
FT                   LRYLALKSLPFPDSYEYDDCSEDLASEFQSAGGRTRSTILEDDDLSQLPSEIGDQNEPV
FT                   AHGSPAYPPHLSHESLVHLPPERASQQSHLSSIPTIGDSANGMADLETAAALMTDIQSN
FT                   AATEPDYVLPKAQSPARFYDPLLPNPVLDTELAGSPAAGPGSSEWEFVNTAHSTHHDSS
FT                   LDPILSTFQAEVSDSISDNNPNTVQAAPIQRPSDRRVLCHACGQIITPQEEESPELNEL
FT                   ENINTLADHAQSMSLGAAGVDPGSAPDATGARNSNNIPTTTDDDLFTRAVSKYRDAFLE
FT                   QHSHLAEDERLRLWAQQLPQFIDGTSNVPNLIPTLSGRKRRGSGFSEPPAERIEMEDTL
FT                   GFQSAPTIQFIDEANTERTGTMNRVARETYVTNLDAETADCANTVASPGCEHRDEILKR
FT                   "
FT   gene            complement(186646..188410)
FT                   /locus_tag="ANIA_07361"
FT                   /old_locus_tag="AN7361.4"
FT                   /product="glutamyl-tRNA synthetase (AFU_orthologue;
FT                   AFUA_2G16280)"
FT   mRNA            complement(join(186646..187477,187528..187782,
FT                   187831..188256,188328..188331,188370..188410))
FT                   /locus_tag="ANIA_07361"
FT                   /old_locus_tag="AN7361.4"
FT                   /note="transcript_id=CADANIAT00000071"
FT   CDS             complement(join(186716..187477,187528..187782,
FT                   187831..188256,188328..188331,188370..188410))
FT                   /locus_tag="ANIA_07361"
FT                   /old_locus_tag="AN7361.4"
FT                   /product="glutamyl-tRNA synthetase (AFU_orthologue;
FT                   AFUA_2G16280)"
FT                   /note="transcript_id=CADANIAT00000071"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000071"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000071"
FT                   /db_xref="GOA:Q5AWG9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWG9"
FT                   /protein_id="CBF78544.1"
FT                   /translation="MLRSALAGPTLMELQSERTEIHRKYAEKLIQRGHAYRCFCSPERL
FT                   DAHARHRSQAGLPPGYDRKCASLLPAHSEERAALGESHVIRLRVEDHPYRYPVYDDLVY
FT                   GETGHKGPPTKLDLIDRVYDDPILIKSDGYPTYHLANVVDDHLMEITHVIRGTEWMSST
FT                   PLHVLLYKCFGWKAPRFAHVPLLVDHSGQKLSKRNADIDLSHFRDQGVFPEPLLNFAAL
FT                   LGWSHKEKNDIFDLKKLEHRFTLKFTRGNTTVAFEKLWFLQSAHVKRYVDGNMPQVNEM
FT                   ISAVAKVVQSTASPEQLSQILQSRPLVDMITPLIKADAKNYTNPKEFVARNSTFFTTDI
FT                   SRPPYDRAVIQFVIPFSSLHTAAAAVTLIPKSHWTLETLRENFATYDAASAVPEEVMTV
FT                   DAEKKFKKELYHYLRWALSAGASGPTVPEIMIILGREETLKRLEEARKLTTEDGAVSPV
FT                   AARLMKEKGLEPKTGSANKAQTKGHSWTPHPSLPSAS"
FT   gene            189109..190693
FT                   /locus_tag="ANIA_07360"
FT                   /old_locus_tag="AN7360.4"
FT                   /product="DnaJ domain protein (Mas5), putative
FT                   (AFU_orthologue; AFUA_2G16290)"
FT   mRNA            join(189109..189236,189271..189881,189932..190693)
FT                   /locus_tag="ANIA_07360"
FT                   /old_locus_tag="AN7360.4"
FT                   /note="transcript_id=CADANIAT00000072"
FT   CDS             join(189198..189236,189271..189881,189932..190490)
FT                   /locus_tag="ANIA_07360"
FT                   /old_locus_tag="AN7360.4"
FT                   /product="DnaJ domain protein (Mas5), putative
FT                   (AFU_orthologue; AFUA_2G16290)"
FT                   /note="transcript_id=CADANIAT00000072"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000072"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000072"
FT                   /db_xref="GOA:C8VCJ0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCJ0"
FT                   /protein_id="CBF78546.1"
FT                   /translation="MKSEKPTAKYGPDAALANHPDKFPEEERDAASVRFQEVQQAYEIL
FT                   SDDDKRHLYDTHGMGAFNGSGEPGMNGGPDLDDILAQMFGMGGMGGMPGMGGMPRPRQS
FT                   PDEEQKYEVSLEELYRGKTVKFASTKNVICSLCKGKGGKEKATAKKCSTCDGHGFKEVL
FT                   TRMGQFLTKSTQTCTTCNGDGQFFATKDKCKKCKGKKTTEERKILEIYIPRGAKDGDRI
FT                   ILEGEADQVPGQEPGDIIFQLEEEKHPVFTRAGADLKATIDITLAESLTGFSRVVLKHL
FT                   DGRGIELAHPKPGHSQILSPGQVLKVPGEGMPIKRSDARGDLYLIVNVKFPDENWKPSP
FT                   AVLERLKEMLPKPGPQIQADTVDEVEYDPKGNVEEFGSKDPSGGDAWEDDDEEGEGAQC
FT                   TTQ"
FT   gene            191591..193198
FT                   /locus_tag="ANIA_07359"
FT                   /old_locus_tag="AN7359.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(191591..191905,191969..193198)
FT                   /locus_tag="ANIA_07359"
FT                   /old_locus_tag="AN7359.4"
FT                   /note="transcript_id=CADANIAT00000073"
FT   CDS             join(191591..191905,191969..193198)
FT                   /locus_tag="ANIA_07359"
FT                   /old_locus_tag="AN7359.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000073"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000073"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000073"
FT                   /db_xref="GOA:Q5AWH1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH1"
FT                   /protein_id="CBF78548.1"
FT                   /translation="MPTTLSTLQSSLPLPLPVLAIIALFLLRFIWRRFGSGLRGIPGPA
FT                   LAKCTRLWKLHSVWKGDHHLTEINLHRQHGPLVRIGPRHVSVADPKAIPVIYGLNKGFT
FT                   KTGFYPIQCISWNKKPQMNLFSTRDEQFHRDQKRPVANAYSMTSLLELEPAVDSCTAIF
FT                   LSRLRDFAGKKRPVDLGTWLQYYAFDVVGEFTFAKKLGFLEEGRDVDDMMAGIQGILAY
FT                   ASLIGQVPEAHKVLLGNPLMPILMPSMESWNQVLQFTLKQVNSRTSLARDGELDKGDLE
FT                   EGKDMLSRWMAIHVADPEKMSTRDVIVHLSTNVFAGSDTTAIALRAIMYFLLKNPDKME
FT                   KAVGEIEAADSAGRLSSPISYKESMTHLPYLGAAIKEAMRLHPSVGLILERHVPEGGVT
FT                   VCGRYIPAGTTVGINAWALHHDEKVFPSPGAFMPERWLESPPAKLKEMEQSFFAFGAGS
FT                   RTCVGKNISLIEMHKIIPQLLRDFTFRLHRPGDEWKTKNAWFVQQEGLVVDLERRR"
FT   gene            194394..196442
FT                   /locus_tag="ANIA_07358"
FT                   /old_locus_tag="AN7358.4"
FT                   /product="hypothetical dihydroxy-acid dehydratase
FT                   (Eurofung)"
FT   mRNA            join(194394..194984,195032..195186,195233..196442)
FT                   /locus_tag="ANIA_07358"
FT                   /old_locus_tag="AN7358.4"
FT                   /note="transcript_id=CADANIAT00000074"
FT   CDS             join(194394..194984,195032..195186,195233..196442)
FT                   /locus_tag="ANIA_07358"
FT                   /old_locus_tag="AN7358.4"
FT                   /product="hypothetical dihydroxy-acid dehydratase
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000074"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000074"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000074"
FT                   /db_xref="GOA:Q5AWH2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH2"
FT                   /protein_id="CBF78550.1"
FT                   /translation="MPCQSKCEGCACGSASSQSASAVNIEDLDKELEALRKRTIELEKV
FT                   RASAKKVSSLSSTLGAGRKLRSTTWFNSGDAGMTALYIERYLNYGVTREELMAGKPIIG
FT                   IAQTGSDISPCNRYHIELAKRVREGIRTAGGIAFEFPTHPIQETSRRPTACIDRNLSYL
FT                   GLVEILHGYPIDGVVLLTGCDKTTPACLMAAATMNIPAICMNVGPMINGYLKNELAGSG
FT                   MVVWTGREMHAAGKLDDEGLVDLISRGAPSVGHCNTMGTASTMNALAEALGMALPGSAA
FT                   IPAPYRERAQCAYKTGLQIVEMVHADRKPSDIMTREAFENVIAVNTAIGGSTNAPIHIN
FT                   AIAKHMGVDISLDDWDQLGFNIPLLLNMQPAGEFLGEEYYRAGGLPAIMAELLDAGKLH
FT                   PDILTCNGHTVAENVKGHHSWDRRVIKPYSEPLMKDAGFVHLQGTLFESAIMKTCVISE
FT                   QFRQHFLENPDDPNAFEGAVVVFDGPEDYHRRLEEAPINDKSILVMRGTGPLGYPGAAE
FT                   VVNMHPPGHLLRQGIKSLPCIGDGRQSGTSGSPSILNASPEAAAGGNLALLRDGDRLRV
FT                   DLNKRRVDILVSRKELDERRAALEAAGGYSIPESQTPWQELFRKETSQLNEGMVLREAV
FT                   KYQRLAQRSETLRHNH"
FT   gene            198052..198652
FT                   /locus_tag="ANIA_07357"
FT                   /old_locus_tag="AN7357.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            198052..198652
FT                   /locus_tag="ANIA_07357"
FT                   /old_locus_tag="AN7357.4"
FT                   /note="transcript_id=CADANIAT00000075"
FT   CDS             198161..198652
FT                   /locus_tag="ANIA_07357"
FT                   /old_locus_tag="AN7357.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000075"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000075"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000075"
FT                   /db_xref="GOA:Q5AWH3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH3"
FT                   /protein_id="CBF78552.1"
FT                   /translation="MAPNLFLCLRTVFCPTYWFQRGQRIQGSISREEHWDSPVPGIYKY
FT                   IPSQGWHLVCRDGSDYDEKVPVPVVYCRILHRYLFEDEVNERCRWHTVTLDGGKTEKLL
FT                   FFQLDDGYTYVAGWDSKGKFIPGPYQRWYLDPETKTMQKVFFPPSSNVSRVSITPDKLN
FT                   "
FT   gene            complement(199123..199693)
FT                   /locus_tag="ANIA_07356"
FT                   /old_locus_tag="AN7356.4"
FT                   /product="thioesterase family protein (AFU_orthologue;
FT                   AFUA_2G16350)"
FT   mRNA            complement(join(199123..199555,199617..199693))
FT                   /locus_tag="ANIA_07356"
FT                   /old_locus_tag="AN7356.4"
FT                   /note="transcript_id=CADANIAT00000076"
FT   CDS             complement(join(199123..199555,199617..199693))
FT                   /locus_tag="ANIA_07356"
FT                   /old_locus_tag="AN7356.4"
FT                   /product="thioesterase family protein (AFU_orthologue;
FT                   AFUA_2G16350)"
FT                   /note="transcript_id=CADANIAT00000076"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000076"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000076"
FT                   /db_xref="GOA:C8VCJ4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCJ4"
FT                   /protein_id="CBF78554.1"
FT                   /translation="MPREIDLKRRRTRKDYIFHQTYRTRWHDNDMYAHLNNTVYAQLFD
FT                   SIINHYLITECGMDPFSYTSSTPAKNDINPSGQVAIMVNSYCDYFASVSYPDILDLGLR
FT                   VNKLGSTSVTYEVGVFKQGEEDVKVVGGYTHVWCERGVMRPAKGGMERGIREALGKLLV
FT                   KEESKI"
FT   gene            200563..202216
FT                   /locus_tag="ANIA_10930"
FT                   /old_locus_tag="AN10930.4"
FT                   /product="FAD-dependent oxygenase, putative
FT                   (AFU_orthologue; AFUA_3G00840)"
FT   mRNA            join(200563..200808,200867..201083,201130..201527,
FT                   201572..202216)
FT                   /locus_tag="ANIA_10930"
FT                   /old_locus_tag="AN10930.4"
FT                   /note="transcript_id=CADANIAT00000077"
FT   CDS             join(200563..200808,200867..201083,201130..201527,
FT                   201572..202216)
FT                   /locus_tag="ANIA_10930"
FT                   /old_locus_tag="AN10930.4"
FT                   /product="FAD-dependent oxygenase, putative
FT                   (AFU_orthologue; AFUA_3G00840)"
FT                   /note="transcript_id=CADANIAT00000077"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000077"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000077"
FT                   /db_xref="GOA:C8VCJ5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCJ5"
FT                   /protein_id="CBF78556.1"
FT                   /translation="MGAMSRWLTVAGLTLLVTGSHAQLLSRDDIQTTLAPQLSANAGIY
FT                   LPHEEVFQLATERWSYYHPPNFTVVVEVAEEQDVATTIKYANANNLPFLAVNGGHGSIS
FT                   SLSNIDHGIQIWMHKLNFVQIAEDGKTATVGGGIKSAELIPALFAQGKHTVHGVCECVS
FT                   YLGPALGGGHGTLQGKYGMASDQFVSLRIATADGEIVTVSENEGDRDLWWAMRGAGHNF
FT                   GIVTSVTSKIYDVPEQGKWAYEQLLFTGNQSEELFAAFNELADIQPPGFMVWTYLVRIP
FT                   PLHPTEPIYLANFMREALDEIEPELIDPFRKISQRPALAKTVGLYTDIPTWINTAVNSR
FT                   GCAAEANKVRFPIGFPRYDPKAQQRLFDVFANGTAGGSPFNTSMILLEQYSAQGVESYP
FT                   QNSSAFPHRYDDLLISPVIAYLSDSEEEEEAAVEFGDLLRNILLRTSENPDELHAYVNY
FT                   ASGYEGPRPWYGYEPWRLEKLQEVKRRYDPQGKFSFYAPIPLS"
FT   gene            202511..204288
FT                   /locus_tag="ANIA_10936"
FT                   /old_locus_tag="AN10936.4"
FT                   /product="DRAP deaminase (Rib2), putative (AFU_orthologue;
FT                   AFUA_2G16360)"
FT   mRNA            join(202511..202753,202813..204288)
FT                   /locus_tag="ANIA_10936"
FT                   /old_locus_tag="AN10936.4"
FT                   /note="transcript_id=CADANIAT00000078"
FT   CDS             join(202511..202753,202813..204288)
FT                   /locus_tag="ANIA_10936"
FT                   /old_locus_tag="AN10936.4"
FT                   /product="DRAP deaminase (Rib2), putative (AFU_orthologue;
FT                   AFUA_2G16360)"
FT                   /note="transcript_id=CADANIAT00000078"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000078"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000078"
FT                   /db_xref="GOA:C8VCJ6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCJ6"
FT                   /protein_id="CBF78558.1"
FT                   /translation="MSLVPVDTTLKVPPPDPVQEPPKVAITPCEGLPVRYYFEGGLRRV
FT                   YPYHYTYNTYCKERWRNRELIDIFTSEFRDREPGYYKKALESGNVCVNGKPAGPHTVLK
FT                   NGEVISHTLHRHEPPVTGNEIGIIHETDDLLVIDKPAGVPVHSTGRYHYNSVMEILRIQ
FT                   NGGAYVPRPCNRLDRLTSGVMFVGKTAQGADRMTVKLKERTVQKEYVARVKGRFPDGVV
FT                   VVDQPIMSVSPKVGLNRVRATGKEAKTKFRRLAYYPPPSPTTSTSDEGENARPATPPPS
FT                   YVNESEGYSIVHCFPLTGRTHQIRVHLQFLGHPISNDPIYSNRRVFGPDLGKNDSSADL
FT                   DEEIIDRLMAMGRTEVPDIGPVETPKPKPALSTKPPSEQPSGEQSTSSDKGEDKDQVSY
FT                   RTHFTTPPLLPPGTSASVVEAIMTKEHEAAVAEYQKRKGERLSGEKCDVCGTELYTDPG
FT                   VHELGIFLHAVAYSDAHGEWSYRSKMPSWARPPKGVEGPTEVPKWVEEEEGKEVVVGDG
FT                   VVPDIGVDEGDVAKNEKRKGKQGATALVEGVGMIDISAARQAESEDVATAAAGTA"
FT   gene            complement(204600..205750)
FT                   /locus_tag="ANIA_07354"
FT                   /old_locus_tag="AN7354.4"
FT                   /product="60S ribosomal protein L32 (AFU_orthologue;
FT                   AFUA_2G16370)"
FT   mRNA            complement(join(204600..204970,205040..205161,
FT                   205251..205375,205585..205624,205687..205750))
FT                   /locus_tag="ANIA_07354"
FT                   /old_locus_tag="AN7354.4"
FT                   /note="transcript_id=CADANIAT00000079"
FT   CDS             complement(join(204862..204970,205040..205161,
FT                   205251..205375,205585..205624))
FT                   /locus_tag="ANIA_07354"
FT                   /old_locus_tag="AN7354.4"
FT                   /product="60S ribosomal protein L32 (AFU_orthologue;
FT                   AFUA_2G16370)"
FT                   /note="transcript_id=CADANIAT00000079"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000079"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000079"
FT                   /db_xref="GOA:Q5AWH6"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH6"
FT                   /protein_id="CBF78559.1"
FT                   /translation="MVLAKKHVPIVKKRTKRFTRHQSDRFKCVPESWRKPKGIDNRVRR
FT                   RFKSNIPMPSIGYGSNKKTKHMMPSGHKAFLVHNVKDVELLLMHNRTYAAEIASAVSSR
FT                   KRVDIIAKAKALGVKVTNPRGRVTTEA"
FT   gene            complement(205945..207336)
FT                   /locus_tag="ANIA_07353"
FT                   /old_locus_tag="AN7353.4"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   protein (AFU_orthologue; AFUA_2G16380)"
FT   mRNA            complement(join(205945..206453,206519..206808,
FT                   206951..207129,207228..207253,207306..207336))
FT                   /locus_tag="ANIA_07353"
FT                   /old_locus_tag="AN7353.4"
FT                   /note="transcript_id=CADANIAT00000080"
FT   CDS             complement(join(205945..206453,206519..206808,
FT                   206951..207129,207228..207253,207306..207336))
FT                   /locus_tag="ANIA_07353"
FT                   /old_locus_tag="AN7353.4"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   protein (AFU_orthologue; AFUA_2G16380)"
FT                   /note="transcript_id=CADANIAT00000080"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000080"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000080"
FT                   /db_xref="GOA:Q5AWH7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH7"
FT                   /protein_id="CBF78561.1"
FT                   /translation="MTIGVAIIGSGIFAREQHLPAIKEAPMFSLKAIYSRSLKSAQGLA
FT                   EGLEGVDLYSDDSGAGKSYQDLLARQDIGAVILALPIVAQPAYIKEALAAKKHVLSEKP
FT                   IAKDLATAQDLMAWYNDNANVDKSKTFWGVAENFRFIRKWLKTAEEVQKLGGVKTFRVV
FT                   VRNKVGTEGKYFSIDTPWRKIPEYQGGFLLDGGIHTVAGVRLILGRGKNSLKSLTAQTS
FT                   QLQEHLPPIDTVDALLTTASGAAGVFSLSFGSEFKSFVLEFTCEKGVVSLVDDQLTVNG
FT                   VATEIPFEGVGVKEEVKAFGESIVNGELNKKLVPDEALADLEVLEMMFRSGEDGGRKTL
FT                   KLQD"
FT   gene            209415..210604
FT                   /locus_tag="ANIA_07352"
FT                   /old_locus_tag="AN7352.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(209415..209604,209672..210604)
FT                   /locus_tag="ANIA_07352"
FT                   /old_locus_tag="AN7352.4"
FT                   /note="transcript_id=CADANIAT00000081"
FT   CDS             join(209415..209604,209672..210324)
FT                   /locus_tag="ANIA_07352"
FT                   /old_locus_tag="AN7352.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000081"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000081"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000081"
FT                   /db_xref="GOA:Q5AWH8"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH8"
FT                   /protein_id="CBF78563.1"
FT                   /translation="MATTTATAYTSTTLVSVPSTFGTNCPTCGQAPGSQSHPAEPTRRR
FT                   VKELEGQVQFLNEQAAKMSEKLLEYEAELRRLRAQSPNQGQNQPSSFTSRNGFSISSTS
FT                   TSSHSPSNSQSQSPLQVQQTQSRLSSLASLLPYRRPSTASSQPQSQSQPPASPGAQQCQ
FT                   LAPFTQSPPPLSQPRTDTPTPRPSFEETLELQNALNREQSLRKAAETQLTQASTELEEL
FT                   TAQLFSQANEMVAQERKARARLEERVAVLERRDIEKRNRLERLEKAMERVERIRALVG"
FT   gene            complement(210749..212641)
FT                   /locus_tag="ANIA_07351"
FT                   /old_locus_tag="AN7351.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(210749..211288,211347..211690,
FT                   211813..211846,211890..212098,212170..212199,
FT                   212280..212337,212403..212423,212477..212641))
FT                   /locus_tag="ANIA_07351"
FT                   /old_locus_tag="AN7351.4"
FT                   /note="transcript_id=CADANIAT00000082"
FT   CDS             complement(join(210749..211288,211347..211690,
FT                   211813..211846,211890..212098,212170..212199,
FT                   212280..212337,212403..212423,212477..212641))
FT                   /locus_tag="ANIA_07351"
FT                   /old_locus_tag="AN7351.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000082"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000082"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000082"
FT                   /db_xref="GOA:Q5AWH9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWH9"
FT                   /protein_id="CBF78565.1"
FT                   /translation="MAGQLLSDPGSSPCRSCQQQEQNIKTPDIISEPWMVELRSSKAFV
FT                   TWVVAIAVFTDVFIYGMIIPILPDVLKTRVSIPEDESFGGALFVGSPFFGYLADKTSSR
FT                   QAPFMVGLLALAGSTVVFWFARTIEALVIARTFQGLSCAVVWTVGMALIVDTMGKDQVR
FT                   LWDPLLEELYIALRLMMIEPRTANRWVDDAHAESESESGTETERLMSPATATLASAYES
FT                   IPRVHEQPRDFESQSRHSTSKSVAEGLTPTRSSMPGILRMMCSVTLLIVLQATLVEAMA
FT                   WASFDSVLPLYVRSTFSMTPLGIGLCFIPLFLPSFLSALIGTAVDKHGSRPIAILGFVI
FT                   DVPAFFLLRLVSSNTLRDQTILYFLLFFAGLAAALKTVSLMVEVTRAIETKERLCPGIF
FT                   GEKGGTAQAYGLFNAAWSGGQVAGPLVAGWLVDSWGWDVMVSVFGGISAVTAVGLLVTT
FT                   ATTKREKK"
FT   gene            complement(215003..217031)
FT                   /locus_tag="ANIA_07350"
FT                   /old_locus_tag="AN7350.4"
FT                   /product="translation initiation factor 4B (AFU_orthologue;
FT                   AFUA_2G16400)"
FT   mRNA            complement(join(215003..216021,216071..216352,
FT                   216407..216487,216616..216666,216723..216779,
FT                   216875..217031))
FT                   /locus_tag="ANIA_07350"
FT                   /old_locus_tag="AN7350.4"
FT                   /note="transcript_id=CADANIAT00000083"
FT   CDS             complement(join(215003..216021,216071..216352,
FT                   216407..216487,216616..216666,216723..216779,
FT                   216875..216878))
FT                   /locus_tag="ANIA_07350"
FT                   /old_locus_tag="AN7350.4"
FT                   /product="translation initiation factor 4B (AFU_orthologue;
FT                   AFUA_2G16400)"
FT                   /note="transcript_id=CADANIAT00000083"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000083"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000083"
FT                   /db_xref="GOA:C8VCK1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCK1"
FT                   /protein_id="CBF78566.1"
FT                   /translation="MAPGKQKAQKMSLGNFLADENFGSWADEMEDMPLPGKSPAPSSFG
FT                   TDRRPPPASSAGFGGPSFNDRGFAMREPLPLPTEPPYTAHIGNLSFDATSGDISDLFAD
FT                   CGVTNVRIVEDKLTKAPKGFGYVEFETVDGLKKALDLSGATLQGRSIRVSIAEPPKERD
FT                   VKELDWTRRGPLPDVAPPRRVPDRASFGRNLDNLSDAGSEPRRRGGFESDGKVRDFSNW
FT                   ERKGPLSPPPMREGRPRNDDNAGFRTRSPAWGEGRSQDGSRPPRREFQERAPTAAELDN
FT                   QWRARMKPDGPKQPSNPPSPSPAAAVPAAAPAPATRPKLNLQKRTVTDAAASPSPSTES
FT                   KSSIFGGARPIDTAAREKEVEQRRQLALRQKKEAEEKAKAEKAERQKAAKEAAKSEKPV
FT                   STLDPNGRDQQDTPRGGGNFEILRRAGEDESGMSADQDPEQQAEGGGAAAAEAPKADDK
FT                   VNGSWRAGPTSTENAGDDEGWSTVSSKPRNNRRGGRNFA"
FT   gene            complement(218464..220050)
FT                   /locus_tag="ANIA_07349"
FT                   /old_locus_tag="AN7349.4"
FT                   /product="Alpha-1,3-glucanaseMutanasePutative
FT                   uncharacterized protein ;;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q96VT3]"
FT   mRNA            complement(join(218464..219077,219123..219254,
FT                   219307..219835,219884..220050))
FT                   /locus_tag="ANIA_07349"
FT                   /old_locus_tag="AN7349.4"
FT                   /note="transcript_id=CADANIAT00000084"
FT   CDS             complement(join(218575..219077,219123..219254,
FT                   219307..219835,219884..220015))
FT                   /locus_tag="ANIA_07349"
FT                   /old_locus_tag="AN7349.4"
FT                   /product="Alpha-1,3-glucanaseMutanasePutative
FT                   uncharacterized protein ;;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q96VT3]"
FT                   /note="transcript_id=CADANIAT00000084"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000084"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000084"
FT                   /db_xref="GOA:G5EB58"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB58"
FT                   /protein_id="CBF78568.1"
FT                   /translation="MKIFHRCCAALTLLANALPALSLPGANSLTIRKDSNKYVTAHFMV
FT                   GIVENYTVDDWKHDMELAKETGIDAFALNCASIDSYTDKQLAYAYEAAEEVDFKVFISF
FT                   DFAYWSNGDTARITSIMQTYADHPGQFQYNGAALVSTFVGDSFDWGPVKRAVDHPIFAV
FT                   PNLQDPNWAGHATTSIDGAFSWYAWPTDGGNSIIKGPMTTIWDDRFRNNLKDKVYMAPV
FT                   SPWFSTHFNTKNWVFICEDLPHLRWQQMLEMQPELIEIISWNDYGESHYIGPYSEAHSD
FT                   DGSAQWTKDFPHDAWRIIAKPYIAAYKAGEREPTVESDQLVYWYRPTPKAVTCSKDPLG
FT                   PPNGINLLEDSVFVTTLLTEPATLTVGSGSLEFSVDVDAGIVTNSFPMGVGSQAFSVTR
FT                   DGEEILGGDGGLDVQDRCDYYNFNVYVGSFSA"
FT   gene            complement(221150..231126)
FT                   /locus_tag="ANIA_07348"
FT                   /old_locus_tag="AN7348.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(221150..221295,221568..221632,
FT                   221671..221813,222168..222384,222464..222564,
FT                   222619..226482,226531..231126))
FT                   /locus_tag="ANIA_07348"
FT                   /old_locus_tag="AN7348.4"
FT                   /note="transcript_id=CADANIAT00000085"
FT   CDS             complement(join(221150..221295,221568..221632,
FT                   221671..221813,222168..222384,222464..222564,
FT                   222619..226482,226531..231126))
FT                   /locus_tag="ANIA_07348"
FT                   /old_locus_tag="AN7348.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000085"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000085"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000085"
FT                   /db_xref="GOA:Q5AWI2"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019439"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWI2"
FT                   /protein_id="CBF78570.1"
FT                   /translation="MTLFNPTTVLVGFLLLYLASFLIFAIVRIATGISIQRIGYFSLRR
FT                   IAYVPSEGVQIELRGLGLSLHPPSFAQPTWLSLRLTDLKITLDPSASGKRSSSTTKLYT
FT                   DEAQSQSEDEPLNQQYRKGEAASARKNKTWATFNRVKERVKRIHRMVHWLRLVDIVAVN
FT                   TTINFLEAGQIQIGTLSMAVDTRRKMVDRGKVFRRKKGESGEQRPAEWILNVHNVQVAV
FT                   DGNEPIEVLDNVGVNIHGILHKGLDGLRDASVAFKIGRMHIPYDDLTLLVQRIKQSRKP
FT                   LVQVDVTKPDEEVTFADYVEELKKPGSTDETIVETVTASKEFAGSLLRGIQEIQVALSF
FT                   FRLSRSVQSPSPGQSSVYLNVVSHEIGIDLHRMDQTSPAHRMYFQRTDVAHQALLAAIS
FT                   LSVSLDDSSGETDNILYIPMATTTIKTTLPSKTLSSYDGFNAEERNTNILFANLVVTSP
FT                   ALDLEPRHVSRLLGLAQTKASTSRGKKRARGQLISRLLPKANIKLSVHEPVVRFVLPIP
FT                   DSSSTGEDDYNLLISSISSISVDVESSHSSEGGAHYSLSSIYRVASHKFYYQTPSGIKH
FT                   NLLTTDNMELKLLLSASPEVCVVVSGSLNNFSGHMVNSEVNRGIQQVVEQFRAQIRPKK
FT                   KYGLPGEDRKPSILRRLPPWLLRFQFEATGFSLEIAGVDESVSKVTRGVSLQLQSWTAD
FT                   YRAQKTEPTAVSVVRRRTPSHSTIGDESPFRFNPTSPPKQTRPGAADGRRLAFHARGFE
FT                   GFVIESEDYLESEPFLSLPRFEIALSTSSDRLGPIFHVNSLIKGVYLQYSLYRYYCLSV
FT                   ALSVLQKAFLPSSQKQPSSPNVAGDTSPPLSPRLAIQRGELITVDIKATVLQVKTFMPA
FT                   DPPMLLQVYGVTAGSHRHSAPFVRAHLVRLHAEAPKLRGVWARIVSMNNFRLDLRKMKL
FT                   KQGKSLVEDKSIDVWTDFVRIGVPHHMIMHRIFDNVINTSKALKQLHHRLKHQIPDFVS
FT                   ARDPEGPKKVPKISFRSKALLFELEDDAFEWKLGCIYRTGLIEQRQRRAREDAFHLKLQ
FT                   KLKESDQRRASSRLRTRSSHRTLRSERVSSDSRRSKSADPKPRNDRAEEKEEKRGRAHR
FT                   FRYDTEGASSFSNEAKVSSESAWYWLQHYNARSWKAKIDAALQFQNSTIREVRNLFEGA
FT                   DDPPEDVQETETVLAIPNRPALMAALISDINLTIDKPTFPSENYPLFLHNIGKGMPMST
FT                   KYALLIPMSIQLDMGEARVNLRDYPLDLLHIPGLRPGQSPRLPSWSLRTNFVIAEEYRD
FT                   YKSSRKVNVELVPSSEMSDGTTSPPFLLDIWRSVSPVKTYSDPVIEINTNLPTSISWGM
FT                   SYQPVIQDMMKIIEGFTKVEIDPSERVGFWDKIRLSFHSRIRVKWKEDGDVHLRLKGSR
FT                   DPYVVTGFGCGFVMCWRKDVQWNIHTTDDPKEFMSVTSGEYVLAIPDYSHEARYLAEAT
FT                   AEDLETSSMSSDQKNAAQFKKVIMKLSGDVKWAAGLVFERNVNENERSTEFRPHYDVVL
FT                   RNPNYINPSEREDYDAYRGFRSNHIHLSVAIIAPNSKNWNADSEQPTTSYNTVHLTPRF
FT                   FTHFYSWWSLFSGVMSLPVRQGRLWPGITKTNKKFNRHLATIKYKLLLAPLFVAHIYKH
FT                   KDPEDYVDDIVTATGIKVRLDSLKLDVHQRREQIKTPSKGRLKQPQASAIRIYRAELDL
FT                   QAADFRAVSASIEGTGADELEKKRDDIISSFQQPVPPADLSRFTIPDHNLDWVDMDDFV
FT                   ELDWILPQESNPRTKILPLAFTPRFTYFRQTDQEEVSAGQTGYSSFGHEDTHECVMSDR
FT                   NQPRRVQLALIQDRLATIEAKIQECTRSIGDLELQMAKDVDQNEQLRVQHREYLRQAAS
FT                   LARRRAFLTAGLHRLEKQLNQSKSTETYQSESTRADADSDSASDGKEADFDGLYSSPHD
FT                   DLNSDFNNRFMIHSVQLKWNNSLRNIILRYIHQVSQRRGFVYYMSRRAVKFILDIVEEQ
FT                   SKNQATYSKLFRGSSRRPSDVHDDDDSVEDRIEQLLHDAKRFVSAEEQDPPEQKDPPTV
FT                   RSDSSESISPEFTAQNSYHLRLIAPQIQLQSEKNHKSVILVAAKGMQLQVVSIMDKERV
FT                   FDDVSGLVQRRFTLNMDGAQFFVATQKNLMTHLQFYAGNKYGNAPGSAWPPWLTLEAMF
FT                   DFELNPFGFSRIIQKTSASLRYDKYNNLRLKYNDEVAKGQPDELGHPDGQETRMDSISV
FT                   DFPQFRAICDSAEYYTLYIIVLDLLLYSEPLEKVRNERLERIMFTSDFSDLRGAPEMVY
FT                   KLQSRIRQLEEIKEHFQIHAKYLDKRGWEDRLILEKDIARCEDELFFLMKAITTSQRKV
FT                   EPTVTGATGLLRWNISASEIVWHLMKDESEPLVEFQLRNAEYDRTDNTDGSNHNQVSVE
FT                   RLYGLNLLPDAVYPQIIVPYLDQARRLEGPDDYMIKIKWHMLEAVAGIPVVDDFEVSLF
FT                   PLKIQLEHELGQRVFEYMFPNVGSTAFENGGFSPFMIKNVKPLESLDSDDEESGQTSPS
FT                   SLQHHSDTSGDDPAKGPSPLELRLQPTLSLSENPRLERRPTHLKAFAMTPIHKESGRQQ
FT                   ARPASALVKKKSADSLRVLSRQATSLSANGVNDEKGKKFGLGIMGGKGKGKKGIDDFAQ
FT                   MMARASNYMTLAHVRVHDVVLCVSYKGKGEHNIEDLHDFVFRLPILEYRNKTWSNLDLA
FT                   LRLKKDVIKALISHAPAILGNKFSHHRPSKQQLRRYRELATSSQLLNNQDTGTSPPENG
FT                   TSPSMASADSSSGYLSESQSHRSSPLARSNSLGSSMYSGKDQSGLFDSRSASEVDVDAR
FT                   WEQSRRIVNPPARPVTSGSAITRSDTARKIDWSEDGQLSATLAANYSLVGSNLPQNGLH
FT                   TSHLFRHHPPSMDSLALTSQKFPSHSTLIIFHLYQDTPDGEKPEIRYGTNLAICVSDQV
FT                   CLSRRGCVDGTWHPSRLNSRCRAPDWTELKWIKLYMGLNLKRKVLTLPFIDCIGTSAAF
FT                   DARVAPITSHIDLGSSAMRAQLQFLSVFRWQVLANGDRFGHIVRGLGA"
FT   gene            complement(232195..233185)
FT                   /locus_tag="ANIA_07347"
FT                   /old_locus_tag="AN7347.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(232195..232505,232579..233185))
FT                   /locus_tag="ANIA_07347"
FT                   /old_locus_tag="AN7347.4"
FT                   /note="transcript_id=CADANIAT00000086"
FT   CDS             complement(join(232195..232505,232579..232801))
FT                   /locus_tag="ANIA_07347"
FT                   /old_locus_tag="AN7347.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000086"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000086"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000086"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCK4"
FT                   /protein_id="CBF78572.1"
FT                   /translation="MVSTGLCVEPLFGVSIRLVTPEAYSGILTDWGFISGLRGNILKHY
FT                   YEDQATSKQRTYASTISGGVAGGAVTKLMGGRLIPGLVVFSLFGYVGQVSYNAIDKWQL
FT                   AQANTPSKPFLTRIAESKWVPLKSLTDDEYRGILSEKLLTIEAEIALIDEKIEELQKAK
FT                   LDAMAEVSPGQEAR"
FT   gene            235747..237595
FT                   /locus_tag="ANIA_07346"
FT                   /old_locus_tag="AN7346.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(235747..236525,236571..237027,237077..237595)
FT                   /locus_tag="ANIA_07346"
FT                   /old_locus_tag="AN7346.4"
FT                   /note="transcript_id=CADANIAT00000087"
FT   CDS             join(235747..236525,236571..237027,237077..237595)
FT                   /locus_tag="ANIA_07346"
FT                   /old_locus_tag="AN7346.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000087"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000087"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000087"
FT                   /db_xref="GOA:Q5AWI4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWI4"
FT                   /protein_id="CBF78574.1"
FT                   /translation="MPLTLPCDACSFRRVKCDGKNPCSTCLRREQSCTYLKVRKRRGPK
FT                   GPRRSTNARVQAMQKNLGIEKSCSMRECSLPASDGTPASPTSSASSDDPLLVRRRISLS
FT                   TYYTYIDIFRSQLYTVWPIVSTNALKAKLNDIKNTQAHALAAALCAATLAQLRLPGHSQ
FT                   AQEPFLVTSGDFVRECIRLRADYDAQSSASLDSLLTSLFLHMYYANIDQIPLATFALRD
FT                   AITHAHLLSLGNVELFKDSQDQQQLRLRIYWILLVTERTFCMQHDLPITLQTIGDLPIP
FT                   VDDGDTDPAFLNGFCNLVRLFTRIDGPLLQAPHLSTCPTYSRDKITDIQASLQTGATRD
FT                   PIIDEVQRVDIWITLAWLSSLLWQYSASHFMLTSDSSNVFFSPSYPFIVARNFLSLVCG
FT                   ASLDSVRPHGYGMEIKLSQLANSLIDVLVYVPSLSKIYDGSNWGPRHAIVELERLLDVV
FT                   AGGRSERLDKLHHRMAQIEFTPAPREALSESDDQESEGPPSDEISEANDLAPHLKTVDH
FT                   WSEDKRGFILQLGKRDGDLSAVFPEFGVEVVSIFPADGDESGRYEGISYDFPADILALG
FT                   AHMPHIPQ"
FT   gene            238221..241162
FT                   /locus_tag="ANIA_07345"
FT                   /old_locus_tag="AN7345.4"
FT                   /product="Alpha/beta-glucosidase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFR7]"
FT   mRNA            join(238221..238437,238482..239104,239157..239472,
FT                   239531..240055,240106..240214,240268..241162)
FT                   /locus_tag="ANIA_07345"
FT                   /old_locus_tag="AN7345.4"
FT                   /note="transcript_id=CADANIAT00000088"
FT   CDS             join(238221..238437,238482..239104,239157..239472,
FT                   239531..240055,240106..240214,240268..241162)
FT                   /locus_tag="ANIA_07345"
FT                   /old_locus_tag="AN7345.4"
FT                   /product="Alpha/beta-glucosidase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFR7]"
FT                   /note="transcript_id=CADANIAT00000088"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000088"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000088"
FT                   /db_xref="GOA:Q5AWI5"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWI5"
FT                   /protein_id="CBF78576.1"
FT                   /translation="MAGTLLSWTPLALALMARALSQLPLTDCPGYRVINVEERPRGLTA
FT                   DLTLAGTPCNVYGVDIENLRLETDYDTNQRLHVKIYDADENVYQVPDSVFPRPVVNDQA
FT                   CADENTPELRFSYAEDPFSFAVSRASNDETLFNTTGHNLIFQSQYVNLRTSLPQNPNLY
FT                   GLGEHSDPLRLNTINYTRTLWNRDAYTIPAGTNLYGAHPMYIDHRGEAGTHGVFLLNSN
FT                   GMDIKIDKNSDNIQFLEYNILGGVLDFYFFAGPSPKDVSVQYAEVAGLPAMVPYWGLGF
FT                   HQCRYGYRDIFEVAAVVHNYSEARIPLETMWTDIDYMDHRKVFTLDRERFPLDTVRALV
FT                   QYLHQRDQHYIVMVDPAVAHSENGAFTRGLEKDVFMRKQDGTLYQGAVWPGATVFPDWF
FT                   HPNTSDYWINEFALFFNAESGVDIDALWIDMNEAANFCDWPCTDPVAYAEENNLPPEPP
FT                   AVRPNPSSLPGFPAEFQPVNSNNNNSSRKRETQVVIAARQGFVKVGNDNGNGRRLGLQG
FT                   RELIDPPYKIANAAGSLSNKTMNTDIFHANGLAEYDTHNLYGTMMSSLSRDAMLYRRPE
FT                   KRPLVITRSTFAGAGSYVGHWLGDNASTWTKYRISIAQMLAFASIFQIPMVGSDACGFT
FT                   GNTTEELCSRWATLAAFNPFFRNHNEYGMVSQEFYRWNSVAEAARKAISIRYSLLDYLY
FT                   TEFHEQTVTGEPFLLPLFFVYPNDPNVVGIDSQFFYGDAILVSPVIEEGKTEVHAYFPG
FT                   DLFYDWYTGLPLRGNGEVITLTDIGYTDIPLHVRGGKIVPVRTGSAGMNTTTEVRKSGF
FT                   RLVIAPGLDGRAAGRLYIDDGESLEQTAMVDVVFTYEDGRVSVDGVFTLQTDLRVEAVT
FT                   VFGDNVVERTIDLPLSGPGGVEL"
FT   gene            complement(241212..242915)
FT                   /locus_tag="ANIA_07344"
FT                   /old_locus_tag="AN7344.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(241212..242915)
FT                   /locus_tag="ANIA_07344"
FT                   /old_locus_tag="AN7344.4"
FT                   /note="transcript_id=CADANIAT00000089"
FT   CDS             complement(241212..242915)
FT                   /locus_tag="ANIA_07344"
FT                   /old_locus_tag="AN7344.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000089"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000089"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000089"
FT                   /db_xref="GOA:Q5AWI6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWI6"
FT                   /protein_id="CBF78577.1"
FT                   /translation="MDTDWNQNRDPERASSAESGSGSSRAIAIDLEQARIATAQEHSLS
FT                   FTEGLRTYRKAVMWSMLFSLAIIMEGYDTTLLQSFFAFPEFVRKYGSPIYTSTSNASSS
FT                   PGPGEEVETHELSAAWQSALTNGAYIGEILGLFITGLVIEKTGYRRLMFASALSLGGFI
FT                   FILVFAPDLPTLLVGEILCGIPWGVFQTVTTAYAADVCPVLLRGYLTTYVNLCWVLGQF
FT                   VATGVLRACLHIGPVQDAGQGDEWSYRIPFMIQWVWLPFILVIVWVGPESPWWLVRKGK
FT                   LSEAKSVLERLSASTLSSSSTPGKALERGQTETTLALMLYTIQMENEYVSQSHESYLSC
FT                   FHSTNRRRTEITCLTWAIQALCGSSFMGYSTYFYQQAGLSVSQSFNMSLGQYAFGIVGT
FT                   LVSWLLMTRFGRRTLYVVGLLLLVIILFSVGFTSLSDTKTASWAIGSLLLLFTFTYDCT
FT                   IGPVCYSIVSEIPSTQLRGKTIVLARNVYNMFMIVNGIIVPRMLNPTAWDWRGLAGFFW
FT                   GGITLVLLCWSYFRLPESKGRTFAEMDILFERRVNARRFRKEEVCFHTNN"
FT   gene            complement(243356..245330)
FT                   /locus_tag="ANIA_07343"
FT                   /old_locus_tag="AN7343.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(243356..243544,243602..244136,
FT                   244216..245330))
FT                   /locus_tag="ANIA_07343"
FT                   /old_locus_tag="AN7343.4"
FT                   /note="transcript_id=CADANIAT00000090"
FT   CDS             complement(join(243356..243544,243602..244136,
FT                   244216..245330))
FT                   /locus_tag="ANIA_07343"
FT                   /old_locus_tag="AN7343.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000090"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000090"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000090"
FT                   /db_xref="GOA:Q5AWI7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWI7"
FT                   /protein_id="CBF78579.1"
FT                   /translation="MQSCDICRKRKVKCDRRTPCARCRRLRQPCTYTDILRKKGPKFVH
FT                   SYPRIYSTALTASGSGSESVSTPSLMGPLTTSVCGSSETLPLPSLMSRNVGTDLGVEAS
FT                   IQIHSSSGIQSSVDSGAGTASEPDEELNLDLDFDFEDVPSGQQLRPPQNSGLDRAFNPD
FT                   VPLGSLGRTAGLETSLEGILSVYIEKLHPLFPVADLREIQDTLRAGGCGQNSNYEKNYG
FT                   FDPTQYALLCSLCAVTYAQLTFSSGRGLSSFPATMDQIQGHEHACLKYLQAALEAQRQS
FT                   DHPQVNHKSRQGQANGGSVKSKARDKILTSFYLFMTYWSLKQMTHAWWYLRECITLLLS
FT                   VRMHQEEEHRKLDMREAETSRVLFWGVFVAERTFCIIHDKPVTLRPWINLPRVPSLLDE
FT                   KEHVTAIPGFVRLVTQFRGLDVDLSGCWTAAGFVTPISRSLSHGTGVTTATTDASRIAA
FT                   GYEYDDTGLETEAWIPLQQLDLAITREWLRAEMWKLGTPGHQQSSSPREFVAALVKEGG
FT                   QWRLEEPLLIGKATLGILQSMEEILQDNWSAIMDEKLYDICECLCDIRPVIQTRQNGVR
FT                   DVEVEINLDQILRGLLDCLARLRGRSAYLLASRLGD"
FT   gene            complement(246932..253021)
FT                   /locus_tag="ANIA_07342"
FT                   /old_locus_tag="AN7342.4"
FT                   /product="TFIIIC transcription initiation factor complex
FT                   subunits Tfc3, putative (AFU_orthologue; AFUA_2G16462)"
FT   mRNA            complement(join(246932..251220,251279..251642,
FT                   251770..252788,252955..253021))
FT                   /locus_tag="ANIA_07342"
FT                   /old_locus_tag="AN7342.4"
FT                   /note="transcript_id=CADANIAT00000091"
FT   CDS             complement(join(246932..251220,251279..251642,
FT                   251770..252788,252955..253021))
FT                   /locus_tag="ANIA_07342"
FT                   /old_locus_tag="AN7342.4"
FT                   /product="TFIIIC transcription initiation factor complex
FT                   subunits Tfc3, putative (AFU_orthologue; AFUA_2G16462)"
FT                   /note="transcript_id=CADANIAT00000091"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000091"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000091"
FT                   /db_xref="GOA:Q5AWI8"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWI8"
FT                   /protein_id="CBF78581.1"
FT                   /translation="MAPSLRDLIDFLLAEIALCGTQDGSGHAPVVDRRFQEKVWQWLTK
FT                   NPEVSVGKGREGNGLSLEQAERRQHAINNAEEKPLNVFVSLERTWLAITGHEPDDTKVL
FT                   PMEFALLSIIASRKSSGISQPDLIKLSGQDKRSVPKRTDVLQQKGYIEKRAIQLKGART
FT                   SLCTLRKFVSQDAGKSAAGTSEDGPNAVKMIDFNSFTDTLFGILREHKIISRNDLKRVL
FT                   GFNDHWHWKVLSRALRKFERIGVVKRVKAMSQYAKTMKKYHPCVMLVREPTAKDIELFH
FT                   DFSIHMYSDIKQNDEAEFEDDAEGEEATGEAPAVGDIRAMEGEQGVEASGRVLPLWSPD
FT                   RVIHNQLFEVVDRAGTMGSTNSLSQPPHLRHLALVRDTALQRTITHYIHYSARNFGKLV
FT                   EAGESSWEAVEFIPRNNRSNTVSIPPVHAEPQLDAYGLPQDVPASDLVKNGDCSLSDCM
FT                   WVVKPKDYNISSSDPKAVELDDGTYAIQYGIKGHSVQSPAGRLATPDTTSLLEVERERA
FT                   SSVDANLASTPVPKRPRKIKRESQNFAGMSELEKLKAMGLDESWTEYSVLLIDRQGPGV
FT                   YITPRGRRKPAGKERGRPPTSRVAVFKSTKLLDLPWFRTDNESLDITRAASQSPEPFTI
FT                   DPRLSATAVRGAPPRSAEETNVVHGTKRSHQHDSGSESGTLSPKARKLRRTGRISNGFR
FT                   SSQELVAEDIFADGQASEAHAHEAQTPSRIQGKRKRTLSPESGHQDVIHVRKRGGQSAK
FT                   LSHDMPTTDGDGPKGPRRKLTTRQASKASKSLLYPQENGEFAANSIKSSPKSSRPVQYS
FT                   QSARSENTLFVSQSAIETPTGQNGTLESPQLQDGAPLATVSGTVAKAPIIASSPVPSRL
FT                   QSATPAAFQTETSASNATPTPETSSRRATRSKLVDKGGSVAFLRRRIVMDLVEKAGGAF
FT                   PMGSELWYPFVTAWMKTKYKEKPDMRTLRNAVKHLVDAGKLRQQTFCGKDSKGVMVTKT
FT                   IICKAELAPDDPVIKEMQEKILASGARHYFPPGVDVDPNLTKQGTGSKLVRGGEIPVEP
FT                   GLTVQLHNKPALVQALEKRKGATIQRRLNRRLEIEQMRESMQEVRPSGVIRLLSRPRPD
FT                   WYIPSSGPGMAPLFTDDPSFGALRKHGGRRHRPSSIQTVDNRQLKRINFSLSLLAPYAM
FT                   LMSPAQSFNPLNGTFSTDAGLATFSLARAPQSRAKQVLMARATLMLMNPYQTFSPNNGT
FT                   FSTNAGLAALFMSRSIQRSSHNRSTRKQEAHLPHSLDDQLMQAGRRNIRIPGETDSRSR
FT                   DFIRDTNAILRWELQNERLLQERSKDVRYINHGIRDSFESAPIEGGIRFHPEEMGFIYE
FT                   EPAVGTRRQTGSSPAFTLEEHSVFPPPPPRDAMRMRHYNPPPPPRPRRLEKLNEMLASG
FT                   NESTSPSASRTQLRRNRLPLPFSRSSYQKLMTAIVAVRALAGGSNGNIVDWPLVSCCFP
FT                   EQDSKVIQDKGKIFLAKNRLQIAKMQYDFQERFVDAYANNEVPQIDYNNLEGYDWNAVI
FT                   EWANANLDVPKSDRTPDLPATREQFDNIFELREEPLGSLDELYQTTTAVTLNRKKQLIS
FT                   NIAFAAPLPYEVGRYCSRRRLELSRFEAVKTCVRANVFTPAEVYRAADARDTLSRIDNS
FT                   LLNNALQSLITERVISQANKGRVVPGRNYDITDYFIQTLSKKRPIEATDVRRASKFKTE
FT                   TLDPALTQQGVFSVAFNAEDGDILALINLFSEGRIKLAPRDPPRDKFGLTEGGYLTRMM
FT                   NKDKLRFPVDVYPVAGRYVTSNPVSEKASTIPPPCPPRIPIITSTDDTGTGAGTVSAPE
FT                   KYPLWLDIHGGFIQVLWDLAVGAIVGTVAVRPGISAKRLASAIKPTMGDWEVLMVLEWL
FT                   TDVGVVRKSSGCAGPGADADEDTDEACWFVREWWGGWS"
FT   gene            255160..257102
FT                   /locus_tag="ANIA_07341"
FT                   /old_locus_tag="AN7341.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(255160..255549,255617..255735,255800..255846,
FT                   255894..255919,255972..256321,256379..257102)
FT                   /locus_tag="ANIA_07341"
FT                   /old_locus_tag="AN7341.4"
FT                   /note="transcript_id=CADANIAT00000092"
FT   CDS             join(255342..255549,255617..255735,255800..255846,
FT                   255894..255919,255972..256321,256379..256633)
FT                   /locus_tag="ANIA_07341"
FT                   /old_locus_tag="AN7341.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000092"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000092"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000092"
FT                   /db_xref="GOA:C8VCL0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCL0"
FT                   /protein_id="CBF78583.1"
FT                   /translation="MDSEANPSTAEAPAAPEGSTSEPPPLPYSLRDRKKSIAFFWFLFV
FT                   LDCTAQPLGLYFGLWYGTNLSHNLVFTIVTISLGGISVFEYFYRLYNLFRSDSTTRPLN
FT                   ARKSWINFTIVWLILAVELITGTVPEEPYVRLVAMVLPTVMFYFGAVYLSLDILRACGF
FT                   RAPFRISSTPKGAVMPTALYVLIEDVVAVDGAGGQMYRYALRTRYLSSPYFRRMLVQMN
FT                   FFWAGGSIIWAAAITAMVFTTPQDAAFVIGWSVPFVWAALWTVITIPWVQSDLRREKEA
FT                   WRTNGAQGGEPYADDINAPSARTRLESLHFPRFFPQRLVREKRSAQSMSETQS"
FT   gene            257826..259600
FT                   /locus_tag="ANIA_07340"
FT                   /old_locus_tag="AN7340.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(257826..257960,258049..258708,258822..258867,
FT                   258958..259020,259103..259214,259291..259600)
FT                   /locus_tag="ANIA_07340"
FT                   /old_locus_tag="AN7340.4"
FT                   /note="transcript_id=CADANIAT00000093"
FT   CDS             join(257826..257960,258049..258708,258822..258867,
FT                   258958..259020,259103..259214,259291..259600)
FT                   /locus_tag="ANIA_07340"
FT                   /old_locus_tag="AN7340.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000093"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000093"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000093"
FT                   /db_xref="GOA:Q5AWJ0"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ0"
FT                   /protein_id="CBF78584.1"
FT                   /translation="MSTPPGPSHTAFTEWAVFNGIKINGIAPARFPGRGLGMIATQAIR
FT                   ENEIMLSVPANLMFTRDSIPESFVSLFPADATNHAILVGFLVHGDSKSQPGLDVWRSVW
FT                   PSWEDFEKSMPIFWPGWLRASSSDMQPPAQDRNENSRNNPDSKSGLKLALLPPSISGLR
FT                   NSMLDPLNTPAPNSQTNSEQSCPYETRYQNLLPRQEKRLYDTYYSIRSVFPETDWKAVA
FT                   YNWAIINSRSFYYVSPGKNEPSDWNDAIGMVPFADYFNHRDDASCEVTFDRDSYIFRAE
FT                   KGEEIYMSYGPHSNDFLLVEYGFYLDDNPSDRVYLDDIILPKLTRSEKKELAERECFGN
FT                   YEITASGADRNSMAAASIKYMSRQKWREYVDGVSEQGFDASRTAGIIRDWIEAYLQECT
FT                   TTIASLVELSKSEKEKDTVELILSRWKQIHRLCERAVESMAA"
FT   gene            complement(259769..260848)
FT                   /locus_tag="ANIA_07339"
FT                   /old_locus_tag="AN7339.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(259769..260848)
FT                   /locus_tag="ANIA_07339"
FT                   /old_locus_tag="AN7339.4"
FT                   /note="transcript_id=CADANIAT00000094"
FT   CDS             complement(259769..260848)
FT                   /locus_tag="ANIA_07339"
FT                   /old_locus_tag="AN7339.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000094"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000094"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000094"
FT                   /db_xref="GOA:Q5AWJ1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ1"
FT                   /protein_id="CBF78585.1"
FT                   /translation="MAPFSIKRAKKDQPQAGQPKKAAPAKPDQPTYKKRAQLTQMFPPR
FT                   PTFTEKDITFQKGRVFLVTGGTSGIGFELAKILYARGGTVYITGRTEEKAKEAVQKIQA
FT                   SVGERDGQIDYIVLKLDDLTSIRESADAFMEKESKLDVLWNNAGIAQPPVGVLSKQGSE
FT                   LQLATNCLGPFLFTQMMLPLLDAAVALNGPAYPGSVRVVWLSDQVVELSSPIEGIVMQE
FT                   LNNPPQDNSRNYLNSKTGAWFLGSEFARRYGPEHGIVSVAMNPGAARTNLLRHAGWTKF
FT                   LSWPLLHSPKLAALTELYAGLSPDINLENNGCYVIPWGRIHTTVAPHLMNALRSKEAGG
FT                   TGRAQQFWDFCDDKTKDYH"
FT   gene            complement(261155..262458)
FT                   /locus_tag="ANIA_07338"
FT                   /old_locus_tag="AN7338.4"
FT                   /product="ubiquitin conjugating enzyme (UbcF), putative
FT                   (AFU_orthologue; AFUA_2G16470)"
FT   mRNA            complement(261155..262458)
FT                   /locus_tag="ANIA_07338"
FT                   /old_locus_tag="AN7338.4"
FT                   /note="transcript_id=CADANIAT00000095"
FT   CDS             complement(261252..262256)
FT                   /locus_tag="ANIA_07338"
FT                   /old_locus_tag="AN7338.4"
FT                   /product="ubiquitin conjugating enzyme (UbcF), putative
FT                   (AFU_orthologue; AFUA_2G16470)"
FT                   /note="transcript_id=CADANIAT00000095"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000095"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000095"
FT                   /db_xref="GOA:Q5AWJ2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ2"
FT                   /protein_id="CBF78587.1"
FT                   /translation="MSRSVRRLMKEAAELSSSPSPHFHAAPVSDSNLYDWHFTLAGPPP
FT                   PSPYAGGIYHGRIVLPPTYPLRPPSFRFLTPSGRFEVNREICLSISGHHEETWQPAWGI
FT                   RTALLAIRSFMEGDANGQVGGLQGVSDEVRRQWAGTSRGWRCDLCAKSNEELLREWRGY
FT                   CVEKGVDVEKEEDAEGVPQGLRIGIGTKGKNDGDNSKVADSAGATKLESGTEKLKSDST
FT                   SMEESTMGTCEKSMSTSTSTSPPVLDNSCSSSSAIPSSPTTFSASVIRDAPAQSPSPAS
FT                   QAVTQRPRPTPTRPASQAVQVASQDSPWLDRAIFGVLVALIIMIFRRFVNIEE"
FT   gene            complement(262666..264265)
FT                   /locus_tag="ANIA_10934"
FT                   /old_locus_tag="AN10934.4"
FT                   /product="DHHC zinc finger membrane protein
FT                   (AFU_orthologue; AFUA_2G16480)"
FT   mRNA            complement(join(262666..263908,263919..264265))
FT                   /locus_tag="ANIA_10934"
FT                   /old_locus_tag="AN10934.4"
FT                   /note="transcript_id=CADANIAT00000096"
FT   CDS             complement(join(262666..263908,263919..264265))
FT                   /locus_tag="ANIA_10934"
FT                   /old_locus_tag="AN10934.4"
FT                   /product="DHHC zinc finger membrane protein
FT                   (AFU_orthologue; AFUA_2G16480)"
FT                   /note="transcript_id=CADANIAT00000096"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000096"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000096"
FT                   /db_xref="GOA:C8VCL4"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8VCL4"
FT                   /protein_id="CBF78589.1"
FT                   /translation="MATLAMSTPSSPTWPKRRPKAWAMRCERYCCAAASYFPLAFVYSL
FT                   TTWAVYVEASVGLKPSSSSWIGMLLQSRNLSTLLTASLCRTTKFDPRRRPLPSPQHFLY
FT                   NGRLHRSRITSSGGGHPYSALPITELPEYTSYTVNSTGGSRFCKKCQCPKPDRAHHCST
FT                   CKRCVLKMDHHCPWLATCVGLRNYKAFLLFLIYTSLFCWVDFGVSAIWIWTEVFNDTRY
FT                   MDGILPVNVVLLSILGGIIGLVLTGFTAWHISLATRGLTTIECLEKTRYVSPLRKALDR
FT                   HRYDGLLGTNTGGENQDTFGSRLQNYGNQILDAHANAIPGVTRPEEGEESSDNLTPAQQ
FT                   ALSRSYADLERQREHDRYEDYLAELDNEKMPHAFDLGWKRNLLHLFGDRPLHWLVPTPT
FT                   TTGNGWEWEPSRKFLEAQERVRQQREQVAEQQRQHQRDLYLRNMNNSRAWLGNELPPGW
FT                   TPDQPLSHSDDVARPATGVSMKTLAPRSPRPRPGEEVYAEDLDKDDFVLEPTRGKGSGN
FT                   QSSREDDWRDWD"
FT   gene            complement(264668..266548)
FT                   /locus_tag="ANIA_10929"
FT                   /old_locus_tag="AN10929.4"
FT                   /product="rhomboid family membrane protein (AFU_orthologue;
FT                   AFUA_2G16490)"
FT   mRNA            complement(join(264668..264979,265034..266022,
FT                   266071..266548))
FT                   /locus_tag="ANIA_10929"
FT                   /old_locus_tag="AN10929.4"
FT                   /note="transcript_id=CADANIAT00000097"
FT   CDS             complement(join(264935..264979,265034..266022,
FT                   266071..266548))
FT                   /locus_tag="ANIA_10929"
FT                   /old_locus_tag="AN10929.4"
FT                   /product="rhomboid family membrane protein (AFU_orthologue;
FT                   AFUA_2G16490)"
FT                   /note="transcript_id=CADANIAT00000097"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000097"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000097"
FT                   /db_xref="GOA:C8VCL5"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8VCL5"
FT                   /protein_id="CBF78591.1"
FT                   /translation="MAAQSYYNGAYNSPPAYEQHDHTSDQFNRVSPRPSPSPVAYNNAP
FT                   YYQSDDPHDPNSLRYSQQSIGSDNGAYVAGGRINEHDQYAENIPLKSANPYGNDHPPQP
FT                   WMQQPTHYAPDPGMMEPQVPMRQKKKGFFQKKIAYVTYILTIAQIIVFIVELVKMGQLT
FT                   GSPIQTKPQFNPMVGPSAYVQINMGARYTPCMKNVPGVQNATQQVLFPCPNATTTDSDC
FT                   SLSELCGFDGVPNPHPGGSLDDKPAPDQWFRFIIPMFLHSGFVHIGFNLLVQMTMGADM
FT                   ERMIGWWRYGLVYLSSGIWGFVLGGNYAGQGEASCGCSGALFGILALFVLDLLYGWNDR
FT                   QNPWVELIIMVLGIAVSFVLGLLPGLDNFSHLGGFTMGLALGLCVMRSPNALRERIGLA
FT                   RSPYVAMSGGVAAENADPDQNKTSTGSNIGGLGKFNPKGFFAGRKPLWWAWWLVRLGAL
FT                   VAVLIGFILLIVNFYKYPSSNCSWCYRFSCLPVNGWCDQGNLFSR"
FT   gene            complement(267853..268302)
FT                   /locus_tag="ANIA_07336"
FT                   /old_locus_tag="AN7336.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(267853..268302)
FT                   /locus_tag="ANIA_07336"
FT                   /old_locus_tag="AN7336.4"
FT                   /note="transcript_id=CADANIAT00000098"
FT   CDS             complement(267853..268302)
FT                   /locus_tag="ANIA_07336"
FT                   /old_locus_tag="AN7336.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000098"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000098"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000098"
FT                   /db_xref="GOA:Q5AWJ4"
FT                   /db_xref="InterPro:IPR024512"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ4"
FT                   /protein_id="CBF78593.1"
FT                   /translation="MQSFYTPSTTTHISSHGPAAVDELINKYSSTMATTSPSPGIHTFD
FT                   RAQRNILQRIADRIRLGYYRYEVTYGLYVMTPGEKIVANTFVVVFLGLLIWAMFFYFPG
FT                   LLFQKFSRLVWLLTGQSGEEMGAALGILDTQPSISQFASQKAALS"
FT   gene            270161..272302
FT                   /locus_tag="ANIA_07335"
FT                   /old_locus_tag="AN7335.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(270161..271107,271156..272302)
FT                   /locus_tag="ANIA_07335"
FT                   /old_locus_tag="AN7335.4"
FT                   /note="transcript_id=CADANIAT00000099"
FT   CDS             join(270172..271107,271156..272253)
FT                   /locus_tag="ANIA_07335"
FT                   /old_locus_tag="AN7335.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000099"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000099"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000099"
FT                   /db_xref="GOA:C8VCL7"
FT                   /db_xref="InterPro:IPR013877"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCL7"
FT                   /protein_id="CBF78594.1"
FT                   /translation="MSSVNQSISMAEEDPLIKALPPATDYLTYLTLLEYQLTPARLPTL
FT                   HKLLQDEVLTTNIGWDLVKILLPMLPESQECLKDVARLGNPREVILRVSDALMQLHPAD
FT                   EDEEESDKQLESHHGDVGQGSSGIKAPAGKIPLHVLKFNTLVAMLSTLHSRIQTKSPSR
FT                   FLATSLQAVLEAYTSMPTNETTIALLEFFRDVSPTKRPPPPPRAPSDSTVLRVAEASAP
FT                   DPEAEVMSPSPAGNEESALIRRFLQFGLIELLKSYLLSCSGPMDPGMSWAVRLQEKLHP
FT                   ESRMPGTGSPTNVYVDNRQLGERDSIIAKITALSQDFGLTDEELLKVVTRDPETQPPPL
FT                   DFEEHPKSAEDIPLERHGSLLLLAAQAAVGKLFSGKALQIKVYPDLARIFDNYVGKFRS
FT                   LDEVAFEQPHVLLDSLLALTVLSLQRPIPAPSDESEFTNFVTLLTACTVRQTYSTVRRI
FT                   PAEIINANPSQLARFKVIRKVLEDERYRTIKDRAIDWLKNEILKAAKEAPGPEPNIFLN
FT                   PHYFSVLFPLLFASPALDLDLSSDLVTSWVRFTQTLSPSIHSALNLYYILISSAELRRQ
FT                   LQLEKTYAYFRSRFLEPVKAICGAFSADLTQNGGDGKIAGSVGEDMVKVGTARSVNLIQ
FT                   HIVEQVEDAVNEAFVVGDAELKDPSADDIARVDAIRKETAVE"
FT   gene            complement(273433..273658)
FT                   /locus_tag="ANIA_11554"
FT                   /old_locus_tag="AN11554.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(273433..273464,273595..273658))
FT                   /locus_tag="ANIA_11554"
FT                   /old_locus_tag="AN11554.4"
FT                   /note="transcript_id=CADANIAT00000100"
FT   CDS             complement(join(273433..273464,273595..273658))
FT                   /locus_tag="ANIA_11554"
FT                   /old_locus_tag="AN11554.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000100"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000100"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000100"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCL8"
FT                   /protein_id="CBF78595.1"
FT                   /translation="MQTPSDQPTHIFPLEFAPVSIASPGTGCVVM"
FT   gene            complement(274455..278774)
FT                   /locus_tag="ANIA_07334"
FT                   /old_locus_tag="AN7334.4"
FT                   /product="phospholipase D (PLD), putative (AFU_orthologue;
FT                   AFUA_2G16520)"
FT   mRNA            complement(join(274455..275182,275220..277216,
FT                   277270..277413,277461..277806,277859..278079,
FT                   278323..278446,278616..278774))
FT                   /locus_tag="ANIA_07334"
FT                   /old_locus_tag="AN7334.4"
FT                   /note="transcript_id=CADANIAT00000101"
FT   CDS             complement(join(274514..275182,275220..277216,
FT                   277270..277413,277461..277806,277859..278079,
FT                   278323..278446,278616..278774))
FT                   /locus_tag="ANIA_07334"
FT                   /old_locus_tag="AN7334.4"
FT                   /product="phospholipase D (PLD), putative (AFU_orthologue;
FT                   AFUA_2G16520)"
FT                   /note="transcript_id=CADANIAT00000101"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000101"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000101"
FT                   /db_xref="GOA:Q5AWJ6"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ6"
FT                   /protein_id="CBF78597.1"
FT                   /translation="MSSDGTMVRLTTSGRMGIRAGRQLNYVNRFHAYLSRIIIEQPRGL
FT                   DNDAGLSTMHYAAIGRMSVMQETADACVRGCPSNGSIDGDSKQRSRAVVAMSYNQDHLA
FT                   YGQYHNQASEGAGEGESARSLVGDTFNMLKSKYKTHHSSQQGQAPGNQNQPPSQSYNPG
FT                   TGGYGGGQSYPSYNRPGSRPSDSNQISSKPPKDKTSGLFGKLQDVVADLGGEVAQRLGT
FT                   AIDPQGYAQYGKPQPQTQHRFGSFAPERHGNDVQWYVDGCSYFYAVSKALESARESVWI
FT                   LDWWLSPELYLRRPPAKNEQYRLDRLLQAAAQRGVKVNIIVYKEVTQALTLSSAHTKHH
FT                   LEALHPNIAVFRHPDHLPDGQGLAASITSSLQNLSLDALKLGQMSVDAMKGVYGIHEGV
FT                   ILYWAHHEKLCIVDGTVAFMGGLDMCYGRWDTHQHALADVHDNPADIVFPGQDYNNARV
FT                   LDFSDVAHPDQNKLDRTQTSRMGWSDVAVSFHGPAVEDIRRMFVERWNFLYDIKYKSRN
FT                   DSRFSRLALYGQPGSSSGHPQAQQGSHQQGPHQHGQQQPSQQNSPSVHPGNTQQTYQPA
FT                   QHQPGHQHYPDTSQTTPQSQPSWSQQQPTYQPYHPGQSYSPSQGASELPPTSPQPNWNQ
FT                   QQPSYQSSQQQSHHGTPQSPYTGQSFPPPPPGPPPSQGSGQAHTPYFPPPPTQATQENQ
FT                   HSSHRGLMDDYSEDRGDRERASGGRPAGSASNFVPRRFRENFDSLRGELAGQIHQYQDR
FT                   ITSNALGRPQQRGNMSCQIVRSCGKWSNGTPTEHSIQDAYAEIIRHSEHFVYIENQFFI
FT                   TATGDKQKPVENKIGAAIVERILRAARAGQKYKIIVVIPSVPCFAGDLGDEAALGTRAI
FT                   MEFQYNSINRGGNSIMELIAKEGYNPMEYIRFYNLRNYDRLKYTVPKAAPQSGGFGPEH
FT                   RPAFDTSAAYQSYSSSHAGPKSGSGQWDTVSSCYMLNGPDLRSIPWDGPTEAEIDAFVT
FT                   EELYVHSKLTKQVMIADDRIVICGSANINDRSQVGDHDSEIAVIIEDRTPVPSKMNGQQ
FT                   WTASRFASSLRRHLFRKHLGLLPPQDYEHVNDHFDFDSPESQVVADPLADTLLSLWNTR
FT                   AHKNTEVYREVFHSVPDDTVRNWNTYKEFYGYYFKNADKQAFGEKIDGPPPTYKYGHVV
FT                   AEKFPGPDGVKRVKELLSQVKGTLVEMPLMFLCEEDVAESGLTLNDLTEPLYT"
FT   gap             280308..280407
FT                   /estimated_length=unknown
FT   misc_feature    280408..419334
FT                   /note="contig 1.127 1..138927(-1)"
FT   gene            complement(280988..282009)
FT                   /locus_tag="ANIA_07333"
FT                   /old_locus_tag="AN7333.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(280988..280990,281334..281361,
FT                   281442..281612,281771..281804,281846..281898,
FT                   281999..282009))
FT                   /locus_tag="ANIA_07333"
FT                   /old_locus_tag="AN7333.4"
FT                   /note="transcript_id=CADANIAT00000102"
FT   CDS             complement(join(280988..280990,281334..281361,
FT                   281442..281612,281771..281804,281846..281898,
FT                   281999..282009))
FT                   /locus_tag="ANIA_07333"
FT                   /old_locus_tag="AN7333.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000102"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000102"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000102"
FT                   /db_xref="GOA:Q5AWJ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ7"
FT                   /protein_id="CBF78599.1"
FT                   /translation="MSYCSGERTGDLDRRKKALSCRFGDRLSGVKGYNLYYAIETIPGA
FT                   STAEVVGDVPANVKNTVMRRFIIGPVAERADWNKERAAMDRDRHISSRVQMDHT"
FT   gene            complement(283507..285947)
FT                   /locus_tag="ANIA_07332"
FT                   /old_locus_tag="AN7332.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(283507..283584,283649..285276,
FT                   285416..285947))
FT                   /locus_tag="ANIA_07332"
FT                   /old_locus_tag="AN7332.4"
FT                   /note="transcript_id=CADANIAT00000103"
FT   CDS             complement(join(283507..283584,283649..285276,
FT                   285416..285947))
FT                   /locus_tag="ANIA_07332"
FT                   /old_locus_tag="AN7332.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000103"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000103"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000103"
FT                   /db_xref="GOA:Q5AWJ8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWJ8"
FT                   /protein_id="CBF78601.1"
FT                   /translation="MASEDGPRKRRRPAQSCEQCRQRKVRCDRNIPCGPCTRARSVLHC
FT                   SYRDKSPSPSSAGVESIITPRSAQRPVTEAFNQRTSDRPTPIDLGDTNLQSQVDLPLIR
FT                   HRLQSLGDRLTALEKGSHLPRDDRRLEQALHDLTERTRNIEQQLSATPRQTRRTNDNGD
FT                   ITVNDIPRRLNVTAASFRELKADLTNMVKECRALRKSIKSHRAVALDDPVPDLHNTIPS
FT                   QPVCDELVQCYLRTFEPIYRVLHVPSFWESYRAFWTEPQSSPMSFLMKLVLILAIGTVF
FT                   YPDSTSGIDNRFTHLKAKWVYSAQWWLTGPSEETTASLDGLQVYCLLLTAHKVCRMGKS
FT                   SVLSTNSLIDMAMRLGLHIDPAKFPNLSVFECEMRVRLWATIREMALQSALESGLPCLF
FT                   AAGFDPRPPLNLDDRDIGPNIDQVPPTKPHTQWTDMSFLSLLQDSVKLRMEVVHFIASP
FT                   GEKSYQQALRLTTDMRQACRKLADFTQSCKKSPSGLGLRPTEFHKRFLDMDFRRYILAL
FT                   HVPFIVQARKDPRFFYSRKASLESAMVIASYADSLNLPAIPADDFSKMILAGTGSFKGP
FT                   LGLDIISVLGLEIVTQLEDESSEQSLLGPGEEIAKATRAPIVRILEHILTQLLQIISLG
FT                   SPNMKSYNFLAAILAQIRAMESNQCIKRVVYETVKQGLHECYALLRSTMASIPGNAMAG
FT                   EPASTAVEATLGLPDPNLTQFALQPVDPAFDLDLASLLCFDSIGVPSNPYL"
FT   gene            287021..287564
FT                   /locus_tag="ANIA_07331"
FT                   /old_locus_tag="AN7331.4"
FT                   /product="cyanate hydratase, putative (AFU_orthologue;
FT                   AFUA_2G16530)"
FT   mRNA            join(287021..287068,287171..287564)
FT                   /locus_tag="ANIA_07331"
FT                   /old_locus_tag="AN7331.4"
FT                   /note="transcript_id=CADANIAT00000104"
FT   CDS             join(287021..287068,287171..287551)
FT                   /locus_tag="ANIA_07331"
FT                   /old_locus_tag="AN7331.4"
FT                   /product="cyanate hydratase, putative (AFU_orthologue;
FT                   AFUA_2G16530)"
FT                   /note="transcript_id=CADANIAT00000104"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000104"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000104"
FT                   /db_xref="GOA:C8VCM2"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8VCM2"
FT                   /protein_id="CBF78603.1"
FT                   /translation="MSLATLDVQNPIPSLAIAQHIGRNEVATAAIFYGQAKASPEDIEK
FT                   LSSLLDIDHETLKAQLSGFPDRGRSVEMPPKEPLIYRLYEIVQNYGYAYKAVLNEKFGD
FT                   GIMSAISFSTKVEKETDEQGNNWAVITLRGKWLPFSRF"
FT   gene            287947..289516
FT                   /locus_tag="ANIA_07330"
FT                   /old_locus_tag="AN7330.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G16540)"
FT   mRNA            join(287947..288252,288576..288759,288815..289100,
FT                   289153..289323,289402..289516)
FT                   /locus_tag="ANIA_07330"
FT                   /old_locus_tag="AN7330.4"
FT                   /note="transcript_id=CADANIAT00000105"
FT   CDS             join(287947..288252,288576..288759,288815..289100,
FT                   289153..289323,289402..289516)
FT                   /locus_tag="ANIA_07330"
FT                   /old_locus_tag="AN7330.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G16540)"
FT                   /note="transcript_id=CADANIAT00000105"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000105"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000105"
FT                   /db_xref="GOA:Q5AWK0"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK0"
FT                   /protein_id="CBF78605.1"
FT                   /translation="MPACPNPQPKTAASPRNKIKTKAPPRVKCTYLSCNFRFQTDKDMK
FT                   KHKTASSEHEYCNKCDIEFEMEEHLLLHKIKSNKHIVCPICGIDFDSEGGRDRHIRQLP
FT                   MARSDLNREAIPNQPDRITANTNGLVDRHWPRLTETGLENRMSDLMDVSTPTGNGKENE
FT                   KLPASKASASVSAAGAGAESKFKSGTLAASALGSPLFVGISNAGVELARIYKDWNPGNF
FT                   IDVFTGEYVCACGKRCLTKEAFETHVLAESQGARRMQCPNCLKIFKSTAAIITHWESPS
FT                   LKCDQSEADMYAQIVDEVSGGLIHIAGYNEDGTISGLTRESSGLTHSSSGSWCSAESTY
FT                   RSQAQPALRAMES"
FT   gene            complement(289513..290607)
FT                   /locus_tag="ANIA_07329"
FT                   /old_locus_tag="AN7329.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(289513..289793,289858..289922,
FT                   289978..290292,290449..290607))
FT                   /locus_tag="ANIA_07329"
FT                   /old_locus_tag="AN7329.4"
FT                   /note="transcript_id=CADANIAT00000106"
FT   CDS             complement(join(289748..289793,289858..289922,
FT                   289978..290292,290449..290517))
FT                   /locus_tag="ANIA_07329"
FT                   /old_locus_tag="AN7329.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000106"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000106"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000106"
FT                   /db_xref="GOA:C8VCM4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCM4"
FT                   /protein_id="CBF78606.1"
FT                   /translation="MSCGSIGSSMCLQRIFDPVNPARLYRPYKKAIPLSLSLVAARYYS
FT                   SCDIVLPYIIEHTTPAHVSQFSKTPTRLHPSRKMVFSLFKSSKQESSAQNADPKFDPNT
FT                   LTMIQPGSPNAPTMNANGVVTEQPARQDEMSMHLRGGGGGGFCCGLCAGLACFECCEIC
FT                   C"
FT   gene            complement(291822..292581)
FT                   /locus_tag="ANIA_07328"
FT                   /old_locus_tag="AN7328.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(291822..291844,291948..292581))
FT                   /locus_tag="ANIA_07328"
FT                   /old_locus_tag="AN7328.4"
FT                   /note="transcript_id=CADANIAT00000107"
FT   CDS             complement(join(291822..291844,291948..292581))
FT                   /locus_tag="ANIA_07328"
FT                   /old_locus_tag="AN7328.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000107"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000107"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000107"
FT                   /db_xref="GOA:Q5AWK2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK2"
FT                   /protein_id="CBF78608.1"
FT                   /translation="MPDQEPAVQTPSQPAPTPQTQAELQLQHTTATIPNRDADFARFKN
FT                   YAAYTFLFGAPILIALPPRKLDHLTVLLTGAFAASANHITRERTGRSILDRLESRISRT
FT                   SLHNPSLPSEKAREIQARIRAEREKRMGQEGVPKEEMEMLKARRDQDRGMLQTLWMGDE
FT                   EKGWKEKRIQEEREALAAGKGYGDLIREHIWDVWTWGGKDGVQNDKDQRVGVAVG"
FT   gene            complement(294301..295078)
FT                   /locus_tag="ANIA_07327"
FT                   /old_locus_tag="AN7327.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(294301..295078)
FT                   /locus_tag="ANIA_07327"
FT                   /old_locus_tag="AN7327.4"
FT                   /note="transcript_id=CADANIAT00000108"
FT   CDS             complement(294421..294957)
FT                   /locus_tag="ANIA_07327"
FT                   /old_locus_tag="AN7327.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000108"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000108"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000108"
FT                   /db_xref="GOA:Q5AWK3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK3"
FT                   /protein_id="CBF78610.1"
FT                   /translation="MRLTSIPIALLLSPLALATPNLVAESNNSILKRSPSPMRPLVARQ
FT                   SSAYILARSPQDDDGVVCDSDEKRCGNACVNEDYNCCPDNANGGCPSDEECQRDNGVWG
FT                   CCPEGEDCRWDDDDDDDDRNIFDRIGDGIDDIGDEIEDGWNDIVNDDDDDAAGMLKPGV
FT                   GVALMAAVVAAVLPA"
FT   gene            complement(296726..298858)
FT                   /locus_tag="ANIA_07326"
FT                   /old_locus_tag="AN7326.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(296726..296971,297016..297514,
FT                   297619..297655,297853..298287,298353..298359,
FT                   298430..298591,298744..298858))
FT                   /locus_tag="ANIA_07326"
FT                   /old_locus_tag="AN7326.4"
FT                   /note="transcript_id=CADANIAT00000109"
FT   CDS             complement(join(296726..296971,297016..297514,
FT                   297619..297655,297853..298287,298353..298359,
FT                   298430..298591,298744..298857))
FT                   /locus_tag="ANIA_07326"
FT                   /old_locus_tag="AN7326.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000109"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000109"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000109"
FT                   /db_xref="GOA:Q5AWK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK4"
FT                   /protein_id="CBF78612.1"
FT                   /translation="MSPNPYNPPLNPTVDGVDDERESNDNTRGTDFRLSWPQICTQHDS
FT                   VLSSHLNMLRSLKGQVSSDPDAYRLISSMIDRTQKLVMQFEGVKRHIVPRTTRSSGSGS
FT                   GSSSGPRPSSDSRSRVDEATVRKRKKRNRISNEIDPVREPQLPVLEVQPAKRKRVDMAM
FT                   PGADQDVRDVMPVSLETEDISDEVQRRLKIKEEQRRKRDAKPEKRKRDRDSLASNVSTS
FT                   SLASSKPRKRYKLNEQVAMEYSPVLSRSAPFNKEDLLLPLLSYSPPNTSNPPTSLPSAM
FT                   AYHNIFRRFYHKDRTPSTSGTAYHSCAQGQGNQSRPVFLNTRNPSASGTASHPHAQGQG
FT                   TQPCLNSTDNHNHPPSDRSANRHQGASNQFLPYASNPNGIRSSPHPTTVVHPCVKYQEP
FT                   RKGVSPRAGPIPVKRLTDLDNDTTMTGMPFPYTRDQWRKIQRIKQCREQEEQRRFQEEQ
FT                   NQNIDLDTVMTDAPSLHQPPTRNSRHVVPCRARKVQFDVNA"
FT   gene            complement(299146..302543)
FT                   /locus_tag="ANIA_07325"
FT                   /old_locus_tag="AN7325.4"
FT                   /product="catalytic subunit of DNA polymerase delta
FT                   (Eurofung)"
FT   mRNA            complement(join(299146..299516,299681..299880,
FT                   299927..302103,302157..302543))
FT                   /locus_tag="ANIA_07325"
FT                   /old_locus_tag="AN7325.4"
FT                   /note="transcript_id=CADANIAT00000110"
FT   CDS             complement(join(299146..299516,299681..299880,
FT                   299927..302103,302157..302543))
FT                   /locus_tag="ANIA_07325"
FT                   /old_locus_tag="AN7325.4"
FT                   /product="catalytic subunit of DNA polymerase delta
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000110"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000110"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000110"
FT                   /db_xref="GOA:Q5AWK5"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR025687"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK5"
FT                   /protein_id="CBF78614.1"
FT                   /translation="MTEAIVMPQKRVLGDASNNPRGVVNSPDTIKKRKIDMQNTVKPSP
FT                   RAPNGQRKVGSSQQKSQFEEEVLEKLTQDISGLKENNSEKDQQWERPPLGEFDPTKDNI
FT                   CFQQIDAEEGTTMGKPAIRLFGVTEAGQSVLLHVTGFQHYLYIAAPVGFTKEDCDPYRA
FT                   FLESKIGQFPPVIQSVQITMRENIYGFQGNKKSYYLKITVTEPRHISKLRSALETKAQT
FT                   VNYKGLWTNADGGILTFDNIQYLLRFMIDTDIQGMSWVEAPAGKYELIAPQDKVSNCQL
FT                   EARIDYRSLISHAPVGDWAKMAPLRILSFDIECAGRKGIFPEPNHDPVIQIANVVTRYG
FT                   ESKPFIRNVFVMNTCSLIVNTQILEFQQEEKMLMAWRDFIQKVDPDVIIGYNIANFDFP
FT                   YLLDRAKHLKCTNFPYWTRLNGMRSEAKDTNFSSKQMGNRDTKATNTNGRLQLDLLQLV
FT                   QRDHNLRSYTLNSVSYEFLGEQKEDVHHTMITELYNGTPDSRRRLAVYCLKDAYLPQRL
FT                   MDKLMCLVNYTEMARVTGVPFNFLLSRGQQVKFLSQLYRKALQQQLVIPNMKSTDEQDY
FT                   EGATVIEPIRDYYDVPIATLDFASLYPSIIQAHNLCYTTLLNKNSVAGMKKDEDYIVTP
FT                   NGDMFCTPKVRKGLLSQILEELLSARKKAKKELAQETDPFKKAVLNGRQLALKVSANSV
FT                   YGLTGATVGKLPCLAIASSTTSYGRQMIEKTKQEVEARYTIANGYSHDAKVIYGDTDSV
FT                   MVKFGVTELEEAMKLGQEASEYVSSKFIKPIKLEFEKVYFPYLLINKKRYAGLYWTNPK
FT                   KYDKMDTKGIETVRRDNCLLVQNVIETVLHKILIDRDVEAAQEYVKDTISDLLQNKIDM
FT                   SKLVITKALTKDSYTAKQAHVELAERMRKRDAGSAPTLGDRVAYVIVKGTAHEVHRHSA
FT                   PTMGGLMKFTKKTQTCLGCKKPLTGKDVMAGAVCESCRPRLGELYTKSMNKMSDLEVRF
FT                   GRLWTQCQRCQGSLHCEVICSSRDCPIFYMRMKAKKDVEDAQKELARFDFDAGAW"
FT   gene            complement(302974..304190)
FT                   /locus_tag="ANIA_07324"
FT                   /old_locus_tag="AN7324.4"
FT                   /product="N,N-dimethylglycine oxidase (AFU_orthologue;
FT                   AFUA_2G16610)"
FT   mRNA            complement(302974..304190)
FT                   /locus_tag="ANIA_07324"
FT                   /old_locus_tag="AN7324.4"
FT                   /note="transcript_id=CADANIAT00000111"
FT   CDS             complement(303009..304190)
FT                   /locus_tag="ANIA_07324"
FT                   /old_locus_tag="AN7324.4"
FT                   /product="N,N-dimethylglycine oxidase (AFU_orthologue;
FT                   AFUA_2G16610)"
FT                   /note="transcript_id=CADANIAT00000111"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000111"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000111"
FT                   /db_xref="GOA:Q5AWK6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK6"
FT                   /protein_id="CBF78616.1"
FT                   /translation="MATQHTYDVVIVGGGIVGSALAYFLSLSNDGKKVAVIERDLSRLN
FT                   GSTGYAPGFVGQFNESEVLTRLAIDSVGEYLKVPGGFDQVGGLEVATSTAGVEKLRWRL
FT                   ETARERGLKAELISAQRAAEMAHDLVKGDNVSALYFPADGTANPAAITGYFQSEARARG
FT                   VEFVEGDVSEVCRGSGRVKGVMTFSGFIPAERVVLATGIWARNLCDFEVPIPVISVAHP
FT                   YMYGKYREPKPYKSPFVRYPEHHVYVRDHGPFFGLGSYDHKPIAEKPNETAVGNWVEEF
FT                   DTTLHRALRFIPEKTNLAPREKFNGLFSMTPDNMPLVGEIPGTEGLYIAAAVWVTHAAG
FT                   SAKFLTQMIKGETLDAVVRKALDPSRFRGCDMERLERESLHCYNNIYSTHEAI"
FT   gene            complement(304883..305622)
FT                   /locus_tag="ANIA_07323"
FT                   /old_locus_tag="AN7323.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(304883..305002,305058..305434,
FT                   305490..305622))
FT                   /locus_tag="ANIA_07323"
FT                   /old_locus_tag="AN7323.4"
FT                   /note="transcript_id=CADANIAT00000112"
FT   CDS             complement(join(304883..305002,305058..305434,
FT                   305490..305622))
FT                   /locus_tag="ANIA_07323"
FT                   /old_locus_tag="AN7323.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000112"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000112"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000112"
FT                   /db_xref="GOA:Q5AWK7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK7"
FT                   /protein_id="CBF78618.1"
FT                   /translation="MRAFSVVSVACIVASVAAFQYPDFVPLSKRQAPGTPEYECHANCG
FT                   GIITASRSDGYCDSSNFKSMLSDCLDCALVYDIWKYYGNSVSSAAENCGLDATPVETTP
FT                   SSASTATETTTSNETESETASTSTVAGSSSEGASSTEITADSTTVKSTSVIPTATTPVT
FT                   HTSPSSATSTTPTPSDPEFTGAATFNTPGWLLMGGLAGAFAAVLVQ"
FT   gene            306382..307374
FT                   /locus_tag="ANIA_07322"
FT                   /old_locus_tag="AN7322.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_6G02800)"
FT   mRNA            join(306382..306577,306633..306704,306773..307374)
FT                   /locus_tag="ANIA_07322"
FT                   /old_locus_tag="AN7322.4"
FT                   /note="transcript_id=CADANIAT00000113"
FT   CDS             join(306382..306577,306633..306704,306773..307374)
FT                   /locus_tag="ANIA_07322"
FT                   /old_locus_tag="AN7322.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_6G02800)"
FT                   /note="transcript_id=CADANIAT00000113"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000113"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000113"
FT                   /db_xref="GOA:Q5AWK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK8"
FT                   /protein_id="CBF78620.1"
FT                   /translation="MRRHIALFVGLSTVARSQTHGEEAAKEMGPAAFLWPPDRTWSAAY
FT                   DNNSPCGSASGVANRTQFPLVNGQLALVIQDESWNVQIAISDRNNPTSNSDFETIVSEA
FT                   RISDVDPGHMCYPVPNPGVDTEEGMNATFQIKYTSDFDTDKNETYYACADITYVPASKF
FT                   TYQVPCFNVTVDEFTPTNGTESNSTSSDNDTTDSNGASASGSDGNTSSSRGSSGLSGGA
FT                   IAGIVVGCVAAAVIAAVLLFGYRRLLQKYRSLRQKTSVRNVDWEAAEAGKPAADGSSGS
FT                   SYGLRKLK"
FT   gene            308983..311481
FT                   /locus_tag="ANIA_07321"
FT                   /old_locus_tag="AN7321.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_2G16620)"
FT   mRNA            308983..311481
FT                   /locus_tag="ANIA_07321"
FT                   /old_locus_tag="AN7321.4"
FT                   /note="transcript_id=CADANIAT00000114"
FT   CDS             308986..311256
FT                   /locus_tag="ANIA_07321"
FT                   /old_locus_tag="AN7321.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_2G16620)"
FT                   /note="transcript_id=CADANIAT00000114"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000114"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000114"
FT                   /db_xref="GOA:Q5AWK9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWK9"
FT                   /protein_id="CBF78621.1"
FT                   /translation="MSMFRSAADISSDSASSSDESDHEVTKSESKPDIRPPVRDAKHKS
FT                   RSVDEDTMDDSDIKDLLAADAESHSNVMTSALLEFYCLTRAADLLNRQHGSHKRYTRES
FT                   PEVQYLGKKMFLYKSKFLSSHGVLAEGVDADQWGPTRQYYRDNLDALGLSALEGLDIGD
FT                   KKPPLVEGGGDLVLASKTRDMHSRKETAASLRIEGPVGPLDLQQRHGADRIPALEELRL
FT                   DPRRIPRPLPLLGSSPTSFPLFDLNPKPSNSSTSRYAVEFSEIRVVGRGSFGEVYHVKN
FT                   HIDGQDYAIKKIPLSQKRLQQLQCGNENQLENIMKEIRTLARLEHANVVRYYGAWIEQT
FT                   HYPRIQIPSQEPGKLVYENTQNSKPYQPSGDESFGVVFEYSYEGQQQSLEDYSIGSHGT
FT                   STATHTSEKPVARSLEDDVESIPRNFSEPTYSQLSTFGASDGDIFTDGFSNDHSRLQVQ
FT                   RSSRPGHALPAVILHIQMSLHPIPLSSYLSQQHSGDPQTLLRRHCYHLIPSLKLILNII
FT                   SGVDYLHSKGIIHRDLKPANIFLSCAEERDFKGCISCLSKAGTCSKFCHPRIGDFGLVA
FT                   DISHLNDRSPESESGPSNIPKLNRVVGTEFYCPPFFRGYGISEAEDEVVPGRSNEEYFD
FT                   YTIDESLDVYALGVILFELVYRISTKMERQMVLTGLTRGVQRTDAIKSIRERPVFPVDF
FT                   DSKVDQGGMVLPTGETVAESLKKCIKGMLELQPSRRWSCSDVQEHLQRLLNIVLKSMTT
FT                   STF"
FT   gene            311671..313875
FT                   /locus_tag="ANIA_07320"
FT                   /old_locus_tag="AN7320.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(311671..311708,312002..312579,312652..312879,
FT                   313125..313619,313784..313875)
FT                   /locus_tag="ANIA_07320"
FT                   /old_locus_tag="AN7320.4"
FT                   /note="transcript_id=CADANIAT00000115"
FT   CDS             join(311671..311708,312002..312579,312652..312879,
FT                   313125..313619,313784..313875)
FT                   /locus_tag="ANIA_07320"
FT                   /old_locus_tag="AN7320.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000115"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000115"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000115"
FT                   /db_xref="GOA:Q5AWL0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL0"
FT                   /protein_id="CBF78623.1"
FT                   /translation="MNPLAGGEEIVVSFHAFIPTSTLHHQPTTIRTLDCKMGDKKLSPL
FT                   THFPTTPYSEPLLPQLAIPNPYYTSTHHALRAWVRNYVDTHIAPYAQEWEEAGEIPPHV
FT                   YKTHCEHGFAIVHPLTTPEDSANLTLPGGVKREEWDTWCGLIVADELNRLGFVGVIWGL
FT                   GGGNSIGCPPIARFGTAEQRRRWLPKVAKGEIRFCLGITEPDAGSDVANIRTTAVRQGE
FT                   YYVVNGSKKWITNGIWADYCTAAVRTGGPGRGGISLLVIPLKAEGVTRRRMHNSGVNAS
FT                   DFNPERLSLACASLRLARVCAEDAFNYATQRSTFGAPLITRQAIQAKIFKFGLLIEPAY
FT                   AFMEQLVNILEKTKNEPRDDVRIGGMTALLKVMSTRALEKSVREAQQILGGAGYNRAGK
FT                   GARIEQISRDARVHVVGGGSEEIMMGLALQEEMKALTTRKRALERKKNLVGDIPVRRWF
FT                   GALQIHMTGTGRPFHVKL"
FT   gene            314262..315919
FT                   /locus_tag="ANIA_07319"
FT                   /old_locus_tag="AN7319.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(314262..314391,314612..314971,315042..315156,
FT                   315311..315479,315851..315859,315893..315919)
FT                   /locus_tag="ANIA_07319"
FT                   /old_locus_tag="AN7319.4"
FT                   /note="transcript_id=CADANIAT00000116"
FT   CDS             join(314262..314391,314612..314971,315042..315156,
FT                   315311..315479,315851..315859,315893..315919)
FT                   /locus_tag="ANIA_07319"
FT                   /old_locus_tag="AN7319.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000116"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000116"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000116"
FT                   /db_xref="GOA:Q5AWL1"
FT                   /db_xref="InterPro:IPR022190"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL1"
FT                   /protein_id="CBF78625.1"
FT                   /translation="MACDLHSRTLYSNTHSDKTRNCVVRDKEAKCRDAKAHQVVLQRGI
FT                   TGKDLPIVPSGVEDSVLKDYVGLCDAPAPLIVRNLGWRENNAGEPERKLLDNTRQLQAA
FT                   FAQTHGSLARTPCAPCASRKGSWKTCVTREYLRTGEKKPTNTDCAKCLFDDRQDCCITL
FT                   TEASTSSRIRRSSAPSPKTLTHDYELPKQNSMCPFKLEVDYAKDCHHKTELSRWTTAPD
FT                   ENGAVLSFPLGVECWDNLPRLKQACSEMEHHLNIAKVESAIRYLKKT"
FT   gene            318573..319227
FT                   /locus_tag="ANIA_07318"
FT                   /old_locus_tag="AN7318.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(318573..319032,319088..319227)
FT                   /locus_tag="ANIA_07318"
FT                   /old_locus_tag="AN7318.4"
FT                   /note="transcript_id=CADANIAT00000117"
FT   CDS             join(318573..319032,319088..319227)
FT                   /locus_tag="ANIA_07318"
FT                   /old_locus_tag="AN7318.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000117"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000117"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000117"
FT                   /db_xref="GOA:Q5AWL2"
FT                   /db_xref="InterPro:IPR022190"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL2"
FT                   /protein_id="CBF78627.1"
FT                   /translation="MVLLSATFPTSFNAVQDKELTCTVVDPRPDKLILGIHPILPILPG
FT                   ITASNLPIPPSGTTSKTIRFYILYPVLRRLDWRTAHAPTPATPESKSWAGDTADLEAAF
FT                   NQTRGLIAKRPCAGCSGGRGLWKSCAGRLGKKINGICANCWQAGEFCTNFNKASNLSRM
FT                   AATLRHCNKLMTNEQVFSFVIGDKMLDSLTHLRRAE"
FT   gene            complement(319696..320980)
FT                   /locus_tag="ANIA_07317"
FT                   /old_locus_tag="AN7317.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(319696..319721,320140..320473,
FT                   320583..320695,320788..320980))
FT                   /locus_tag="ANIA_07317"
FT                   /old_locus_tag="AN7317.4"
FT                   /note="transcript_id=CADANIAT00000118"
FT   CDS             complement(join(319696..319721,320140..320473,
FT                   320583..320695,320788..320980))
FT                   /locus_tag="ANIA_07317"
FT                   /old_locus_tag="AN7317.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000118"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000118"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000118"
FT                   /db_xref="GOA:Q5AWL3"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL3"
FT                   /protein_id="CBF78629.1"
FT                   /translation="MADNTTDHASQLEKGMGGLPPTFVHLDRTHTAGGHVNDRTQPGLP
FT                   VVHRTFANPSPLGLLSFATGLHARGVETPNVILGVLIFFGGLGQFLAAVMEFFTGNTFG
FT                   ATLWATYSAFNFSYAMIYIPGTGILAAYTDAETGALSPEFNQAIAIYLWAWFIVNTLYV
FT                   VAAVRSSWVIFIDLAILSLGFLLLAVAYMTGDQAVMTAGYSVTMVTAALSSIPLEQKK"
FT   gene            complement(322093..323108)
FT                   /locus_tag="ANIA_07316"
FT                   /old_locus_tag="AN7316.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(322093..322260,322319..322478,
FT                   322552..323108))
FT                   /locus_tag="ANIA_07316"
FT                   /old_locus_tag="AN7316.4"
FT                   /note="transcript_id=CADANIAT00000119"
FT   CDS             complement(join(322093..322260,322319..322478,
FT                   322552..323108))
FT                   /locus_tag="ANIA_07316"
FT                   /old_locus_tag="AN7316.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000119"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000119"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000119"
FT                   /db_xref="GOA:Q5AWL4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL4"
FT                   /protein_id="CBF78631.1"
FT                   /translation="MSAIQTQIQNGAVPNAVSNVCPPGTKFHVLEVGWLECDEAFVTRG
FT                   GNTSTKSTEGKSFVNKRRQLPMYCILIEHPHEGLILWETGCGKDYPEVWGPAVSDIFAR
FT                   VRYEPQHELRAAIEATGNKVEDVKKIIIGHLHLDHAGGLDEFMENKEVEVWVHERELNA
FT                   AFWSVATGADAGVYLAHYLNLSLNWKTFNDQTMDFCQGITLHHLPGHTDGLIGMQINMP
FT                   ESGTFFFISDHCHVLENWIDGIPQGWLARDHPAWFRSTQRLKQLQRITKGQVIPGHDET
FT                   TFLELKKQAKVFT"
FT   gene            323623..325153
FT                   /locus_tag="ANIA_07315"
FT                   /old_locus_tag="AN7315.4"
FT                   /product="succinate-semialdehyde dehydrogenase (Eurofung)"
FT   mRNA            join(323623..324673,324726..325153)
FT                   /locus_tag="ANIA_07315"
FT                   /old_locus_tag="AN7315.4"
FT                   /note="transcript_id=CADANIAT00000120"
FT   CDS             join(323623..324673,324726..325153)
FT                   /locus_tag="ANIA_07315"
FT                   /old_locus_tag="AN7315.4"
FT                   /product="succinate-semialdehyde dehydrogenase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000120"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000120"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000120"
FT                   /db_xref="GOA:Q5AWL5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL5"
FT                   /protein_id="CBF78632.1"
FT                   /translation="MSLASLKRKDLFQQHGLIGDKWVSSSGGGTFTVTNPATLETLATL
FT                   PEMNGADTESAITAAHTAFQSFRKTTARQRATWLRKWHALCVENIDDLALILTVENGKT
FT                   LAEAKGEVLYAASFLEWFAGEAERVHGEVVPASNANQRILTVKQPLGVAACLAPWNFPI
FT                   AMITRKVGAALAAGCTTVWKPAGETPLSALAQAVLAREAGFPSGTINVITTLNSVAEVG
FT                   AALCNSKLVRKLSFTGSTRIGKLLASQCSQNLTKLSLELGGNSPFIVFDDAKVETAVEA
FT                   CILAKFRNSGQTCVTANRIFVQEGIYDRFSAALVEKVKALKVGNGVEEGVIIGPLTHER
FT                   AVEKAVAHIKDAQEKGASLLLGGSPCQPNNLPGYFLEPTVLGKMSTEALTTREEVFAPV
FT                   VALYPFKTEEEVLAKANDCDVGLGSYVITESMPRMWRVAESLEVGMVGINMGTLSAAES
FT                   PFGGVKESGYGREGGRQGIEEYMTVKSILMNVAA"
FT   gene            328444..331749
FT                   /locus_tag="ANIA_07314"
FT                   /old_locus_tag="AN7314.4"
FT                   /product="polyphosphoinositide phosphatase Fig4
FT                   (AFU_orthologue; AFUA_2G16640)"
FT   mRNA            328444..331749
FT                   /locus_tag="ANIA_07314"
FT                   /old_locus_tag="AN7314.4"
FT                   /note="transcript_id=CADANIAT00000121"
FT   CDS             328444..331485
FT                   /locus_tag="ANIA_07314"
FT                   /old_locus_tag="AN7314.4"
FT                   /product="polyphosphoinositide phosphatase Fig4
FT                   (AFU_orthologue; AFUA_2G16640)"
FT                   /note="transcript_id=CADANIAT00000121"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000121"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000121"
FT                   /db_xref="GOA:Q5AWL6"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL6"
FT                   /protein_id="CBF78634.1"
FT                   /translation="MPSSDGASRPPDSEASRAASLAGRSSRTASLGDSSSLISTATPEP
FT                   NIAPEASFTSSTSHKTSEDQADGITNAQLDDDTLRRSPLSPFSPGPYNAPPAPPSIGED
FT                   AGEEEDEEPRIATSFQRDSISASAQKQRQVYLDTGGEDGIYRMHKFSLYETATWFYMVG
FT                   MDLSDTRFRILKIERTCDTDDLNIIEDEIVYTKRQMSHLLDAIDDGNKSSGGLKLKCSA
FT                   WAILGFVRFTGPYYMLLATKRSQVAMLGGHYVYKIDGTELISLTTSSSSSRFKPEKNPE
FT                   EARYIAILHSLDLTRAFYFSYSYDITNTLQNNINRERKLHEDGLPRDFRQDFNTMFIWN
FT                   HHLLTPAIMSLKNPYQWCLPIIHGYVEQAKMSVYGRLVYITIIARRSRYFAGARFLKRG
FT                   ANDLGYVANDVETEQIVSEMTTTSFHLAGPSLYANPLYTSYVQHRGSIPLYWTQENSGV
FT                   SPKPDIELNLVDPFYSAAALHFDNLFARYGAPIYVLNLIKSRERTPRESKLLREFTNAV
FT                   EYLNQFLPEDKKLIYKPWDMSRAAKSRDQDVIETLEDIAGEIIPKTGFFQNGQSPETGL
FT                   KVQNGIARTNCIDCLDRTNAAQFVIGKRALGYQLHALGIIEGTTVEYDTDVVNLFTDMW
FT                   HDHGDNIAIQYGGSHLVNTMATYRKINQWSSHSRDMVESFKRYYNNSFLDAQRQEAYNL
FT                   FLGNYIFSQGQPMLWDLSTDYYLHHADPRYWANKKKPNYIKWYTEENLKKREVPVPPVP
FT                   PKEPLSRYDDYWFEYYRPLAVSSFSKIFSYKMNSTLRYLPFRPTSTDDYNLSPFVPRIS
FT                   HEQLNRERPQRSVKIQEPEPLANPPNPHQPYTAEKRPGIMKPISSLGTLQNTNAASSHP
FT                   SMDSSLTNPTPSKAQIAQWTLGQLVSDSLNPSVTAAEAEEYERYINHPLKVPLVVTSED
FT                   ELTAASIREHEANLDLVEYMNKCNVEEYTLSANAEENLADYAEFLHVSEEGLTVVEADK
FT                   DKKRYKRYGQWLKGKSLFKQRVET"
FT   gene            332432..334059
FT                   /locus_tag="ANIA_07313"
FT                   /old_locus_tag="AN7313.4"
FT                   /product="glycosyl hydrolase family 43 protein
FT                   (AFU_orthologue; AFUA_8G02510)"
FT   mRNA            join(332432..332524,332593..333069,333134..333298,
FT                   333367..334059)
FT                   /locus_tag="ANIA_07313"
FT                   /old_locus_tag="AN7313.4"
FT                   /note="transcript_id=CADANIAT00000122"
FT   CDS             join(332432..332524,332593..333069,333134..333298,
FT                   333367..334059)
FT                   /locus_tag="ANIA_07313"
FT                   /old_locus_tag="AN7313.4"
FT                   /product="glycosyl hydrolase family 43 protein
FT                   (AFU_orthologue; AFUA_8G02510)"
FT                   /note="transcript_id=CADANIAT00000122"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000122"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000122"
FT                   /db_xref="GOA:Q5AWL7"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL7"
FT                   /protein_id="CBF78636.1"
FT                   /translation="MHRRFKILYFALVAKYARAALDIIPGATWTADSTSKHMAPDSCMI
FT                   SCLPSPQYQPLTLHSEEDGTYYMIGEEKTDGALFQAVNCYSSTNLVEWTFVNQLLTVTE
FT                   EEGADLGPNRIVERPKVIKNDNTGQYVMWMHIDSTDYADARVGIATGNSVCEDYVYRES
FT                   FRPLGFQSRDIGLFKDEDGSAYLLSEDREYGTRIIRLTDDYLHVANVTFGWEYFAESPA
FT                   LIKRGETYFIFGSHLTGWSPNDNIYSTATSLSGPWTDWTEVAPVGSNTFSSQVNYVLPL
FT                   GTDKAIYMGDRWVSSNLGASTYIWLPLQIDGTTATASLTWYDSWSVDLASGTWNAEEDE
FT                   TVYEGEDGALSGGARLIDCSRCSGSTAAGYIGGAGDGENDGAVTLQVDYATQSTDSARI
FT                   TLNIHYLNGDTDPRYAAVSVNGGEAQTIAFLSTNQLSGSGSSAVHVDLVQGVNTVQISG
FT                   VEGGGWGPDIDQVAVPL"
FT   gene            complement(334166..336058)
FT                   /locus_tag="ANIA_10927"
FT                   /old_locus_tag="AN10927.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(334166..335167,335220..335641,
FT                   335753..335858,335909..336058))
FT                   /locus_tag="ANIA_10927"
FT                   /old_locus_tag="AN10927.4"
FT                   /note="transcript_id=CADANIAT00000123"
FT   CDS             complement(join(334166..335167,335220..335641,
FT                   335753..335858,335909..336058))
FT                   /locus_tag="ANIA_10927"
FT                   /old_locus_tag="AN10927.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000123"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000123"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000123"
FT                   /db_xref="GOA:C8VCP1"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018870"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCP1"
FT                   /protein_id="CBF78638.1"
FT                   /translation="MERLRNAANAALQQPALTPIPDLILADLTPIAVSQLWQETSTYSS
FT                   SDNSEILQNLLIAEASFRKQSPENLSDMDKSAINRFYAWATQDESRQRSTLAVSVISRL
FT                   NALLPFEQSECVSSVVIALASFSSDADAWNTHEAFTASTAMLRDFVEASSFWLTIESIL
FT                   KSRVRPIFAKAKNPAITESGRKNFHPIPLPRFDSSILDPETKPWKLQDAYITTVFAWIV
FT                   NQYKPTDINTLEAHFPLLVPPTLSLIDDSSHFYKRLGCILLSQFLVPIRESKSDILRRT
FT                   NLSSVFEDAIRPLFHSLPTITPEDDSIQLLSEAYPALRSLVQTSYRLSSATNRSTSSPR
FT                   QLTDEEKFISTTTKTLRDHLIPSFHHISSTNPTTSSGSTFASFPHPRLSTFLLEQIAIT
FT                   CAEIGIHTTKYLQEIIPLIYSTLSNPFGTAHPPLLLSALSATRAVILNAYPRLWRWRGE
FT                   MLGAICSCWIHIFEEEGESKRVDGNKADELGNLKKQLQGAVYLLRYALEHPVHVNTDHG
FT                   QREAKENIGKEIQMLVEADESLKTCLLAEINSDDPTYFGYNT"
FT   gene            complement(336267..338147)
FT                   /locus_tag="ANIA_10924"
FT                   /old_locus_tag="AN10924.4"
FT                   /product="tRNA nucleotidyltransferase (AFU_orthologue;
FT                   AFUA_2G16660)"
FT   mRNA            complement(join(336267..336511,336575..338147))
FT                   /locus_tag="ANIA_10924"
FT                   /old_locus_tag="AN10924.4"
FT                   /note="transcript_id=CADANIAT00000124"
FT   CDS             complement(join(336267..336511,336575..338147))
FT                   /locus_tag="ANIA_10924"
FT                   /old_locus_tag="AN10924.4"
FT                   /product="tRNA nucleotidyltransferase (AFU_orthologue;
FT                   AFUA_2G16660)"
FT                   /note="transcript_id=CADANIAT00000124"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000124"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000124"
FT                   /db_xref="GOA:C8VCP2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCP2"
FT                   /protein_id="CBF78640.1"
FT                   /translation="MFAYSCSSCAIRVFTRLTQRTTYFPRSPSFHQPTSHRIPIQLALF
FT                   SCYMSRHQLGDFPSPRAKKRRRISTTTAAEAGVATMNPAADGTSQQLPTIQLTPCETTL
FT                   KDLLLDVAQYIQDCDTANRHGDGTKTVLRFTGGWVRDKLLGVESHDIDVAINNMTGYQF
FT                   GTMLKEYLDIPENLDKYKGQNGEKELSLHKIEANPEKSKHLETVTTKIFGFDVDLVNLR
FT                   KEAYDENSRTPQMEFGTAEEDALRRDATINALFYNLNESKVEDLTGRGLDDMRDEIIRT
FT                   PMEPYQTFKDDPLRVLRLIRFASRLGFRIDKDTENAMQHGDIGAALKLKISRERVGIEV
FT                   QKMLQGPDPRGALHIIDRLNLYPIIFANFQDDVTADYSTWSLAYEALHRLCSEDDSGTI
FT                   SRVRSLLVRDPLETYYSWVIVAFAPWSTVPTRVQGTKLIPPRMAETARDSLRADNRTVN
FT                   ILKQTGTHWRNIIDVKTALVEGRMEGTAAEVRQQLGLHIRSWSTDWRFCVLLSLLQEIM
FT                   QGGNFVKVVQSYDQFLSYIVEQDLQDVCDLKHIVKGDEIMEAFETRKKGPWVSNALKLV
FT                   IEWQLLHPGVEDKEGALKYLQSKREEIGL"
FT   gene            338353..340946
FT                   /locus_tag="ANIA_07311"
FT                   /old_locus_tag="AN7311.4"
FT                   /product="PutativeTRAPP (transport protein particle)
FT                   complex protein TRS85 (Eurofung)"
FT   mRNA            join(338353..339739,339790..340946)
FT                   /locus_tag="ANIA_07311"
FT                   /old_locus_tag="AN7311.4"
FT                   /note="transcript_id=CADANIAT00000125"
FT   CDS             join(338671..339739,339790..340946)
FT                   /locus_tag="ANIA_07311"
FT                   /old_locus_tag="AN7311.4"
FT                   /product="PutativeTRAPP (transport protein particle)
FT                   complex protein TRS85 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000125"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000125"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000125"
FT                   /db_xref="GOA:Q5AWL9"
FT                   /db_xref="InterPro:IPR024420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWL9"
FT                   /protein_id="CBF78642.1"
FT                   /translation="MTSPGDAAPVKPPPSFSPGVPRVPSKTRYPQRRDSSASLDTERAD
FT                   SRIASSPTTPLSNTTDLPIRSASPSARSIRSSTPQIGRTSLGSPLDGRADTALDIRSLI
FT                   IRSFSPVVGVYASPDTDELVRQKGFKGGFWELIRPFGENVPGKLVVRDSVGSSRGWEDY
FT                   GVRFVDLGDLCRAPNDPSQGYNSSLAQLEAVLEKQLDSADSLPSGPLHPKDLAGLSSTS
FT                   PLYKLYLRQLLSIASASPHETFRHPVASVIAISSRNPAPLESLRQLYADTNTGPQKVPD
FT                   WIHPEYLRYYVLVHDEDRDDISASTKLYDQMKRHFGLHCHLLRLRSNQCVVTDDDSVQV
FT                   PECEWLSPSERLSERPEPLVDLDSDGLLYLFDSDVMAIKGFVRELVAQSIVPFMENRVA
FT                   VWNDQVASRRRGISGRFMSISRKWAGFGTSSRSSSGSGGASGNYNVSQGFYHYDHSEAI
FT                   LRKMADYAFMLRDWKLAASTYELLRSDYANDKAWKYHAGAYEMCAVSTLLNPLGAGSKI
FT                   KVESIDQMFDTACYSYLTRCSDAPITLRCLTLAVELLKSRGGSAAESAAKWAMRAMDLG
FT                   LVESVGQGLLSERISSCYASRAPPNGLRFGGRRRKAGMWSLFAADMWLKLGKPSLASAC
FT                   LEEAERLYADALDSDGVFPMPEMQTFVDNLRLSVKVGYLEARGLDVKEETGSTNPLDDE
FT                   ETSEKLDRRMNRRSLIGNLNPLDTATLAQLQTARDGDNVPSDDFERA"
FT   gene            341306..342977
FT                   /locus_tag="ANIA_07310"
FT                   /old_locus_tag="AN7310.4"
FT                   /product="vacuolar sorting protein SNF7 family protein,
FT                   putative (AFU_orthologue; AFUA_2G16692)"
FT   mRNA            join(341306..341352,341409..341679,341755..341976,
FT                   342044..342238,342291..342977)
FT                   /locus_tag="ANIA_07310"
FT                   /old_locus_tag="AN7310.4"
FT                   /note="transcript_id=CADANIAT00000126"
FT   CDS             join(341306..341352,341409..341679,341755..341976,
FT                   342044..342238,342291..342977)
FT                   /locus_tag="ANIA_07310"
FT                   /old_locus_tag="AN7310.4"
FT                   /product="vacuolar sorting protein SNF7 family protein,
FT                   putative (AFU_orthologue; AFUA_2G16692)"
FT                   /note="transcript_id=CADANIAT00000126"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000126"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000126"
FT                   /db_xref="GOA:Q5AWM0"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWM0"
FT                   /protein_id="CBF78644.1"
FT                   /translation="MSDLLNYILSQDSFRKNRLPSLYSDFSIQAKTNPDGYRVNVAAWE
FT                   QALTRAARNGYISSHTFLQHSGDGKVQRRKANHLTLHVSEGLLRDLEIPELGRPVALGA
FT                   VFEDAVWNRTMVPVHLYKASAASLRKPQWGLIDTTTLSPWNVMVWGLKQIRGVVVGSGT
FT                   DAPRLQTQDLVLVSNLQEAAEKLVKQVLDASPSRTDLVFSKESFVEAFGTILNENSELS
FT                   NTDYDVLLLYLSRDKGAIAYDGKTIRFRPTDDSPREITEQDTAISLIKSLTATMTRQIG
FT                   SLEKKIAELNATARAALGDKNRVSALAALRSKKLAEHNLQQRLDTLAQLEQTQLKIEQA
FT                   TDHVEYLKVMESSTGALRGLNAQLGDVSKVEDVVYELREEMSKVDEIGNIMGEAGPQID
FT                   ETEIDEELEGLEFKERKAKEEQEAEGTRKQLAELDNLGLETKGAIRKAPVGQNVDSALE
FT                   DSIEKLSQMSVEEGA"
FT   gene            complement(342192..344624)
FT                   /locus_tag="ANIA_07309"
FT                   /old_locus_tag="AN7309.4"
FT                   /product="Postreplication repair E3 ubiquitin-protein
FT                   ligase rad18 (EC 6.3.2.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q02398]"
FT   mRNA            complement(join(342192..343816,343878..343989,
FT                   344041..344624))
FT                   /locus_tag="ANIA_07309"
FT                   /old_locus_tag="AN7309.4"
FT                   /note="transcript_id=CADANIAT00000127"
FT   CDS             complement(join(343114..343816,343878..343989,
FT                   344041..344557))
FT                   /locus_tag="ANIA_07309"
FT                   /old_locus_tag="AN7309.4"
FT                   /product="Postreplication repair E3 ubiquitin-protein
FT                   ligase rad18 (EC 6.3.2.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q02398]"
FT                   /note="transcript_id=CADANIAT00000127"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000127"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000127"
FT                   /db_xref="GOA:Q02398"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02398"
FT                   /protein_id="CBF78646.1"
FT                   /translation="MEPTFDIPDSTDWLDTPLTLLAPFETSLRCQVCKDFFDNPVITSC
FT                   SHTFCSLCIRRCLSTEGKCPTCRSSDQELKLRRNWVVQELVEGFKNARPSILQLARMAQ
FT                   TGTDDSGDLAAEEPASKKRKIEPNAIVGTDGLPEEGIRTRSQSRGASRQPQATPVQVID
FT                   DGNDEDYMPDGLVPCPVCGRRMKEEAVFRHLDSCTGTAEELKPAAFGSLAPGPRKSFLA
FT                   ATGKPPERLPVINYSLLKDTVLRKKLKDLGIPNWGPRALLQRRHTEWLNLWNANCDSRT
FT                   PKPKRELLRELDVWERTQGGNSVTPTDPTNAVMNKDFNTEEWSANYDTDFKALIANARK
FT                   KNDAVIRSTIPNASQANSDTPRSAQLVDQPIEASLTPQDVDEKSTMNPQDAIDNRTEVP
FT                   PVPDPPQALSGIDRAVNSPMKNVTEGDAQAIPISSSASTHKTPH"
FT   gene            344801..346539
FT                   /locus_tag="ANIA_07308"
FT                   /old_locus_tag="AN7308.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(344801..344860,344910..344965,345014..345271,
FT                   345377..345509,345576..345854,345908..345932,
FT                   345980..346333,346388..346539)
FT                   /locus_tag="ANIA_07308"
FT                   /old_locus_tag="AN7308.4"
FT                   /note="transcript_id=CADANIAT00000128"
FT   CDS             join(344801..344860,344910..344965,345014..345271,
FT                   345377..345509,345576..345854,345908..345932,
FT                   345980..346333,346388..346539)
FT                   /locus_tag="ANIA_07308"
FT                   /old_locus_tag="AN7308.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000128"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000128"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000128"
FT                   /db_xref="GOA:Q5AWM2"
FT                   /db_xref="InterPro:IPR019038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWM2"
FT                   /protein_id="CBF78648.1"
FT                   /translation="MAIADHKKFLAEAVFHERRTVTYRSLGRALRVHSTLAKQMLYEFH
FT                   LNENSKKPSSVHATYVLTGVPKPVEPVRNGATANGNGDNEDDIMPSSPYISSSLPNPET
FT                   ESDQVPVSAVLLAREEDLEGNLQPTILQDLNVLTDVSREMLVNHAHEDPLEYGKQWGMV
FT                   QNTNVMRRTGVRPPPPPSSTVPAKRPAQSEPLQPGKAEIKNEEPPKPLQRQNSASSAKT
FT                   NEKIPPAKKEKGSLFSSFAKAKPKLKKEDPATSAASAAESTATSGAEDVVDDASEDEQE
FT                   DLFPESRKEGPSETRESRKERDERLRKMMEDDGGLVSNIVHHRILMSADEDEEMIDATE
FT                   PPTESETIDKPPPKQEDLKVEATVKGGRRRGRRQVMKKVVKKDSEGYLVTVEEPSWESF
FT                   SEDEPTPPPPKKKPGVSAPKAKPGTKAGQGNIMSFFGKK"
FT   gene            346946..348685
FT                   /locus_tag="ANIA_07307"
FT                   /old_locus_tag="AN7307.4"
FT                   /product="DUF1237 domain protein (AFU_orthologue;
FT                   AFUA_2G16720)"
FT   mRNA            join(346946..347079,347183..348351,348417..348685)
FT                   /locus_tag="ANIA_07307"
FT                   /old_locus_tag="AN7307.4"
FT                   /note="transcript_id=CADANIAT00000129"
FT   CDS             join(346946..347079,347183..348351,348417..348685)
FT                   /locus_tag="ANIA_07307"
FT                   /old_locus_tag="AN7307.4"
FT                   /product="DUF1237 domain protein (AFU_orthologue;
FT                   AFUA_2G16720)"
FT                   /note="transcript_id=CADANIAT00000129"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000129"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000129"
FT                   /db_xref="GOA:Q5AWM3"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWM3"
FT                   /protein_id="CBF78650.1"
FT                   /translation="MTLPALVLALSLLSANAREAAALRDEPTILRRACPDYLSYSTAPQ
FT                   PAIECRTFNSSAVEQVIEDVTSRMIDKDLAQLFRNAFPNTLDTTIRWHIDGFTTAIRQS
FT                   KSKKQNEQWTGPQTFVVTGDINAEWLRDSTNQLANYQTLANRDRRLYNLIQGAINTQAE
FT                   FVIQSPYCNAFQPPPPSNIPPEAHNQDDQVHPAYEPSVVFECKYELDSLANFLALTADF
FT                   HENTGSTDFLTSRWYTALDTLLAVLDAQSQPTFNTEGQFVTNQYTFQRTTTLGTETLSL
FT                   AGVGNPLNSGTGLIRSAFRPSDDATIMGFFIPANAQMAVQLNKTAAMLRTAGGHDDLAN
FT                   NLQDRSTRLRRAIQENAIVNHPKFGDVYAFEVDGYGSHVFMDDANVPSLLSLPVLGYLD
FT                   KDDPVYQNTRKMILSKDGNPYYLTGSAFHGIGGPHIGLENAWPMSLLIQAQTSDSDIEI
FT                   RECLNLVKNSSLLGLVHESINVNNIVEYTRPWFAWANSVFAQTVLKIAAERPAIVFGEG
FT                   AEPYIP"
FT   gene            complement(348969..350527)
FT                   /locus_tag="ANIA_10925"
FT                   /old_locus_tag="AN10925.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   12 (Eurofung)"
FT   mRNA            complement(join(348969..350380,350439..350527))
FT                   /locus_tag="ANIA_10925"
FT                   /old_locus_tag="AN10925.4"
FT                   /note="transcript_id=CADANIAT00000130"
FT   CDS             complement(join(348969..350380,350439..350496))
FT                   /locus_tag="ANIA_10925"
FT                   /old_locus_tag="AN10925.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   12 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000130"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000130"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000130"
FT                   /db_xref="GOA:C8VCP8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8VCP8"
FT                   /protein_id="CBF78652.1"
FT                   /translation="MEYLPSLQQEFDELKPSLFELLAEQQLSDLLPPSIRYILAVATHR
FT                   HPRYLLRVLNSFDEVYALLSLVVERYYLRNFGGSFTENFYSLKRERVLLTKNGEIPRAQ
FT                   LGAPGPVRESLKLRNSDVWKNLLVMVGIPYLKRKLDEGYDIHAAPQASLIMNGGPRYNP
FT                   SDDLPPHPTIRQRFMHAYKWFLRNVYPSFNAAYYFSILAFNLAYLFDNTKYSSPFLWLI
FT                   GTRIRRLSSADHQAIAKILEGKPQTPNSRSARSRPGSGLLGLFSPHNLYPQLLTSLRYF
FT                   LPASIFALKFLEWWHASDFSRQLARKATDTLDIPAPITKGMISPSERKSRPPTKQKEDP
FT                   ESPKSALKTSSPHKRIQPPISASSYLPIFTVPLPPADSDAASSCPVCLNQLTNPTACQT
FT                   GYVYCYVCIFHWLNGEHQRQIDFMNGDGAGAAWEDDSGDGIDADGDRNETESAAKTGKS
FT                   RHGKWESGKGRCPVTGRRVLGGTEGLRRVLI"
FT   gene            complement(350896..352979)
FT                   /locus_tag="ANIA_10923"
FT                   /old_locus_tag="AN10923.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(350896..352979)
FT                   /locus_tag="ANIA_10923"
FT                   /old_locus_tag="AN10923.4"
FT                   /note="transcript_id=CADANIAT00000131"
FT   CDS             complement(350916..352961)
FT                   /locus_tag="ANIA_10923"
FT                   /old_locus_tag="AN10923.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000131"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000131"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000131"
FT                   /db_xref="GOA:C8VCP9"
FT                   /db_xref="UniProtKB/Swiss-Prot:C8VCP9"
FT                   /protein_id="CBF78654.1"
FT                   /translation="MTLLRAPQRFQYASRVFTSTSLSTPRHAYLTYSRVRSLTSTSHHP
FT                   TKSHPSLSSSTSNTTSVEENDAPKSQCTPQASQHIPWYLQEESSVPAVSEVTLQEKLPE
FT                   LPENPPKILPELLEYIFKDLGLDELKLIDLRPLETPSALGANVIMIIGTARSVKHLNVS
FT                   ADRLCRWLRSEYKLSPYADGLLGRNELKIKLRRKNRRARIASRTGTMFDDKDDGITTGW
FT                   ICVNAGVVEEHPVEERVEGDFEGFGPLVGGTRVVVQVFTAEKRAEMDLETLWEGRLARA
FT                   QRERQKHADAAKDDAPEEVRYPNSISPSPSDYKSPNVPRSWISLPHEQRRQFHIRSLRS
FT                   FARPAHHAVFTPRFMSQNHTPAEHAIVGSELSSPTAMLLQYITTMPDQQLMSALGDRPD
FT                   DESSTDFLRLFHHSLLGASPNVLALARLELLCLAHSRGHTGISKESVHRAFMGCCFSAS
FT                   HIPDRLIPTVVDILLTPRTGDNPDGEKWFTDADKELALSALDQLVLRGNDFMNLQFFTR
FT                   LYYLSSLPPGPPGEENDDGLTPAERGAHVVRMIEILDIPFDPIHARTLMVYLFRNGDYD
FT                   AFMKWWRTLPLKNSPRTREDYEMLFRLHADSGDSRLTRECISTWAPMMSREDPPIWLEG
FT                   DLVAHLRDCLLLADERTPARAAEGTQSLFAKLWRACERELNKSEVV"
FT   gene            complement(353153..354472)
FT                   /locus_tag="ANIA_07305"
FT                   /old_locus_tag="AN7305.4"
FT                   /product="Pre-rRNA-processing protein esf2 (18S rRNA factor
FT                   2) [Source:UniProtKB/Swiss-Prot;Acc:Q5AWM5]"
FT   mRNA            complement(join(353153..353664,353717..354472))
FT                   /locus_tag="ANIA_07305"
FT                   /old_locus_tag="AN7305.4"
FT                   /note="transcript_id=CADANIAT00000132"
FT   CDS             complement(join(353297..353664,353717..354389))
FT                   /locus_tag="ANIA_07305"
FT                   /old_locus_tag="AN7305.4"
FT                   /product="Pre-rRNA-processing protein esf2 (18S rRNA factor
FT                   2) [Source:UniProtKB/Swiss-Prot;Acc:Q5AWM5]"
FT                   /note="transcript_id=CADANIAT00000132"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000132"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000132"
FT                   /db_xref="GOA:Q5AWM5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWM5"
FT                   /protein_id="CBF78656.1"
FT                   /translation="MTTRKHNEFLDIGTSDDEDNDAGYDSEAAEESKGRTVKRRKTQSR
FT                   EDGIESASEDESSGGSEGEESDTEAGGVRLREKKRGQRDEYENDSDDDGNYMNQESQYL
FT                   DVTAEVEKAKAKKNQKPLDKLKNKPPKKNKTGVVYFSSLPPYLKPFALKSLLETRGFKP
FT                   ITKVFLTPAVRPPSAPRRRSNKRKTYTDGWVEFASKKTAKICAETLNATIVGGKKGGWY
FT                   HDDVWNMKYLKGFKWADLMETQERERSEREAKRRIEDARARKEEKVFLQGYEKGKMLEG
FT                   IQKKNEEKRRKKMADKDGHGDQGKEQAINARRLFKQNEVKLGRDKTSADQTTVEEDTRR
FT                   VLGKIF"
FT   gene            complement(354834..356355)
FT                   /locus_tag="ANIA_07304"
FT                   /old_locus_tag="AN7304.4"
FT                   /product="mitochondrial carrier protein (Leu5), putative
FT                   (AFU_orthologue; AFUA_2G16770)"
FT   mRNA            complement(join(354834..355970,356035..356355))
FT                   /locus_tag="ANIA_07304"
FT                   /old_locus_tag="AN7304.4"
FT                   /note="transcript_id=CADANIAT00000133"
FT   CDS             complement(join(354990..355970,356035..356355))
FT                   /locus_tag="ANIA_07304"
FT                   /old_locus_tag="AN7304.4"
FT                   /product="mitochondrial carrier protein (Leu5), putative
FT                   (AFU_orthologue; AFUA_2G16770)"
FT                   /note="transcript_id=CADANIAT00000133"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000133"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000133"
FT                   /db_xref="GOA:Q5AWM6"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWM6"
FT                   /protein_id="CBF78658.1"
FT                   /translation="MSAAATGHAQDDSTSLIPNPTSPNIIGDSQSRNQSASQQMESASH
FT                   AQRPTSHNISSGAVVAGPHATTADDPSHRPGQSSRNGGQEKNKRSLDYVLRSGLAGGLA
FT                   GCATVVAPLDRVKILFQASNPQFAKYTGSWTGLVFAIRDIKRHEGARGLYRGHSATLLR
FT                   IFPYASIKFLAYEQFRAIVIPSRDKETPFRRLVSGSLAGITSVFFTYPLELIRVRLAFE
FT                   TKKSSRSSLVDTIRQIYGEQVKPPKELSTGKGTSSVTGTAAAAANTVSSTTRNIVPSSG
FT                   LANFYRGFTPTLLGMIPYAGVSFLTHDTVGDWLRLPLLAPYTTIPRSSSSGHKKDRQKL
FT                   QLTAAAELLSGAIAGLVSQTSSYPLEVVRRRMQVGGVVGDGRRLGMAETARIIMMERGF
FT                   RGFFIGLTIGYLKMIPMTATGFFVYERLKWSLGI"
FT   gene            complement(357326..360675)
FT                   /locus_tag="ANIA_07303"
FT                   /old_locus_tag="AN7303.4"
FT                   /product="DDT domain protein (AFU_orthologue;
FT                   AFUA_2G16780)"
FT   mRNA            complement(join(357326..358382,358433..360042,
FT                   360102..360118,360198..360278,360521..360605,
FT                   360673..360675))
FT                   /locus_tag="ANIA_07303"
FT                   /old_locus_tag="AN7303.4"
FT                   /note="transcript_id=CADANIAT00000134"
FT   CDS             complement(join(357326..358382,358433..360042,
FT                   360102..360118,360198..360278,360521..360605,
FT                   360673..360675))
FT                   /locus_tag="ANIA_07303"
FT                   /old_locus_tag="AN7303.4"
FT                   /product="DDT domain protein (AFU_orthologue;
FT                   AFUA_2G16780)"
FT                   /note="transcript_id=CADANIAT00000134"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000134"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000134"
FT                   /db_xref="GOA:Q5AWM7"
FT                   /db_xref="InterPro:IPR004022"
FT                   /db_xref="InterPro:IPR018501"
FT                   /db_xref="InterPro:IPR028935"
FT                   /db_xref="InterPro:IPR028941"
FT                   /db_xref="InterPro:IPR028942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWM7"
FT                   /protein_id="CBF78660.1"
FT                   /translation="MVLFKRKPVQYLPRPIIEDDSSEACTLREDGGIKRGEQLVSRSAK
FT                   GSHIAPGPILDVDEIYEEFKSEFYPGEPVLILLDDNTRLHGVIRDKAKFPEQLYPDGTV
FT                   RTPAHATYLVKVLDRPDEEALLDNHHITRDRKTFTKQMLRAFIKNNVTRESWNGAPWLV
FT                   KPSVAEEYRIPTEVPKHLQYGARVAEKKAQKKADQEGFFGFFASKELPELKPAVKGQKA
FT                   KPSAQDLARSEEAQFLEYKRSLNGNPSFLVGNKSMNGPPRPSKSQEPEKNAPPIPSVVI
FT                   KAEPPRPPSPPPIKYPIEDLEIPPNREKKKQRPPLKFLKANEFDDPNDEDLLQDAIEME
FT                   SVGLLLETWNTLNVYCEVFQLDSFTFDDFLQAMRFSSDEMDCELFVEIHCAVLKKLVNA
FT                   EKDDNGAIQISLPELPVEESEDSDEDEEMVEDEQDEPEATPEPAVTRMTTRGSLAKAEA
FT                   EGLKATLNGDHDSSEIKSHRASEMLSEYRWIDRLRKRDFRNGGWEMIMIGLLHQLSVRP
FT                   RMEKVCNQILEHLAPLDQEPTQDTARAQYAVLDVNLRIRALQIICMLSLETRAIRNYLE
FT                   ECSNQMTEFRKEKIEYQKARKAAMEEVRRLHQECKALAPEPEKSPSPLPEMEPAEDTKM
FT                   SGMDGDSQVESEVEGTPQRALRGGVDRVMERKRKLEEERERKEQLAKQPKGSKQYQRLL
FT                   KKLEEQKAAVKKFEDKIAVVDNDLREADCPRTRCLGKDRFCNRYWWFERNAMPYEGMPD
FT                   SSTAEAKYANGRLWVQGPDDMERLGFIDVSDDLKKQYQKRFHMSPAERKKHEEGPTRLS
FT                   GAHEWGYYDEPEAIEKLLDWLDSRGERETKLRKELLLHRDKLVKCMQARHEYLSRTEDD
FT                   SEDIPTKRVTTRNKTYVADAKHRCLNWRNSTALADNGHLHVDASRPSKRARKSGEDLKE
FT                   VKATNRQGKPLTRQGGRYNF"
FT   gene            362112..362508
FT                   /locus_tag="ANIA_11553"
FT                   /old_locus_tag="AN11553.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(362112..362356,362466..362508)
FT                   /locus_tag="ANIA_11553"
FT                   /old_locus_tag="AN11553.4"
FT                   /note="transcript_id=CADANIAT00000135"
FT   CDS             join(362112..362356,362466..362508)
FT                   /locus_tag="ANIA_11553"
FT                   /old_locus_tag="AN11553.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000135"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000135"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000135"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCQ3"
FT                   /protein_id="CBF78662.1"
FT                   /translation="MTGQVSSTVLRLRGSAKQCSATSRALFKHYFSTSAEKNTDPASIQ
FT                   LVESLHQKNGNLSTRLTDGEVKLIISSYWPAIISTYFSFPGNVDLYAFTP"
FT   gene            complement(363089..364832)
FT                   /locus_tag="ANIA_07302"
FT                   /old_locus_tag="AN7302.4"
FT                   /product="lectin family integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_2G16800)"
FT   mRNA            complement(join(363089..363370,363431..363959,
FT                   364010..364204,364252..364432,364492..364562,
FT                   364617..364683,364744..364832))
FT                   /locus_tag="ANIA_07302"
FT                   /old_locus_tag="AN7302.4"
FT                   /note="transcript_id=CADANIAT00000136"
FT   CDS             complement(join(363243..363370,363431..363959,
FT                   364010..364204,364252..364432,364492..364562,
FT                   364617..364683,364744..364832))
FT                   /locus_tag="ANIA_07302"
FT                   /old_locus_tag="AN7302.4"
FT                   /product="lectin family integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_2G16800)"
FT                   /note="transcript_id=CADANIAT00000136"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000136"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000136"
FT                   /db_xref="GOA:Q5AWM8"
FT                   /db_xref="InterPro:IPR005052"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWM8"
FT                   /protein_id="CBF78663.1"
FT                   /translation="MKVPALFFFFSAVATAQTVIESSSFGHGAMVAPNREGIPGWDIGG
FT                   EGHFPQILSNKVILTPPYPGNTRGYAWSQTPLSQSEWAAEFQFRATGVERAGGNLQLWY
FT                   AKDGKQKIGSASIYTVGQWDGFALVVDTHSGRGGSIRGFLNDGTTDYKSHSSVDSLAFG
FT                   HCDYSYRNLGRPSVIRVRSTNAIFEVTVDDKPCFATDKITLPAGNTIGVTAATPENPDS
FT                   FEVFKVVLQTATSPVGKAPPVQAQNTNQQPLADQPQGNARQEQGFSNNLNSINAQFVDL
FT                   GSRIQLVNHATNNIIRELGNQASKSETRQLELLQRVATKEQVQSLEARLQRMEQTLLSI
FT                   QRDLEGKDYRDRFNQLHETLRSSHQSLTENLKDNVVSVITASTPRMGFFIFSMIAFQVF
FT                   LAVSYIIYKRRRANMPKKFL"
FT   gene            365415..367468
FT                   /locus_tag="ANIA_07301"
FT                   /old_locus_tag="AN7301.4"
FT                   /product="Dolichyl pyrophosphate Glc1Man9GlcNAc2
FT                   alpha-1,3-glucosyltransferase (EC
FT                   2.4.1.-)(Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl
FT                   glucosyltransferase)(Asparagine-linked glycosylation
FT                   protein 8) [Source:UniProtKB/Swiss-Prot;Acc:Q5AWM9]"
FT   mRNA            join(365415..365491,365578..365656,365717..365910,
FT                   365960..366453,366504..366643,366693..367120,
FT                   367351..367468)
FT                   /locus_tag="ANIA_07301"
FT                   /old_locus_tag="AN7301.4"
FT                   /note="transcript_id=CADANIAT00000137"
FT   CDS             join(365415..365491,365578..365656,365717..365910,
FT                   365960..366453,366504..366643,366693..367120,
FT                   367351..367468)
FT                   /locus_tag="ANIA_07301"
FT                   /old_locus_tag="AN7301.4"
FT                   /product="Dolichyl pyrophosphate Glc1Man9GlcNAc2
FT                   alpha-1,3-glucosyltransferase (EC
FT                   2.4.1.-)(Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl
FT                   glucosyltransferase)(Asparagine-linked glycosylation
FT                   protein 8) [Source:UniProtKB/Swiss-Prot;Acc:Q5AWM9]"
FT                   /note="transcript_id=CADANIAT00000137"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000137"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000137"
FT                   /db_xref="GOA:Q5AWM9"
FT                   /db_xref="InterPro:IPR004856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWM9"
FT                   /protein_id="CBF78665.1"
FT                   /translation="MAELYPSLTQCAIVATAFKILLFPAYKSTDFEVHRNWLAITHSLP
FT                   VQEWYYEKTSEWTLDYPPFFAVFEWALSQLAQYVDPAMLDVQNLNYDSWQTVYFQRATV
FT                   ILSELVLFYALNRFIRSDPQPTKHLAHAASLSILLSPGLFIIDHIHFQYNGFLYGILVL
FT                   SIVWARKQSKLLYSGIAFAVLLCLKHIYLYLAPAYFIYLLRAYCLDPKSVFRPRFGNAF
FT                   KLGLSIITVFGLAFGPFVYWGQLLQLKDRLFPFSRGLCHAYWAPNVWAMYSFTDRILIP
FT                   FAPKLGLPVNQDALTSVTRGLVGDTSFAILPEISKEYTFVLTLLSLILPLIKLWLRPDY
FT                   YTFVGALTLCGYASFLFGWHVHEKAILLIIIPFSLIALKDRRYFSAFRPIAVAGHVSLF
FT                   PLLFTAAEFPLKTVYTLLWLILFLFVFDRIAPVPERPRIFLVDRFSLLYITVSIPLILY
FT                   TSLVHQLIFGLESSITPSQPLEQRIPSPVTSASHSSLRFWYRMSAKASMTP"
FT   gene            complement(368209..370867)
FT                   /locus_tag="ANIA_07300"
FT                   /old_locus_tag="AN7300.4"
FT                   /product="PHD finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G16810)"
FT   mRNA            complement(join(368209..368626,368677..369456,
FT                   369540..370867))
FT                   /locus_tag="ANIA_07300"
FT                   /old_locus_tag="AN7300.4"
FT                   /note="transcript_id=CADANIAT00000138"
FT   CDS             complement(join(368209..368626,368677..369456,
FT                   369540..370867))
FT                   /locus_tag="ANIA_07300"
FT                   /old_locus_tag="AN7300.4"
FT                   /product="PHD finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G16810)"
FT                   /note="transcript_id=CADANIAT00000138"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000138"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000138"
FT                   /db_xref="GOA:Q5AWN0"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN0"
FT                   /protein_id="CBF78667.1"
FT                   /translation="MARNLRSSSHARSNDSRPSTPVPHTANMASPFTESTRPRKQRRTG
FT                   RSSRVGTDSLRDTPVSSQSQSVQPQESATNGVSGTELNGHFADWIEPEPRAPVPSYLDT
FT                   PWSNVSNAHNPVLGTMRPLGALPTTADRRKAGLAPSHPGTPSIPAVKEKQPVSEGEKKD
FT                   DSPPTLLTPAEEQAPELILPRPTIEEDLAAFTILPVPNSIDADVDTLKAAVESALHLAS
FT                   DANNRLVIKGLLRMWEKCGNDPYVLRILDGVCQETPGSPQRSMFQKAMRTVLGELEAQE
FT                   MARTEPGAPPVLGRARSASSVSTLSSAKSLDAETYAPVPVVAATSAPRPKKGKQSKNST
FT                   QKKTAPAVDFQRQRAVENPEFSEEAIQAKKSRLRKSLPKIATSESGIRSSLTSNPPSNF
FT                   SSPGPIAANLDISVSRNTGAHRERSESVASSDAGDNRRLTPSLTDEPAENNDFCRQCEK
FT                   SGRLLCCDGCVYSYHFSCLNPPLDPANPPEGDWFCPKCSVSKSLNTLLGGMEKTPGRDF
FT                   ALPNKIRDFFAGVRTGDDGKYEEVASLPRINPRAARGSRTGRYDDPFLLRITDAKGKLI
FT                   VCVKCGQTTNGRRPIIQCDFCPCAFHMDCLDPPLAVPPTQRVGSDRLYHTWMCPNHALH
FT                   DMCYPVRDEEGYETMKRIRRPKNPRFIDVEVLPENEEEENLEDEEKEGITYRVSEKGIK
FT                   LDFIERVKRENETAAAKKAAEKMYFEYAKSKVDAITSEAKAFFESQKPADDTTAAILNS
FT                   RTDVEREAAANLILFAQSNQVIWQNEQNGQINLLIDQLKANAPKNLPAPEDEISSLRAL
FT                   QKLIEQRISALQPKQKTKNAYSSEVQPTS"
FT   gene            complement(373526..375574)
FT                   /locus_tag="ANIA_07299"
FT                   /old_locus_tag="AN7299.4"
FT                   /product="curved DNA-binding protein (42 kDa protein)
FT                   (AFU_orthologue; AFUA_2G16820)"
FT   mRNA            complement(join(373526..373972,374050..374847,
FT                   374927..375031,375105..375188,375440..375574))
FT                   /locus_tag="ANIA_07299"
FT                   /old_locus_tag="AN7299.4"
FT                   /note="transcript_id=CADANIAT00000139"
FT   CDS             complement(join(373782..373972,374050..374847,
FT                   374927..375031,375105..375188,375440..375473))
FT                   /locus_tag="ANIA_07299"
FT                   /old_locus_tag="AN7299.4"
FT                   /product="curved DNA-binding protein (42 kDa protein)
FT                   (AFU_orthologue; AFUA_2G16820)"
FT                   /note="transcript_id=CADANIAT00000139"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000139"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000139"
FT                   /db_xref="GOA:Q5AWN1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN1"
FT                   /protein_id="CBF78669.1"
FT                   /translation="MAENQTQTPEVDYTLNNPDTLTKYKTAAQISHKVLEAVSAQCVEG
FT                   AKIIELCQQGDKLLEEELAKVYKGKKIQKGIGHPTTVSPNSHVTPYTPLVSETAEAETT
FT                   LKAGEIAKIQLGAQIDGFGTIVCDMVVVGASEVTGREADLIHATYYANELLLRLMAPPG
FT                   LLATGSDEEKKKAAAERPPTQARITQLIEKIAKTYDCTIVENTTSWLFERNEIEAEKKI
FT                   ILSPGSGVKGEGVPDVGEVWGVEVGLSLGSGKVKNLDLRPTLHRRTTTTYQLKRPSSRA
FT                   TLTEIVKKFGQFPFSLRQLDDEKAAKVGVIESVRNGVLRQYEPAGDADNAAVSRYLTTI
FT                   AITKNGITKLAAPATPDFEKIKSDKKIEDEEILKILELPLSKSTGSKNKNKKKKAKKAD
FT                   GADE"
FT   gene            376309..377517
FT                   /locus_tag="ANIA_07298"
FT                   /old_locus_tag="AN7298.4"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein (AFU_orthologue; AFUA_2G16830)"
FT   mRNA            join(376309..377158,377377..377409,377487..377517)
FT                   /locus_tag="ANIA_07298"
FT                   /old_locus_tag="AN7298.4"
FT                   /note="transcript_id=CADANIAT00000140"
FT   CDS             join(376320..377158,377377..377409,377487..377517)
FT                   /locus_tag="ANIA_07298"
FT                   /old_locus_tag="AN7298.4"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein (AFU_orthologue; AFUA_2G16830)"
FT                   /note="transcript_id=CADANIAT00000140"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000140"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000140"
FT                   /db_xref="GOA:Q5AWN2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN2"
FT                   /protein_id="CBF78671.1"
FT                   /translation="MKVDAKDIPLRILTHNIRYATTSPFRGERFWEERAPRLLNELRYN
FT                   TRNQDAFICLQEVLDNQLIDILSGLNSNDHVDSGAAAESSDHTWAYIGVGRDDGYKAGE
FT                   YSPILYRPSVWELRHWETVWLSETPDVPSKSWDAASIRIVTIGLFTHHVSRHTVLAMNT
FT                   HLDDQGSRSRFEAAHIILHKIDEYRNGRFGNIISGIFLAGDLNSEDTQEAYAVLTALES
FT                   PMVDSATLVDTADYYGNQTTWTGFGYEGEDPKRIDYILLGPAVRGDGPGRGLPWNIEGT
FT                   DSAQRAQVPRYCRYKQVTI"
FT   gene            378495..381457
FT                   /locus_tag="ANIA_07297"
FT                   /old_locus_tag="AN7297.4"
FT                   /product="SWI-SNF complex subunit (Snf5), putative
FT                   (AFU_orthologue; AFUA_2G16840)"
FT   mRNA            join(378495..380564,380685..381457)
FT                   /locus_tag="ANIA_07297"
FT                   /old_locus_tag="AN7297.4"
FT                   /note="transcript_id=CADANIAT00000141"
FT   CDS             join(378495..380564,380685..381011)
FT                   /locus_tag="ANIA_07297"
FT                   /old_locus_tag="AN7297.4"
FT                   /product="SWI-SNF complex subunit (Snf5), putative
FT                   (AFU_orthologue; AFUA_2G16840)"
FT                   /note="transcript_id=CADANIAT00000141"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000141"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000141"
FT                   /db_xref="GOA:Q5AWN3"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN3"
FT                   /protein_id="CBF78673.1"
FT                   /translation="MAFPDSSQQGMADAQSDAIQNNSDLLDGAADFDHDVDSSLLADHG
FT                   IEGSDTIGEGKHNAKAVLAASGVSLPKSVSGQDASNMDTSPGSQNGSANGAAPGKKRSR
FT                   DGAFIPPSSPGNALPVRVRETPMEKILLDEYVNREFQHSALTAWQNPSQQLLQEKRAER
FT                   DYYLALRRENHTNPAALYGVGYEGFGNARTDLRNQHPQLLYPAHRRRPGNRKTRELRVS
FT                   RKDMKTQSEQLEHLVPIRLDIDWEKVKIRDTFTWNLHDRVVSPDLFAEKLVEDLGLPLE
FT                   SCGPLVRMISQSIQEQICDFYPHVHIEEEALDPHLPYSAYKNDELRIVVKLNITIGQHT
FT                   LVDQFEWDINDPHNSPEEFAARMTTDLSLSGEFTTAIAHSIREQSQLFTKSLYIVSHPF
FT                   DGRPVEDPDLKASFLPSPLTSSFRPFQAAKEFTPYLYELNEAELERTEVSFQRDQRRQK
FT                   RSVNRRGGPALPDLKDRQRTIRTLLVSSVIPNTAPSLEESNVFKRSGSSRRGRAAVGLR
FT                   EGGDDSDESDSDESSLVGSPAIGPHLAQGTARTRGMRGAATAAHAALRANLGQSATPEP
FT                   HNESRVSARRRDYREESPEEPEKLIVTLKISREKFRQFLMNGYKTNSAAVNSTPATQPA
FT                   SQRSTPQVQTPTLNSTPVPSQSHSQARLPSAGRPGPIQHLGAVEAPNPPQPGVPGPPPP
FT                   SWLVAGLNRLNQANPNDSFEAVMRYTAVDTETMQPVTHSQAQANQKLKFLYLPRIRCHD
FT                   CPGKLYTPGPATTVDNFEVHLRNRQHKERVEERLAKAAAASNAAT"
FT   gene            complement(382270..387266)
FT                   /locus_tag="ANIA_07296"
FT                   /old_locus_tag="AN7296.4"
FT                   /product="BimD protein
FT                   [Source:UniProtKB/TrEMBL;Acc:O94076]"
FT   mRNA            complement(join(382270..384991,385042..386715,
FT                   386791..387266))
FT                   /locus_tag="ANIA_07296"
FT                   /old_locus_tag="AN7296.4"
FT                   /note="transcript_id=CADANIAT00000142"
FT   CDS             complement(join(382502..384991,385042..386715,
FT                   386791..387147))
FT                   /locus_tag="ANIA_07296"
FT                   /old_locus_tag="AN7296.4"
FT                   /product="BimD protein
FT                   [Source:UniProtKB/TrEMBL;Acc:O94076]"
FT                   /note="transcript_id=CADANIAT00000142"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000142"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000142"
FT                   /db_xref="GOA:Q5AWN4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN4"
FT                   /protein_id="CBF78675.1"
FT                   /translation="MPSRTRQGPSVATEDVEPEEPSGGLRQLKFNEPLSWRVGRSAIPI
FT                   ADLLQRLQTLAQELRKLEQEEIEKESLRKVSQELATAQLLAHKDKGVRAWATCCIVDVL
FT                   RLCAPDAPFTANQLKDIFTCIVSSIIPALGDPSNPYNAQHIYVLNSLAEVKSIVLMTDL
FT                   DHPDTLIVPLFISCFDIVAGSAKASTGEPVAKNVEYDMTRLLVTVIDESPVLAPDVVDV
FT                   IVAQFLRVDPRVLDGPGKKGKKPETQVDEKQETLLLKDYPAAYNMAKAICQACPERMTS
FT                   HISQYFNNVIIDASATGTQNGPSKQARRTNLDDSDEEGEDIKELSKAHRLIRELWRACP
FT                   DVLQNVIPQLEAELSAESVSLRLLATQTIGDLTSGTGVAGPPPPLPMDPAVYPQVKLDD
FT                   YARSIPQPNVLLMPFAPKPFSQAHSSAYDSFLSRRLDKSASVRASWATAIGRIILTSAG
FT                   GSGLSDNEEQTLITHLSSMLRDADERVRLAAVEAVGTFGLSHIVNKLGVSGGVSTQDSL
FT                   LFILAERVKDRKSQVREHATKVLARAWAVASGDIERSHEQVTPLLKEAPSRILDAYYTN
FT                   DPEIHVSIDRAMFEILLPLSYPPIKPKLSRSSSSQSQRLKDSQAAEPESEADVDRIRVR
FT                   RILTLVGGLDEKAKKVFFAMQKRQVSLRTAVTVYLQACEEYNGGVMEKNKDQIKAQLTK
FT                   IVDALAKTFPDPARTSADLWKFAKIHDRRGYQLIRFAMAAVSDYRTVIKAIKELARRLQ
FT                   SSNNTILHETLTTLLYRCSSIVFNRSHIPAIMSISRSDENGLAAPAHEMLKEISSLNPE
FT                   VLEAQVQEICKDLEAQAPKATTVSAAGTEEILKACSGFAKKLPSKLPKERKFFQALVDY
FT                   ALHSPSPRAAKHAVLILMAVTDKKNMYAKDLVEKCVSKCTYDSERFLTKLATLSQLNLL
FT                   APREADEESDAIIKISVNQILLTNRSPTPNSGYFWSDQVDDETAAKEWALKIIVNRLRA
FT                   KDGSDSDDDFRAHAEPVYDTLNKLIVNSGELSKKKDTPATQKSRLRLLAANSLLKLCSS
FT                   HALCEQLLTPQDFNSIALVAQDPLPEVRSGFINQLKKKLVQDTRLGARWYVIPYLLAFE
FT                   PQVGLKDSTLTWLRSRAAFFSQQTNGKKGEKQTVMEALFSRLLSLLAYHPDYPPADLDE
FT                   STKLDELTDFARYILFYLSAVANEHNLSLIFHIAQRVKQARDGITKSDEMSRRLHTLSD
FT                   LAQATIRRFADVYSQQRRFGGGAGGVNLLQTYPGKVGVPSSIFAPMGSHREAQEVADTT
FT                   FLPEDAEDRLDRIVRATMRTKNGSSQAGAKKRKTDSTQEPSRDANAAKKARKNSESSSR
FT                   RKSGSSAVGFKMPKRKSTKKTGDDWSSDGEAAGNVASSSATRRRSNRGSASRRISYADP
FT                   DSDEDDMEMDELNQARDDEDEGEDQAKDIENGSDLSELSEADSNMLEEPEDDDGPSEKE
FT                   DQPDDKQNGDDDAQPASPVPVASKAKVPGKAMKKATLPTRRSARR"
FT   gene            complement(387612..389411)
FT                   /locus_tag="ANIA_07295"
FT                   /old_locus_tag="AN7295.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_2G16860)"
FT   mRNA            complement(join(387612..388519,388577..389411))
FT                   /locus_tag="ANIA_07295"
FT                   /old_locus_tag="AN7295.4"
FT                   /note="transcript_id=CADANIAT00000143"
FT   CDS             complement(join(387612..388519,388577..389303))
FT                   /locus_tag="ANIA_07295"
FT                   /old_locus_tag="AN7295.4"
FT                   /product="MFS multidrug transporter, putative
FT                   (AFU_orthologue; AFUA_2G16860)"
FT                   /note="transcript_id=CADANIAT00000143"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000143"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000143"
FT                   /db_xref="GOA:Q5AWN5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN5"
FT                   /protein_id="CBF78676.1"
FT                   /translation="MSDINNLHPGDGPGHDAPSSSTTLRSESRSSLGYGEKAMQSSPDT
FT                   VSEKGEDRDIESGNHDAQKPSADEKPKELESKDPNLIEWNGPNDPENPQNMPHWRKWVI
FT                   TMTMSSMTMWLTFASSVFSTATLVTAQQFGVSTEVMILATSLVVFGFAAGPLVWSPMSE
FT                   LYGRKYPLFLGYALFAIFQIPVAVAKNVQTILVCRFLMGFLGCSPLAVVGGAMADFWDP
FT                   VDRAIAIALFSAATFVGPVLGPIVGGFLTDSYLGWRWTAWITLIASGSFGGIAWFVVPE
FT                   TYHPVLLQRRAAKLRKETGNQDLYAFLDHHRPTFGDIVRKYLFRPVQMLMLEPILILIT
FT                   LYLALVYGILYLFFEAYPVSFQEERGWTNGGIAGLPFIGIMIGVLCGVALIVWQTKTRF
FT                   ARKLAKHGRVIPEERLVPMMVASVLLPGGLFWFGWTSSPNVHWLAQVAAGVPIGAGILV
FT                   IFMQGLNYIIDVYMMFANSAIAANTLIRSSLGGAFPLFATQMYHKLGVPWASSLLGFIT
FT                   VAMIPIPIVFYIYGKKIRALSKFSPNF"
FT   gene            complement(390914..392901)
FT                   /locus_tag="ANIA_07294"
FT                   /old_locus_tag="AN7294.4"
FT                   /product="PHD and RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G16870)"
FT   mRNA            complement(join(390914..392472,392546..392901))
FT                   /locus_tag="ANIA_07294"
FT                   /old_locus_tag="AN7294.4"
FT                   /note="transcript_id=CADANIAT00000144"
FT   CDS             complement(join(390914..392472,392546..392831))
FT                   /locus_tag="ANIA_07294"
FT                   /old_locus_tag="AN7294.4"
FT                   /product="PHD and RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_2G16870)"
FT                   /note="transcript_id=CADANIAT00000144"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000144"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000144"
FT                   /db_xref="GOA:C8VCR2"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCR2"
FT                   /protein_id="CBF78678.1"
FT                   /translation="MSDTCIVCLGDLGESASDPLAASVPRPDLEPDGKAPDISTKAEGS
FT                   DGSEDSFIAQLLPCGHILHNNCLKPWVERANSCPICRRTFNEVELSDRVGGPVISSYAV
FT                   EDRVQVADVDPSMVVEYIDDDVSDFQPCPICGDSENEEVLLLCDGCDVPTHIYCVGLDE
FT                   VPAGPWYCSRCETQRPIGLSSDAVDRLSHAQTRRRHRTRAQQRRVLSRNQINSLHWARV
FT                   WQSVWDNLNIDLDFPFDDDRAVERALQQQRREEANQREFRTWQRRFDVAERQGGRNRFR
FT                   DTAALLDIEAPRPSRPRAPRAPTPEPESLEEMRAWNAFERAREIENNPSAARKRKEPTM
FT                   SPSPEPAEPARKLKRPRTRRAEDLAALAVQNGESSRSATAQASARLNADNSSEPSFLSS
FT                   LLKEVEDASTPQSVNSYGPSAHVSAEQSTLGLSSPSISPVPSNQSSPRLSSTTPPPHSG
FT                   SRPISPMQLTPPREVSSPTFSPEVSPASSHKDVREETPSRSRPRRIPRAAHIVRAVRSN
FT                   ESSPARIGLSLEVKSDIQKLVSAALKPHYRSKVVSKEEYTDINRNISRKLYEHALGLDS
FT                   LESTTKARLEAKAKEEVHNAVEALRQSKARANGSDDSS"
FT   gene            395101..396614
FT                   /locus_tag="ANIA_07293"
FT                   /old_locus_tag="AN7293.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(395101..395489,395536..395608,395658..395782,
FT                   395833..396614)
FT                   /locus_tag="ANIA_07293"
FT                   /old_locus_tag="AN7293.4"
FT                   /note="transcript_id=CADANIAT00000145"
FT   CDS             join(395101..395489,395536..395608,395658..395782,
FT                   395833..396538)
FT                   /locus_tag="ANIA_07293"
FT                   /old_locus_tag="AN7293.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000145"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000145"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000145"
FT                   /db_xref="GOA:Q5AWN7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN7"
FT                   /protein_id="CBF78680.1"
FT                   /translation="MESSREFDIVVLGPTGYTGKYCAEHIVTHLPTNLKWALAGRSTKK
FT                   IEGVAQELKKLNPDRLDPGKTMYWCLWSGSADASIEIISVQLNKEELRSLAERTKLIIN
FT                   CVGPYHIYSTPVVEACANAGTHYVDATGETPWVKQTVDKYHGTAKSNGAIIIHCVGIES
FT                   APADMLAYALVKEVREKMSCQTKEITGSIYEFKSSGASGGTLASILTCIEDFSGSQLLE
FT                   STKPFALAASPPPKDIPSESFVARILGVRTVRDLGTLTKSPTDFCDMTIIHRSSTLMPE
FT                   LYGPRFYFRQFLNVRNTFIGILWNYAFLVGTAFLILAPVRWLVKKAIYAPGSGPTTESG
FT                   RNDRCEYRAIATPDQDTPKRVLGKLKYAGSSMYHFTGVLMAEAAMVILENEEKVKRVSG
FT                   GGIVTPASLGQEYLDRLENNGCRVETQVLEN"
FT   gene            complement(396695..398164)
FT                   /locus_tag="ANIA_07292"
FT                   /old_locus_tag="AN7292.4"
FT                   /product="epoxide hydrolase, putative (AFU_orthologue;
FT                   AFUA_2G16900)"
FT   mRNA            complement(join(396695..396972,397032..397083,
FT                   397159..397489,397549..397954,398086..398164))
FT                   /locus_tag="ANIA_07292"
FT                   /old_locus_tag="AN7292.4"
FT                   /note="transcript_id=CADANIAT00000146"
FT   CDS             complement(join(396695..396972,397032..397083,
FT                   397159..397489,397549..397954,398086..398164))
FT                   /locus_tag="ANIA_07292"
FT                   /old_locus_tag="AN7292.4"
FT                   /product="epoxide hydrolase, putative (AFU_orthologue;
FT                   AFUA_2G16900)"
FT                   /note="transcript_id=CADANIAT00000146"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000146"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000146"
FT                   /db_xref="GOA:Q5AWN8"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN8"
FT                   /protein_id="CBF78682.1"
FT                   /translation="MAVDKTRVSGDSRVEHRSAFVKGKTYGYLYSQPPSGQYKGTVVLV
FT                   FTLTFLYTLSSSILMQILFCLSSMVSRTCQWVGDTRFRYLSIKATESLRQIVLDMDERY
FT                   TRPSILQSEQAADGITVFLNQDAPADLAAYSHKNCADDIKELANQLGASKIILGGHDWG
FT                   AFLAYRVALWHPTLITHLFTVCVPYSPPYKRYMTLEDMVSKVAPHFGYQLHFVSGEIEE
FT                   AVKSKEDYKQFLISLYGGKTQEKEPAFDVHKGVDLEKMRSVKMSWLLEEEEMEYYAWEF
FT                   ARHGLRGPLNWYRTRKINYDDELSLQKGTIDIPVLFIQALKDAALPPHLGKGMGKAIPQ
FT                   LTTKQVNASHWALWEKPAEVNQALEAWFNEVVEGGSRVAKL"
FT   gene            complement(398576..399676)
FT                   /locus_tag="ANIA_07291"
FT                   /old_locus_tag="AN7291.4"
FT                   /product="nuclear protein SDK3, putative (AFU_orthologue;
FT                   AFUA_2G16910)"
FT   mRNA            complement(join(398576..398956,399026..399094,
FT                   399153..399600,399666..399676))
FT                   /locus_tag="ANIA_07291"
FT                   /old_locus_tag="AN7291.4"
FT                   /note="transcript_id=CADANIAT00000147"
FT   CDS             complement(join(398576..398956,399026..399094,
FT                   399153..399600,399666..399676))
FT                   /locus_tag="ANIA_07291"
FT                   /old_locus_tag="AN7291.4"
FT                   /product="nuclear protein SDK3, putative (AFU_orthologue;
FT                   AFUA_2G16910)"
FT                   /note="transcript_id=CADANIAT00000147"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000147"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000147"
FT                   /db_xref="GOA:Q5AWN9"
FT                   /db_xref="InterPro:IPR006786"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWN9"
FT                   /protein_id="CBF78684.1"
FT                   /translation="MAEGTLASAVIVPEQENHVPSPESGLKRRQSSTTDLESDIKRRRL
FT                   STQNDDQDSEEPPARRQSSPKLEVQDTERKRNRRDEERKRGQRLFGSLLGTLSQTSNSA
FT                   AQRRRADIERKQQDKLKLQDEEYGELKKKRWEERLATRKKEQKSYEKEMMLTRHENLLA
FT                   MAHSLKTKSEPALLRPEEEDIIQDQVREAEATIAREVEEFDARNAQEDQPETDRQEQPE
FT                   EAQEKLEQQEPSQDAQNDEAKEQEEKVQAEQSHEEEPEETKPDGPSTEAVSASPHQDED
FT                   HRGAEDDGGEVVEDNEDTVIY"
FT   gene            400108..400434
FT                   /locus_tag="ANIA_07290"
FT                   /old_locus_tag="AN7290.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            400108..400434
FT                   /locus_tag="ANIA_07290"
FT                   /old_locus_tag="AN7290.4"
FT                   /note="transcript_id=CADANIAT00000148"
FT   CDS             400108..400434
FT                   /locus_tag="ANIA_07290"
FT                   /old_locus_tag="AN7290.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000148"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000148"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000148"
FT                   /db_xref="GOA:Q5AWP0"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWP0"
FT                   /protein_id="CBF78686.1"
FT                   /translation="MSRHHPDLVMCRKQPGISIGRLCDKCDGKCPVCDSYVRPTTLVRI
FT                   CDECSFGNYQNKCIVCGGEGISDAFYCFECTRLEKDRDGCPKIINLGSSRTDLFYQKKS
FT                   FRNH"
FT   gene            complement(400541..401988)
FT                   /locus_tag="ANIA_07289"
FT                   /old_locus_tag="AN7289.4"
FT                   /product="actin monomer binding protein, putative
FT                   (AFU_orthologue; AFUA_2G16920)"
FT   mRNA            complement(join(400541..400759,400810..401061,
FT                   401130..401761,401903..401988))
FT                   /locus_tag="ANIA_07289"
FT                   /old_locus_tag="AN7289.4"
FT                   /note="transcript_id=CADANIAT00000149"
FT   CDS             complement(join(400643..400759,400810..401061,
FT                   401130..401761,401903..401921))
FT                   /locus_tag="ANIA_07289"
FT                   /old_locus_tag="AN7289.4"
FT                   /product="actin monomer binding protein, putative
FT                   (AFU_orthologue; AFUA_2G16920)"
FT                   /note="transcript_id=CADANIAT00000149"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000149"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000149"
FT                   /db_xref="GOA:C8VCR7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR028458"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCR7"
FT                   /protein_id="CBF78688.1"
FT                   /translation="MQSGISVSQELHDAFSRFASDTSIFCLPVTITAERLTPLSTLPFS
FT                   GFGENAFYASLSQLTSVLEPKTPIYLLIRRTGSNLIALTYIPSNAGVRAKTLFASTRAT
FT                   LVRELGSEKFSETIFATDEEEVIGENAWKEREAEKNGTSTGGYRREDLMGEKERELEAV
FT                   RRAEEAARSGTPGRDIGIGGTFARGPSRMKIEMQVDEDAKNALGGLQQGGLVQMAIDVS
FT                   TETFKLTAAESGVDANSVQNHISASSPRYTFYHYPDSDTIIFIYTCPSGSSIKERMLYA
FT                   SSRMHALQVAEEQGLKILKKIEAGAPDEVTGERLQEEVNPPQNNGLRQGFAKPRRPGR"
FT   gene            403686..405744
FT                   /locus_tag="ANIA_07288"
FT                   /old_locus_tag="AN7288.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(403686..404703,404747..405744)
FT                   /locus_tag="ANIA_07288"
FT                   /old_locus_tag="AN7288.4"
FT                   /note="transcript_id=CADANIAT00000150"
FT   CDS             join(403686..404703,404747..405744)
FT                   /locus_tag="ANIA_07288"
FT                   /old_locus_tag="AN7288.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000150"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000150"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000150"
FT                   /db_xref="GOA:Q5AWP2"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWP2"
FT                   /protein_id="CBF78690.1"
FT                   /translation="MEPRTTSEPVNSSVPAHAAALAAPRVIGLYGLPGCGKSYIMDQLK
FT                   QELGETDFEYFEGSKEISKVTPGGLDEFKMQDKYKQDHWRKLAIDAIKSTCAQTGKTGI
FT                   VTGHYMFWEGGKKEEASRVCSQADLATYTHILYVNAPLEVTAKQRAEDTKRARSNLSSE
FT                   HLRRWQETEIQEIHDLCRENNILFATIYPNLKSKLASLIRDFQCHDENHNRLVAEHIFD
FT                   KCISPSYDELQTVLFFDADKTLAAVDTGTRFWKIHETKGGKKDPLSALFRGPLGYSYTA
FT                   FRQAMLLYEESTNDDEFEAICEEIASHTRPLSGNVLASAPGRKLPPRFFCHCDLRTTTL
FT                   KVVGGGRIKDGFVVTPSVKECLITRAKSAHTVYTWAFGDSPLDLPMMRAAHKPVVVVGE
FT                   QQSRSKSMEHKLLTEIRDNGLQARQVLLPVNTSPPLLDTAKLPVANLTEKSFLDEIFQP
FT                   LGRPGGVRLHHATDSHATKLLSTPMRDDSIRGPSLQEAHENAGRYLATRYLVELIGTEV
FT                   LAIRHPQGNFVAGYRLLDEEQTLIVPLMRGGQSMASGIFKVFPKARLHDAKEPTDVKEE
FT                   HLKGIVNVILVDSVINSGESMAQFVQRIREVDGAVRIIIVAGVIQDQAVKGCSQLRAVA
FT                   RSTELTVVALRLSANKYTGKGTTDTGNRLFNTTYLD"
FT   gene            complement(408028..409228)
FT                   /locus_tag="ANIA_07287"
FT                   /old_locus_tag="AN7287.4"
FT                   /product="Mitochondrial succinate-fumarate antiporter
FT                   (Eurofung)"
FT   mRNA            complement(join(408028..408641,408718..408915,
FT                   408965..409018,409072..409119,409171..409228))
FT                   /locus_tag="ANIA_07287"
FT                   /old_locus_tag="AN7287.4"
FT                   /note="transcript_id=CADANIAT00000151"
FT   CDS             complement(join(408028..408641,408718..408915,
FT                   408965..409018,409072..409119,409171..409228))
FT                   /locus_tag="ANIA_07287"
FT                   /old_locus_tag="AN7287.4"
FT                   /product="Mitochondrial succinate-fumarate antiporter
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000151"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000151"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000151"
FT                   /db_xref="GOA:C8VCR9"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCR9"
FT                   /protein_id="CBF78691.1"
FT                   /translation="MSAKGGDGRKPASPAVNLIAGGGAGMMEALVCHPLDTIKVRMQLS
FT                   RRSTAPGVSQASWFRENRCRDCQEGNRTRSVQGSGAVLGGIIPKMAIRFTSYEQYKQLL
FT                   ADKNTGAVSSKATFLAGLAAGVTEAVAVVNPMEVIKIRLQAQHHSLADPLDAPKYRSAP
FT                   HALFTVIKEEGFMALYRGVSLTALRQGTNQAANFTAYTELKAFLQRSQPEYSNSQLPSY
FT                   QTTVIGLISGAVGPFSNAPIDTIKTRLQKTRAEPGQSAVNRIMTIAKDMFKQEGASAFY
FT                   KGITPRVMRVAPGQAVTFTVYEFLKGKLEASNWAFVGGKYEE"
FT   gene            410955..411915
FT                   /locus_tag="ANIA_07286"
FT                   /old_locus_tag="AN7286.4"
FT                   /product="sodium-dependent transporter (Eurofung)"
FT   mRNA            join(410955..411676,411734..411842,411874..411915)
FT                   /locus_tag="ANIA_07286"
FT                   /old_locus_tag="AN7286.4"
FT                   /note="transcript_id=CADANIAT00000152"
FT   CDS             join(410955..411676,411734..411842,411874..411915)
FT                   /locus_tag="ANIA_07286"
FT                   /old_locus_tag="AN7286.4"
FT                   /product="sodium-dependent transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000152"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000152"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000152"
FT                   /db_xref="GOA:Q5AWP4"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWP4"
FT                   /protein_id="CBF78693.1"
FT                   /translation="MSTPQPAWKRIALFILHQWLIIGIGVACLLGYFFPNVAKHGGIIR
FT                   SEYSILYGAVAIVFLISGLSIPQDKLVRQLFNWRLHLLVQVTSFLFIPALVLAVVHAIL
FT                   ASDKTERIDRAVLAGYIFTACIPTTIASNVVMTRSAGGDDAAALAEVLIANILGPFVTA
FT                   GWTVTLLPASKEFDVWRDQDEDLTAMYRDVFKQLGLAVLLPLAVGQFVRFLWPKKTGHI
FT                   LQKYKLAKLGSFCLLLMIWSTFSSCFATGALQGLSTESIVFVVLFNIALYLFLTAASAF
FT                   EQPLAAGRS"
FT   gene            complement(412319..413802)
FT                   /locus_tag="ANIA_07285"
FT                   /old_locus_tag="AN7285.4"
FT                   /product="microbody (peroxisome) proliferation protein
FT                   peroxin 26 (Eurofung)"
FT   mRNA            complement(join(412319..413322,413378..413802))
FT                   /locus_tag="ANIA_07285"
FT                   /old_locus_tag="AN7285.4"
FT                   /note="transcript_id=CADANIAT00000153"
FT   CDS             complement(join(412449..413322,413378..413802))
FT                   /locus_tag="ANIA_07285"
FT                   /old_locus_tag="AN7285.4"
FT                   /product="microbody (peroxisome) proliferation protein
FT                   peroxin 26 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000153"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000153"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000153"
FT                   /db_xref="GOA:C8VCS1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCS1"
FT                   /protein_id="CBF78695.1"
FT                   /translation="MADDTSGMSASTPALSPSKLCSRTYKKASQLFLTRRLQEALVSLE
FT                   PVITAKGSNDDQEVNGTSLPPIATVPATWRIKIWNLYITLLSAIIDLGPEEGKKVIGQK
FT                   EWKDISTQVRDGGIWERVVQIGYQGREGSIDAEVVYNLGTLLLNHSPSQIINQQRLETY
FT                   LSSYGQPNLDIEEHLNSPTSSQQHRIRNGGTDTPKDLAARVRLIELFTLHVLPRNEEWD
FT                   YAEEFINLSEVLDEERKEVFMQTLEGLKEEKEQGKLRAAALQREKEAELERQAQEADRQ
FT                   RAEEAVAAERAAQQKNHKMNGSGVDYGIEKTHPNGSIRGKKGERVGSSKAGSSSRTALS
FT                   PPSSKNLKKPEKPETRARQSRALAAGLQNLVQYLGKSISKNPLSFLRLLLFLLGIIFAL
FT                   NRPKIRERIKRIAGSGWQKVRGTVGMGVKVSYI"
FT   gene            415037..416382
FT                   /locus_tag="ANIA_10928"
FT                   /old_locus_tag="AN10928.4"
FT                   /product="CAF1 family ribonuclease, putative
FT                   (AFU_orthologue; AFUA_2G16960)"
FT   mRNA            join(415037..415129,415168..415713,415837..415872,
FT                   415931..416245,416332..416382)
FT                   /locus_tag="ANIA_10928"
FT                   /old_locus_tag="AN10928.4"
FT                   /note="transcript_id=CADANIAT00000154"
FT   CDS             join(415037..415129,415168..415713,415837..415872,
FT                   415931..416245,416332..416382)
FT                   /locus_tag="ANIA_10928"
FT                   /old_locus_tag="AN10928.4"
FT                   /product="CAF1 family ribonuclease, putative
FT                   (AFU_orthologue; AFUA_2G16960)"
FT                   /note="transcript_id=CADANIAT00000154"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000154"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000154"
FT                   /db_xref="GOA:C8VCS2"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCS2"
FT                   /protein_id="CBF78697.1"
FT                   /translation="MDVDETDYESLALLKFVRKLIDEWIALGDIKKRDKYLKIPPPSRQ
FT                   KETQTLDSVPSILNRFQKRLVHQVVEVEYPDFVTIGRPGFVQIIDYDEKREVAVRDKRV
FT                   QWCQKRVRKQTGFRWIAEALAWGDLTHLSTNYFPGVRGNTASTEQGKSLQEFVENFKAR
FT                   LKAHRPILVGHNLFTDLVYFFRCFFWNPTEPCRGLSVHGAQAFSYCHRYKTDLFRHTSS
FT                   FRQIFVKLSAQLGSGSQIRPAGSPSNTSLTAAHGLNNRFSHLHVEETSNGLASPLVVAE
FT                   SERSDGVLGQQSHAEEIRLAEKGLLISRPNFQFWRVYGNNLRNFGTKEKNLQNMKRAIG
FT                   MCAASI"
FT   gene            416668..418012
FT                   /locus_tag="ANIA_10922"
FT                   /old_locus_tag="AN10922.4"
FT                   /product="50S ribosomal subunit L30 (AFU_orthologue;
FT                   AFUA_2G16970)"
FT   mRNA            join(416668..416752,416807..417474,417530..418012)
FT                   /locus_tag="ANIA_10922"
FT                   /old_locus_tag="AN10922.4"
FT                   /note="transcript_id=CADANIAT00000155"
FT   CDS             join(416707..416752,416807..417474,417530..417832)
FT                   /locus_tag="ANIA_10922"
FT                   /old_locus_tag="AN10922.4"
FT                   /product="50S ribosomal subunit L30 (AFU_orthologue;
FT                   AFUA_2G16970)"
FT                   /note="transcript_id=CADANIAT00000155"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000155"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000155"
FT                   /db_xref="GOA:C8VCS3"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCS3"
FT                   /protein_id="CBF78699.1"
FT                   /translation="MSSGSNGARRIASILRPSIAEQRVCSSCQETLVRRNYASAATPIS
FT                   PKPSSSTSSTFPVVSPTYTINAGVLLSRPPQITRDLTDFEKAYYFYQKRLNERLALPFT
FT                   KYFYFKRGTPLDEDWKRKVRERQTAARDIGKYNAYGKEAWNDELLLGAKESEPEHIVEA
FT                   LISDAESTANNTSQDTSKQEQIPRPHPRVTEADKKGDTKSLDRALQRTLYLLVQHKEGY
FT                   WKLPSSPVASGETLRSAAERTLEQSAGVNMNTFMVGYHPVGHYVYNSRKPKIDETTGAT
FT                   LAGEKTFFMKGRIMAGQADLSANVQNLKDFKWLAKEEIAKYVLPPYYAAIKNMLAER"
FT   gene            complement(418113..418684)
FT                   /locus_tag="ANIA_07283"
FT                   /old_locus_tag="AN7283.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(418113..418198,418274..418397,
FT                   418487..418684))
FT                   /locus_tag="ANIA_07283"
FT                   /old_locus_tag="AN7283.4"
FT                   /note="transcript_id=CADANIAT00000156"
FT   CDS             complement(join(418113..418198,418274..418397,
FT                   418487..418684))
FT                   /locus_tag="ANIA_07283"
FT                   /old_locus_tag="AN7283.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000156"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000156"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000156"
FT                   /db_xref="GOA:Q5AWP7"
FT                   /db_xref="InterPro:IPR019367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWP7"
FT                   /protein_id="CBF78701.1"
FT                   /translation="MVCSKCQKKLKATELATPGVKRKSEMYYGSPSTSLGGGGGGGSGS
FT                   GSGTSVANRTKATLGNTGVSKNKLLSAKAKNPYAAYSSSCDMCKAKTEQGRKYCQRCAY
FT                   QKNACPMCGKSLTGKSAKDQPVVQGQKFNLK"
FT   gap             419335..419434
FT                   /estimated_length=unknown
FT   misc_feature    419435..459726
FT                   /note="contig 1.126 481..40772(-1)"
FT   gene            419838..421699
FT                   /locus_tag="ANIA_07282"
FT                   /old_locus_tag="AN7282.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(419838..419846,419947..420029,420079..420617,
FT                   420741..421699)
FT                   /locus_tag="ANIA_07282"
FT                   /old_locus_tag="AN7282.4"
FT                   /note="transcript_id=CADANIAT00000157"
FT   CDS             join(419838..419846,419947..420029,420079..420617,
FT                   420741..421699)
FT                   /locus_tag="ANIA_07282"
FT                   /old_locus_tag="AN7282.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000157"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000157"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000157"
FT                   /db_xref="GOA:Q5AWP8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWP8"
FT                   /protein_id="CBF78703.1"
FT                   /translation="MPHFRKITGSVRQSAQNSEDELFKYTSGRWIYNEHLRLKERYLEF
FT                   SVPALKKAIAAAYGHSTSDIISFFKFSEGGFNRLFQATFNDGKQIIARIPYPSTGPEHY
FT                   AVASEVATMDYLRLHGITTPEVYCWCSTRANPVGAEYIIMEKLDGTPLGDVWFMLTPKE
FT                   QHRIMKQIVKWETRLMSLKFPASGSIYYRKDVLSGEVVPLPDNSHKFWLSSHDVFHAVG
FT                   ERELKWAQTYAKPRLPYERLYREIHNFCQVSPDSHIKNLSDNLTLARCLGFKSGSSLNR
FT                   PVIRHPDLQPNNILVSKTNKIIGLIDWQHSAILPHGIVAGIPKHFQNYGDSESEKLLEP
FT                   QINLPPNYDSLDLPEQIQVRETIRRRLVHFLYADFTKHLNEEHYDAIFNQSVILLQRLF
FT                   HSAGTPWEGDSTTLRADMIRAIQNWPNFITEDSLEHDKRICTKPPLEYPDTVIHDTIHV
FT                   DTQQRAADTVMEQTRNVLGVDILGWVPNDEYEAAKEMAREIKIKMLEAAETCGDITGIQ
FT                   NHFPFEDFDEKS"
FT   gene            422230..423166
FT                   /locus_tag="ANIA_07281"
FT                   /old_locus_tag="AN7281.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(422230..422238,422407..422427,422523..422707,
FT                   422952..423030,423096..423113,423164..423166)
FT                   /locus_tag="ANIA_07281"
FT                   /old_locus_tag="AN7281.4"
FT                   /note="transcript_id=CADANIAT00000158"
FT   CDS             join(422230..422238,422407..422427,422523..422707,
FT                   422952..423030,423096..423113,423164..423166)
FT                   /locus_tag="ANIA_07281"
FT                   /old_locus_tag="AN7281.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000158"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000158"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000158"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWP9"
FT                   /protein_id="CBF78705.1"
FT                   /translation="MEEVSPKMFILPGPPLAYLHWPTYTGLPTLADLRFAPGVLWRLGR
FT                   SGCIQIALRGLLIAFSSSKECYLISTLSLPTWSLELCFLLQIKEVSKLGRLRQFGPAFQ
FT                   "
FT   gene            complement(424179..430376)
FT                   /locus_tag="ANIA_07280"
FT                   /old_locus_tag="AN7280.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(424179..426148,426202..426707,
FT                   426788..427337,427706..427758,427807..430376))
FT                   /locus_tag="ANIA_07280"
FT                   /old_locus_tag="AN7280.4"
FT                   /note="transcript_id=CADANIAT00000159"
FT   CDS             complement(join(424179..426148,426202..426707,
FT                   426788..427337,427706..427758,427807..430376))
FT                   /locus_tag="ANIA_07280"
FT                   /old_locus_tag="AN7280.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000159"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000159"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000159"
FT                   /db_xref="GOA:Q5AWQ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ0"
FT                   /protein_id="CBF78706.1"
FT                   /translation="MAGITQERAREIITEIFNQSGGFLTDDEQQGVLANVLGAPVREAA
FT                   ARAWTSDTRFVYEMIQNAEDCSYNSAKSKNAIPSLKFYVFLDRIVVDSNEDGFEESHVR
FT                   AICSAGKRKKEGKLGEKGIGFKSVFKIASKARIQSGPFCFSLRHRDGENGLGMIAPVNE
FT                   IHEPLPDGVRTRFTLFSRPEKCREIQDELLRLPHTIIAFLSRLHMLSFYLSRSSTSLMF
FT                   SRPTIEPSLVCVETRHSTVMVHRYIPFRRKVAGLPPRESRPLIEDVEVVLAFPQDGRAL
FT                   TTQPFAHSYRPLRGAGLNFLIQSDFVTQDNGEDLVACPWNDHILDSLPGVFFAALQEIC
FT                   SIPEFEKIWPQFLPDDKIKDSPWSPFYERLLRDLKHIPVFKTRRGTLKSLEDVRYLLPE
FT                   HCDSNGEPLLEDLQEDIYLSSQYADYYGLLEPFGLQPISSRQLLDRLRPYLENPQPRLL
FT                   VDRFSETSIIMKRFHENWHSKVAGLLLSWLNCPQDDVVAKQIEHLQIVPVNKGCRSIVL
FT                   KSPKDSAIYFPHDTSGNLIPSGVVDVVPVPEVVDVARVRLYTRLGVKAAEPSFVIERIC
FT                   DWNMRAAERPSLEESICNLRYVYATAPSRSAINAKCIFLYDSDGKELEMPQYGASEWKR
FT                   AEDLYFKNNDGYGMDAVMQVLQRRCPPLVDLQYPKFLHPAYTAGSLSNDPWMKWLEGVG
FT                   SIRQAPRLETPGPAPRPSKLLRLVVRYAPDILISMLKDNWNVYAMELASVCPSTLSEIM
FT                   NASVPVDCGTEPLKRSFLGTHERRNLWSGTYLKDKFPFLKILSSRENDDLKDWEFLARF
FT                   GVGTTMAEFLVGSAKRLSMMPLSHARDGFFKLYELLADNYYDGFWDSPTPPAIVYLPQP
FT                   DSDDAWIPLTKNCVWSVFPFTNGQYAIRHLYPGLEDLFVDRLRVDVPDICSYIDKIQCM
FT                   MASDSSNSEILVVLKELSSLRPTALDLEPLKMIRFLPVRKGVNNIIYATVSYPFLIVDD
FT                   DRLQIDTHVPVLNFAPEDVCCLRQFFSALDLQERYVSNQLRETTVITGNADKSAELTHD
FT                   LRQRAQFLLRVSILPYGKVEEIFSQATVYTTENISRRFNLGDGLETGSYRGLSHLEKID
FT                   GNLQVFVPRDESQRAICYATALPRALVLYLGIDDRMACGTFATVLREPVDILDAVLNEM
FT                   GIIHLAMEQSKDLVIRTKNQAESEEIGFNLSPSLKDARPVRKSLSINLKASEAYIEEQD
FT                   SPSESLTTLTESYNTANEDHECISSNIILSYYGSEPQDRCLTITEAALKSAAEDTDTRQ
FT                   LALLLDHIGTQGQPVTVSQDVLEAAAANELCGQSMLSLLLEFSDSRGQIGKEIEMDAIL
FT                   KSAVRNEECGRKVTELLLHYMKLQKKKVTITGAILKAAAESSKSSNTPLSILLEHDHDP
FT                   VTEDIVVAAAMNEDSGYQIMSLLLDYDCDTWISPAIFEAAASNLHQGPQLMAVLLRQNG
FT                   ENIRITEDIIIAAAHNDVSGLEVLSLLKQHNGGYLPVTEAILVAAAESENCQETIDLFV
FT                   DIYSWDLPLTNDVLEAAARNPAFGKENLAQLLDHLAHPQITKEIMIAAISDSEKVNLLR
FT                   TVSYCDTFAIVEAAVGSLESCLQETLLYELCDELGDSIIDSALEAAAANPVNGFKAVSL
FT                   LLKFCSEDHKFSEGTFLAAARNPRSGEDILGLLLKRQPDIQITAELITAATTADNRTLE
FT                   QLIRHLIQKHPSTAISPLIQMTESFLEAVTGNWNCGEDVLRLLFETRTGNDGSIPITQA
FT                   ALINAASNVQCGFEVIVILLDHGGPNLKNLITEDVIIAAAGNSLWGLEILALLLDREYT
FT                   ISFSVDVFSAAERNIWCGEEILALLLEHQAFDAEDADADSSDDGDFCEDTEAAEPVNLY
FT                   DLDSDDDL"
FT   gene            431180..431579
FT                   /locus_tag="ANIA_11552"
FT                   /old_locus_tag="AN11552.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(431180..431226,431307..431369,431426..431479,
FT                   431549..431579)
FT                   /locus_tag="ANIA_11552"
FT                   /old_locus_tag="AN11552.4"
FT                   /note="transcript_id=CADANIAT00000160"
FT   CDS             join(431180..431226,431307..431369,431426..431479,
FT                   431549..431579)
FT                   /locus_tag="ANIA_11552"
FT                   /old_locus_tag="AN11552.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000160"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000160"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000160"
FT                   /db_xref="GOA:C8VCS8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCS8"
FT                   /protein_id="CBF78708.1"
FT                   /translation="MYGHTFVFEHSDLGTVPDYELSLFFDANPWLKPYEWMMSFKNMVS
FT                   KLSSESTASSREFYLRDWF"
FT   gene            435961..437297
FT                   /locus_tag="ANIA_07279"
FT                   /old_locus_tag="AN7279.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_1G01300)"
FT   mRNA            join(435961..436524,436645..436943,436997..437297)
FT                   /locus_tag="ANIA_07279"
FT                   /old_locus_tag="AN7279.4"
FT                   /note="transcript_id=CADANIAT00000161"
FT   CDS             join(435961..436524,436645..436943,436997..437297)
FT                   /locus_tag="ANIA_07279"
FT                   /old_locus_tag="AN7279.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_1G01300)"
FT                   /note="transcript_id=CADANIAT00000161"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000161"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000161"
FT                   /db_xref="GOA:Q5AWQ1"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ1"
FT                   /protein_id="CBF78710.1"
FT                   /translation="MKSKSLYALLNAALSAAAITHPGLLHTEDDFMRIQDFISSKTEPQ
FT                   LTGWNKLAAHADPDYTPSATETVCRGSSCDPENYPSLYRDIAAAYTNAVYWKVTGAEPN
FT                   ADATATILDAWSGTLNSIEGNSDRFLASGLYGYQLANAAEILRGYEKWDGLQGVVELLE
FT                   RIFLPMNVDFLQNHNDAVIDNYWANWDICNLASLHAIGVVSDNQTVIDQAITYFKEGQG
FT                   MGALNNAIWTIHEEEGSGKPLGQGQEAGRDQGHSLLDFGLLGVLAQQAYNQGEDLFALG
FT                   DNRILAGAEYAFKYNTGNDVPFTSYTNSHGTADVISASGRGGIRPIAELLYAHYNGVKG
FT                   LNASWTGAYRDLVVEDGGGAEGGSGDYGSNSGGYDQFGFGTALFRLD"
FT   gene            complement(438358..440151)
FT                   /locus_tag="ANIA_07278"
FT                   /old_locus_tag="AN7278.4"
FT                   /product="glutamate decarboxylase (Eurofung)"
FT   mRNA            complement(join(438358..438460,438533..439080,
FT                   439134..439796,439848..439875,439928..440151))
FT                   /locus_tag="ANIA_07278"
FT                   /old_locus_tag="AN7278.4"
FT                   /note="transcript_id=CADANIAT00000162"
FT   CDS             complement(join(438358..438460,438533..439080,
FT                   439134..439796,439848..439875,439928..440151))
FT                   /locus_tag="ANIA_07278"
FT                   /old_locus_tag="AN7278.4"
FT                   /product="glutamate decarboxylase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000162"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000162"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000162"
FT                   /db_xref="GOA:Q5AWQ2"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ2"
FT                   /protein_id="CBF78712.1"
FT                   /translation="MVTLSRVSQESSSHRQRREIRDISVQTTEYAGVYGTKYAAEELPL
FT                   YVMNDNGMPPDVAEQMIRDELSLDGNPLLNMASFVTTYMEPQVETLMAAAMRKNFIDFE
FT                   QYPQSARMQTRCVNMIADLFNAPTNQESKEGTEHGESEGAEGAMGTSTVGSSEAIMLAL
FT                   LAMKKTWHKKRSDAGKDTSHPNIIMNSAVQVCWEKAARYFDVEERYCYCTDDRYVIDPV
FT                   QAVELVDENTIGICAIMGTTYTGHYEDVKAINDLLVQRNIDCPIHVDAASGGFVAPFIC
FT                   PELVWDFRLEKVVSINVSGHKYGLVYPGVGWIFWRSPEYLPRELVFNINYLGSEQATFT
FT                   LNFSKGASHIIGQYYQLIRLGRNGYKAIMQNLVQVSQNLARGLSDLGLLILSDNTGNGS
FT                   GGVPLVAFRLPDDESRLFDEFAVSAVLRRRGWVVPAYTMAPRSNNLKLMRIVVREDFTA
FT                   HRCGILIQDIKMAIEWLEEMDETTIQRYTTYLAQHGTRLPNAHSFYKDEHSLHGKTGKT
FT                   HAVC"
FT   gene            441958..446821
FT                   /locus_tag="ANIA_10921"
FT                   /old_locus_tag="AN10921.4"
FT                   /product="NACHT and WD domain protein (AFU_orthologue;
FT                   AFUA_3G07460)"
FT   mRNA            join(441958..441960,442016..446821)
FT                   /locus_tag="ANIA_10921"
FT                   /old_locus_tag="AN10921.4"
FT                   /note="transcript_id=CADANIAT00000163"
FT   CDS             join(441958..441960,442016..446821)
FT                   /locus_tag="ANIA_10921"
FT                   /old_locus_tag="AN10921.4"
FT                   /product="NACHT and WD domain protein (AFU_orthologue;
FT                   AFUA_3G07460)"
FT                   /note="transcript_id=CADANIAT00000163"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000163"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000163"
FT                   /db_xref="GOA:C8VCT1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCT1"
FT                   /protein_id="CBF78714.1"
FT                   /translation="MFKQLSSRQARSPDTHSSISSQDPAWKKEIYNANEEVHESSTLSS
FT                   TQTRRTLSRHWLPFRSSSRRRSPSPETQSKFGLHVVHRPKTIAPVNIVFVHGLGGDRIL
FT                   TWCKHRDKRLYWPEKWLKQEQSIGRCRILSFGYDASFGMGAVKSIYRISDFAKSLLHDM
FT                   KFGQDSNGNPLGLGKVPTVFVAHSMGGLVVKAAYLLGQNDETYKEVVQSIGAIIFLATP
FT                   HRGADSAATLNNLLQASFSSSKSFIAELQRGSPALEDINEQFRHIAPKLLIASFYESLA
FT                   TRIGIHSTMIVIRDSATLGYQQEISRELHADHHEVCKYSSPQDANYTSVRNTLASFIAQ
FT                   LQAKGIEVINDLMAEESRKIEKLLLVTPKHEEEFETLRSWWLEGTCDWIFDVATVKNWL
FT                   KNEEEVEEVPIVQFKAPPASGKSVLSAYLVRELRSRGHSVLYFFFRAEDSDQRTVSFFL
FT                   RSTALQLASVSPVYKEKLLHIAIGGHSVMTSSSTDVFRKLFQFASSGVDFPYPLYWIVD
FT                   AVDESESAKTVLEYISRIRLVIPSLKVLFTSRESVIFPADQKIATFSASAEGKGSVGDN
FT                   SLDIRIYLERMMHEMGGKQELKDTVMQAILRRAQGNFLWVRLVVKEILSCHTEEGIETA
FT                   LQSMPKDMNQLYERMEWVVLSAPRAEDKEIAQMILRWVVCSRFPMTTEVLNQALNKKFI
FT                   DLRKTISQVCGQFVMVDPSGQVRLIHETAREYLTRTTASPIAIRLPKSHYSLFEQTLSA
FT                   LLAPDIRQKVIRAQESISVSEPFLLYAATSWMYHLQQSAEISDQTIDHLSQFFRTTSVL
FT                   VWIHLLSITDQLDRLVRAAKIVTDSIKAYRKSNMTKNPLLHKLSNLELLERWSADLLKI
FT                   VGKFSRQLKIYPAAIYSQIPPLCPSSSVIYEQFYQQDFANIKIMGISQTDWNDNLARIP
FT                   LPRGEEGIKLCCFGRYVAVLTSSGRVTIWDANHFKQVCSLVHQEAVTSMSFNRYGTEML
FT                   TFGLVTSRLWSVPSGELLATVVNPANTRALSVTFRETDRSVLVACTNRVIYSLDLEDLA
FT                   AGWRMLSRSLLHERSEVGGAIVNSPRCVSFNGDASQVGVSYRGFPLSVWDLNEMRCIAR
FT                   CRRPTRTPSKPESAEVTWFPVDRFTWNPVTGHIIGLYKDGTVFKWHPATNEYQEASSSA
FT                   DEVAASPDGSLFVTSSSNGTVKVWSFEYMSVIYQLSSGDLVRELAFAPDSRRFYDIRGS
FT                   LLNAWQSNTLLRFLEVDEAFSDTSSQDQRSTSISHISEAHTVSYEAVSVIRVSPEHGLY
FT                   CAGNEEGIVTLFDEKSEELGKILEFPNFVSISCLAWSNDSGYVAGADLAGDIEIRKLTK
FT                   VKTTGNGPSQVQSVPQSKPVLKKDGSAICDLLFSHDSTLLLIISGLSAYIWSVEEGCVI
FT                   IEKQIAQTSTQIWANHPAQPGTLLKFADNGITGFRWSDFSEIATALYDGLSLHSEATCP
FT                   KLKGVRFNQNGKFATIHQTDITCMERLFIVDISALQLKPGSTSSIARLSTIVPADVARQ
FT                   VEVVLGILPGSRFFFLDKNLWLCSVFLKSSVTEDTIERHYFLPRDWTTTEYFQQCLLLE
FT                   NGTLLCPREDEVAVIKSELSRSY"
FT   gene            447426..449191
FT                   /locus_tag="ANIA_10920"
FT                   /old_locus_tag="AN10920.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(447426..448965,449016..449191)
FT                   /locus_tag="ANIA_10920"
FT                   /old_locus_tag="AN10920.4"
FT                   /note="transcript_id=CADANIAT00000164"
FT   CDS             join(447426..448965,449016..449191)
FT                   /locus_tag="ANIA_10920"
FT                   /old_locus_tag="AN10920.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000164"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000164"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000164"
FT                   /db_xref="GOA:C8VCT2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCT2"
FT                   /protein_id="CBF78716.1"
FT                   /translation="MSSANPSTDMAPAANTPNNILEARETPVSATRPYTSFTSRSTMFI
FT                   VIIAGFATITSPLTATVYFPLLPTLEGQFRVSPQAINMTLTIYVIFQAISPAVFGPLSD
FT                   TVGRRPIFLLTLAIYALANLGMALNKHNYGFLLLLRALQSLGASAAFAISYGIVADVCV
FT                   SSERGKTMAWVSIALNMGTCLGPIIGGLVAYLSGDIEWVFWALFIVGLLLLLIVGMFLP
FT                   ETARNLVGNGGDQTEGTLWQQCCWSYIRTVRLLNKEENEQDHREYEAAVRAEPGTLNRL
FT                   ITRISAPFSIRMFAAPLRIIFFPDAFWCLWINGSFYAVDYILAATVPNIFTDIYQFNTL
FT                   LTGLAYLPRGIGIIVGSYCNGRMMDYNYKVTARKHNQPINRVSGDNIQQFPIELARSRG
FT                   TYYLLVISTCTLLAYGWTANYKKHFSVLLILQFIQGFWSTCFYTIYNTLLIDVFPDNPS
FT                   TAAASASITRCALAAIGVTTLQPFVDAAGLGWYFTALGLFSAVCGIVAVSFVRKYDVNA
FT                   VIDMVIAMKGNFQYHGEGQPAGSTVYSRNLVHVPISLVLFNKDRFALPSIAPDK"
FT   gene            complement(454751..455659)
FT                   /locus_tag="ANIA_07276"
FT                   /old_locus_tag="AN7276.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(454751..454878,455086..455659))
FT                   /locus_tag="ANIA_07276"
FT                   /old_locus_tag="AN7276.4"
FT                   /note="transcript_id=CADANIAT00000165"
FT   CDS             complement(join(454751..454878,455086..455659))
FT                   /locus_tag="ANIA_07276"
FT                   /old_locus_tag="AN7276.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000165"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000165"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ4"
FT                   /protein_id="CBF78717.1"
FT                   /translation="MEVDDSPPGGARPGTPLLGENSEPPSGPTTPTPLPRNSLKRRALF
FT                   SPQKTPTAAPVPVSHLPQAPSICEQVSMVADDQLVLLNDWKLAMTSLAKALDLTVSSLQ
FT                   GRPRDLARGLAARFVSLAKQDSPQLIPLMTAAAPPQPSRQIEQPNQPPTPEACEGPLKR
FT                   QTSQPTTWASLTAPRAGQGNWQTIAPEHCKVFLLSEKAASLAGDGYFEILTEYYQVIIP
FT                   WIPKQLWSLDR"
FT   gene            complement(456868..458379)
FT                   /locus_tag="ANIA_07275"
FT                   /old_locus_tag="AN7275.4"
FT                   /product="xylosidase/glycosyl hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G00930)"
FT   mRNA            complement(456868..458379)
FT                   /locus_tag="ANIA_07275"
FT                   /old_locus_tag="AN7275.4"
FT                   /note="transcript_id=CADANIAT00000166"
FT   CDS             complement(456868..458379)
FT                   /locus_tag="ANIA_07275"
FT                   /old_locus_tag="AN7275.4"
FT                   /product="xylosidase/glycosyl hydrolase, putative
FT                   (AFU_orthologue; AFUA_2G00930)"
FT                   /note="transcript_id=CADANIAT00000166"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000166"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000166"
FT                   /db_xref="GOA:Q5AWQ5"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ5"
FT                   /protein_id="CBF78719.1"
FT                   /translation="MALPAVADISNPIFWADFADIDIIRVNDTFYYSASNMHYSPGAPI
FT                   LRSYDLLNWEFAGHSIPELTFGPNYYLDDGQQAYIKGTWASTLQYRPSTSTFYWMGCID
FT                   GTTYIYTAPDVGGPWTKASTINTCYYDCGLLITSDDKMYVAYGNNGISVAELSEDGLGE
FT                   VSNQLVFPSDDAGYLEGSRFYERDGKFYIFTTHPANEEHVLMSNSGPLGPYERRLLISN
FT                   AGTPVDGGGYPHQGGIVDTPNGDWYYMAFVDVYPGGRIPVLAPIIWNSDGWPYVELVDG
FT                   AWSVTYDAPAINPPSTPVSSFEPYTDTFTVEKLSPQWEWNHNPDNAKWSIGEGVTLTTA
FT                   SLTNDLYAAKNTLTHRILGPKSTATIHLNISSMASGDRAGLALLRHHSAWIGVVNDGST
FT                   TRIAVTTGLEMDSEWNTVSTGTEVATAEYSNSEVWLRVEADISPGAGSGQFSFSGDGTT
FT                   FTDLGGSYTLNNNWEFFMGYRFGIFNHATTELGGSVVLKSFALSV"
FT   misc_feature    459727..491138
FT                   /note="contig 1.125 1312..32723(-1)"
FT   gene            complement(<459777..460982)
FT                   /locus_tag="ANIA_10919"
FT                   /old_locus_tag="AN10919.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(<459777..460343,460401..460982))
FT                   /locus_tag="ANIA_10919"
FT                   /old_locus_tag="AN10919.4"
FT                   /note="transcript_id=CADANIAT00000167"
FT   CDS             complement(join(<459777..460343,460401..460982))
FT                   /locus_tag="ANIA_10919"
FT                   /old_locus_tag="AN10919.4"
FT                   /product="hypothetical protein"
FT                   /note="submitted as non-partial"
FT                   /note="transcript_id=CADANIAT00000167"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000167"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000167"
FT                   /db_xref="GOA:C8VCT5"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCT5"
FT                   /protein_id="CBF78721.1"
FT                   /translation="MALGSVALSQSLLLLRLITCVGFARADNPIVQDIYTADPAPLVHD
FT                   GRVYVFTGHDEDSSTWYTMRDWRLFSSADMVNWQHHGSPMDLTTFSWADNDAWAGQVVA
FT                   RDDKFYFYAPVHHSTTGAMAIGVGISDSITGPYTDALGHPLVENGEIDPTVYIDDDGQA
FT                   YLYWGNPGLWYVELNEDMISYSGNISQVELTEGPWLYKREDIYYMIYAATCCSENIRYS
FT                   TGSSPTGPWTYRGIIMQSQGASFTNHPGIIDYEGRSYFFYHNGALPGGSGFTRSVAVEE
FT                   FTYNADGTIPELSMTTAGPAQIGTLDPYRRQEAETIAWSDGIEVEACSEGGFNVANIDN
FT                   GDYIKVAGVAFDEGASSFTARVASAGNGGNLELHLDSKDGPVV"
FT   gene            complement(464786..466391)
FT                   /locus_tag="ANIA_07274"
FT                   /old_locus_tag="AN7274.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_6G12070)"
FT   mRNA            complement(join(464786..465032,465110..465480,
FT                   465555..466391))
FT                   /locus_tag="ANIA_07274"
FT                   /old_locus_tag="AN7274.4"
FT                   /note="transcript_id=CADANIAT00000168"
FT   CDS             complement(join(464786..465032,465110..465480,
FT                   465555..466391))
FT                   /locus_tag="ANIA_07274"
FT                   /old_locus_tag="AN7274.4"
FT                   /product="FAD binding domain protein (AFU_orthologue;
FT                   AFUA_6G12070)"
FT                   /note="transcript_id=CADANIAT00000168"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000168"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000168"
FT                   /db_xref="GOA:C8VCT6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCT6"
FT                   /protein_id="CBF78723.1"
FT                   /translation="MRHSVYSWLTLSAMRGTISPVEALNLTALYGSGLSDSAQILDASE
FT                   PGFMNITPRWTQYRPPIYYGAIVPATEADIQHIVRTSVEHDIPFLATGGGHGLTTTLGQ
FT                   FSGITIELTRFNTVKLNKETGQITLGGGTRYSDIYEPMFNTGKMMGLGNTPCIGAVGAT
FT                   LGGGTGIGQGIYGLGLDALLSVRLITATGDIVVASRTENQDLFWAIRGAGASFGIVISA
FT                   TFQLHDAVNGGIVALTMFTYSPEQNRSVWEALQSYDENIPDELSFNLAAVVNATTREAF
FT                   IVAESEYHGPPAEAERFLQPFIDIGPTSVQSTTLPWTQIYDTVHSTNQRLCTPGQYLNE
FT                   YTIALKRTDVDAFTAYYNELYALWVREERYEGDWIIARSPIRVMRLVSDEETVFPHRHA
FT                   ITHLLFGNYYSSPSLDSTINAWMRNVRARFQATSGYDRLHAYTNFAQGDEGPGAWYGSA
FT                   NLKQLRALKSKWDPDGAFNNFNPVLP"
FT   gene            470357..471136
FT                   /locus_tag="ANIA_07273"
FT                   /old_locus_tag="AN7273.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            470357..471136
FT                   /locus_tag="ANIA_07273"
FT                   /old_locus_tag="AN7273.4"
FT                   /note="transcript_id=CADANIAT00000169"
FT   CDS             470357..471136
FT                   /locus_tag="ANIA_07273"
FT                   /old_locus_tag="AN7273.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000169"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000169"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000169"
FT                   /db_xref="GOA:Q5AWQ7"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ7"
FT                   /protein_id="CBF78725.1"
FT                   /translation="MPPSGSSFTALNLPADFTLPQCMEYFTLRAGPNTDLWRKPPNGDT
FT                   STAPIVFTSLRNPFLVAEVTVTADFEMEWDQGGLVIFAGGAPQSISSGTAPLARTRRFG
FT                   GASPNPQPCKWVKAGMEFASGTVNVSSVSATADGADWSLAPLSAADRGPSAIHSVRLKL
FT                   ERVGHSLWVWYQVPSVSPYAMTPGQVAETWKKMREVTWFFYGVEDKFIYVGVYASRPAN
FT                   IQRSSTVWGRTHRTGSSSSAPATGDYLVVEFEDLEIL"
FT   gene            473393..475994
FT                   /locus_tag="ANIA_07272"
FT                   /old_locus_tag="AN7272.4"
FT                   /product="ABC transporter, putative (Eurofung)"
FT   mRNA            join(473393..473476,473527..473793,473975..474230,
FT                   474360..474420,474532..474603,474761..474825,
FT                   474881..475224,475338..475507,475613..475994)
FT                   /locus_tag="ANIA_07272"
FT                   /old_locus_tag="AN7272.4"
FT                   /note="transcript_id=CADANIAT00000170"
FT   CDS             join(473393..473476,473527..473793,473975..474230,
FT                   474360..474420,474532..474603,474761..474825,
FT                   474881..475224,475338..475507,475613..475994)
FT                   /locus_tag="ANIA_07272"
FT                   /old_locus_tag="AN7272.4"
FT                   /product="ABC transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000170"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000170"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000170"
FT                   /db_xref="GOA:Q5AWQ8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ8"
FT                   /protein_id="CBF78726.1"
FT                   /translation="MGGFRPASRVARLSYDATTKVLSADGVQPRAQSSRLTDTSRRPRR
FT                   QRRPDNQLVFRLDPRIFSTPTEEKILCDQTEKEKRTLQSGPLGLVSPQGIFSEYEATVA
FT                   TAEPGCSSAATAKVQNVERKFPIRPIIEVSKCCSEPVEIKQESKIEAQFADNDSTTGIK
FT                   QQGPGPGSVYRYYIRSAGSSLVVSFLAFTLIEAFCNSFQALWLQWWVKANEEYPNKQLE
FT                   MLLFVRGLNNISLKLHSDLLKTALEFGQDLELIDMMLPIYAVNCITNIMEVSINTLIIC
FT                   IIGKYLAVTIPFLGLVLFFIQSYYLQTSRQVRLLDIEAKAPLYTHFLETIRGISSIQSF
FT                   KWEPHLREKNYALLNRSQRPFYMMYSVQQWLTLVLDLVVGAVAMWTMTEISIGAVTRVL
FT                   RFTQDTPSEKEQCMSIVQSGLPHDWPDRGAIEITGLTAGYEEDRPLRSVREWENLLGYG
FT                   DTTNAKRPGRTHTDGRMQHRSISKSTLRSRINVVLQDPFFMDGTTLRVNLDPHQSVAGD
FT                   ADIIKALGKVHLWDQIRAKGGLEAEFASTDWSVGQKQLLCLARAMVEPS"
FT   gene            complement(476191..477474)
FT                   /locus_tag="ANIA_07271"
FT                   /old_locus_tag="AN7271.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(476191..476690,476766..477474))
FT                   /locus_tag="ANIA_07271"
FT                   /old_locus_tag="AN7271.4"
FT                   /note="transcript_id=CADANIAT00000171"
FT   CDS             complement(join(476191..476690,476766..477474))
FT                   /locus_tag="ANIA_07271"
FT                   /old_locus_tag="AN7271.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000171"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000171"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000171"
FT                   /db_xref="GOA:Q5AWQ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWQ9"
FT                   /protein_id="CBF78728.1"
FT                   /translation="MYNAVHPQEAPQQMPQIRAMGSVASPILLPISATGPVPLSLTLAS
FT                   DNLSPNASSAFSMIPISMDVEEGAPQPEFRDIQPWDLKHPVAVYANRDGKQLPVFYDAA
FT                   TQEYYLFTIEGAVLLHKTPTITIKKRQARQVLGRISYSQIRRITETELAESIMKGIDLP
FT                   LSSSPLVDSVSLLRNAMHDSIIVTRNSRPTTFFRFWEDKDVRDSGTLGSDSLLMYLRPS
FT                   MDGLVGHRCDALWHCGNNVIYCSKCTSYRLPSTCPTSGDADKADNTLTFGPPIPVGRVT
FT                   VGVHITRKIFDGCLRPDKKGLNIPHAYQTLSKIFHKPTIDSIPIPQTYMVSNLLKDSLF
FT                   VVADMFPKTAAESWADYFDVGGEHAQQGMSGMTNAAVGVTAGSAIIGTGAMVGLRIAEV
FT                   VGV"
FT   gene            complement(478694..479507)
FT                   /locus_tag="ANIA_07270"
FT                   /old_locus_tag="AN7270.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(478694..478950,479015..479097,
FT                   479149..479507))
FT                   /locus_tag="ANIA_07270"
FT                   /old_locus_tag="AN7270.4"
FT                   /note="transcript_id=CADANIAT00000172"
FT   CDS             complement(join(478694..478950,479015..479097,
FT                   479149..479507))
FT                   /locus_tag="ANIA_07270"
FT                   /old_locus_tag="AN7270.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000172"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000172"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000172"
FT                   /db_xref="GOA:Q5AWR0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR0"
FT                   /protein_id="CBF78730.1"
FT                   /translation="MLAVIGLGLTKASILILIRGIFSVSRPFRHLCNAMLFVVAAWTIS
FT                   FFFSNLFTCFPVTPLVEPFYGNKCINGLAMWYAGCISDVVVDLIILVIPLPMISQLKLP
FT                   LRQKVAIGAIFLLGTTVVVISITRMAMYFHVGTTFREHYNDMTYYTSPVFFWTNIEISL
FT                   AVILACLPTLRPVWTVLSGGRARKSSTYRPYDEIEPENSERMRRVKPTLDTIDRLESSI
FT                   ALVKVPAGPR"
FT   gene            480568..482282
FT                   /locus_tag="ANIA_07269"
FT                   /old_locus_tag="AN7269.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(480568..480833,480918..481725,481792..482011,
FT                   482058..482282)
FT                   /locus_tag="ANIA_07269"
FT                   /old_locus_tag="AN7269.4"
FT                   /note="transcript_id=CADANIAT00000173"
FT   CDS             join(480579..480833,480918..481725,481792..482011,
FT                   482058..482199)
FT                   /locus_tag="ANIA_07269"
FT                   /old_locus_tag="AN7269.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000173"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000173"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000173"
FT                   /db_xref="GOA:C8VCU1"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCU1"
FT                   /protein_id="CBF78732.1"
FT                   /translation="MALFLTGYLLLTFTLTLSFSTLRVWAAGRWPDVVAQELGPQLSSL
FT                   ASIITEPGAVESDFERWSAYSAPQPGVVVSVATEEDVAKTVKFCVSNSIRFLAQNGGHG
FT                   WADTFDLGPNRRGLLIDITQLNTVVFNANRTQVTLGGGVSIGEAVAAAVEHDTLIPTGN
FT                   CNCVGTLGAILGGGYGNLLGMVGFGVDNVLELKVVLADGEVHTVTPGRQGKDHDLFWAL
FT                   RGAGPNYGIVTSATLKAYPVDSATNITAWMGQLVFSGEQVEAVVQAIEELTLTPEMNIF
FT                   LYYMTVNGTQRFIATPFYYGDEGEARGRAAFASLLDIGPIEDQTAEVPYARWNDGSDGF
FT                   CTSGGYKPAYSAALQTQNSVVIMEAYSLDRARALPDDSAAFPGRSRVNFQAVAIPWYYD
FT                   QGLENSAIAWGETMRALWWETDGLDDPAVYVNFAHGDENLTTIYGENVGQLRAIKARVD
FT                   PENVFNQWFNLGTGRP"
FT   gene            complement(482243..483024)
FT                   /locus_tag="ANIA_07268"
FT                   /old_locus_tag="AN7268.4"
FT                   /product="short chain dehydrogenase/reductase, putative
FT                   (AFU_orthologue; AFUA_7G00840)"
FT   mRNA            complement(join(482243..482949,482994..483024))
FT                   /locus_tag="ANIA_07268"
FT                   /old_locus_tag="AN7268.4"
FT                   /note="transcript_id=CADANIAT00000174"
FT   CDS             complement(join(482243..482949,482994..483024))
FT                   /locus_tag="ANIA_07268"
FT                   /old_locus_tag="AN7268.4"
FT                   /product="short chain dehydrogenase/reductase, putative
FT                   (AFU_orthologue; AFUA_7G00840)"
FT                   /note="transcript_id=CADANIAT00000174"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000174"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000174"
FT                   /db_xref="GOA:Q5AWR2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR2"
FT                   /protein_id="CBF78734.1"
FT                   /translation="MSSQTIVLISGANRGLGFEAAKCLVHLANYHIILGSRDLLKADKA
FT                   ADTLHALPNLKCSVSTVQLDVTDKSSITAAKSYIEATFSRLDILVNNAAIYLLNPTSSV
FT                   DALRASLDTNVIGVVALTEELLPLLRKSASPRLILVSSSNGSLEYNSDPSSPHGGTWAM
FT                   EYRVTKAALNMLLVQYHASLKEITVLGVDPGFSATEVIGDADALRKMGAAEPEVGGEII
FT                   ASVVRGEKGQPGRIYGPQGIVPW"
FT   gene            483229..484878
FT                   /locus_tag="ANIA_07267"
FT                   /old_locus_tag="AN7267.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            483229..484878
FT                   /locus_tag="ANIA_07267"
FT                   /old_locus_tag="AN7267.4"
FT                   /note="transcript_id=CADANIAT00000175"
FT   CDS             483229..484878
FT                   /locus_tag="ANIA_07267"
FT                   /old_locus_tag="AN7267.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000175"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000175"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000175"
FT                   /db_xref="GOA:Q5AWR3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR3"
FT                   /protein_id="CBF78736.1"
FT                   /translation="MTIPEFDYIIVGGGLTGCVVASRLKQHDPSLNVLLLEAGVDPSNN
FT                   PNVKTYPPLFSLLGSDIDWKYSTTPQPNTGNRIHSVHAGKALGGGTTINFGGWSRGDSA
FT                   DYDLWARTVRDQRWGYQGLLPYFRRSESFFDRTADVQEHGFEGPVRVCAVSASDPNRQY
FT                   PMRGPVRDAWIEIGEQYNPAPGTGRLSGVVEFLETWQGGERQAAHQAYSLDGLQCITGA
FT                   RAHKVEVSGPGNIVSGVLLADGRRFTARKEVILAAGALRTPQLLMLSGIGPGDTLAKHG
FT                   ISSVVEAPEVGRNLIDHFALYQLYKLREPERGIALGSSKLSHPALTQGFPVDWAVNQRV
FT                   PRDVLDPAVQKDKERFGSSTDESVLIPGRPLVETLILYAPIGMPTDGSLLMTSVMLLSA
FT                   TSRGTVSISSASPSDPPLVDSNYYDTETDRAVLTYGSRRTAKALLETSALKNYVECEVP
FT                   PPDMPALTSQSSDEEFDARIRATGMAHHHPAGTAAMGKVVDTELRVIGVRNLRVVDASI
FT                   LPVSIGGHPQATLYAVAEQAADLILQADVEKA"
FT   gene            complement(485020..485509)
FT                   /locus_tag="ANIA_07266"
FT                   /old_locus_tag="AN7266.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(485020..485290,485346..485509))
FT                   /locus_tag="ANIA_07266"
FT                   /old_locus_tag="AN7266.4"
FT                   /note="transcript_id=CADANIAT00000176"
FT   CDS             complement(join(485196..485290,485346..485436))
FT                   /locus_tag="ANIA_07266"
FT                   /old_locus_tag="AN7266.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000176"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000176"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000176"
FT                   /db_xref="GOA:C8VCU4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCU4"
FT                   /protein_id="CBF78737.1"
FT                   /translation="MRISASISLSLAMLLSLFAIATGLPTKLEPETDASVVRTPQVQRD
FT                   EGIQDADDYVRNSWSE"
FT   gene            complement(486860..487759)
FT                   /locus_tag="ANIA_07265"
FT                   /old_locus_tag="AN7265.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(486860..487141,487218..487336,
FT                   487395..487520,487576..487759))
FT                   /locus_tag="ANIA_07265"
FT                   /old_locus_tag="AN7265.4"
FT                   /note="transcript_id=CADANIAT00000177"
FT   CDS             complement(join(486860..487141,487218..487336,
FT                   487395..487520,487576..487759))
FT                   /locus_tag="ANIA_07265"
FT                   /old_locus_tag="AN7265.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000177"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000177"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000177"
FT                   /db_xref="GOA:Q5AWR5"
FT                   /db_xref="InterPro:IPR021765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR5"
FT                   /protein_id="CBF78739.1"
FT                   /translation="MLGNRREKGYSLLPLTGGQPERLPYHYVAYFLLTASNILFLGLWL
FT                   FSGHMSSDCIRPQISYSPAKDDGAIAYVKKRLMRDIEHNPFTGEPRPELDAAWRHILEP
FT                   MTTKISAEELAHLPDTSIPFADGSGYIAELAVYHELHCVKRVRRYLHLSHYMPNITADE
FT                   LVRENTHIDHCLEYWREAAMCRGDTTLATFRWKDGLPYSRVYSDHECVDWEALDDWARG
FT                   RMVDMSDYSILKQN"
FT   gene            488044..489230
FT                   /locus_tag="ANIA_07264"
FT                   /old_locus_tag="AN7264.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            488044..489230
FT                   /locus_tag="ANIA_07264"
FT                   /old_locus_tag="AN7264.4"
FT                   /note="transcript_id=CADANIAT00000178"
FT   CDS             488044..489117
FT                   /locus_tag="ANIA_07264"
FT                   /old_locus_tag="AN7264.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000178"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000178"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000178"
FT                   /db_xref="GOA:Q5AWR6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR6"
FT                   /protein_id="CBF78741.1"
FT                   /translation="MRVRSHCPQRVPFISHHLSRHFRTTGLSDLKNIWKLTQQDHSNYW
FT                   TGYLSTRPKYTDSFYDLIYNHHATHSRNRGSFKSLSVAHDVGAGPGHVAAKLAARFSHV
FT                   VVSDNNASHLEYAKRFLSRSGIPQSSFSYVSSRAEDLLLKDPGKAGSADLVACALTFPL
FT                   LDTLPALQSFHTLLKTGGTLAIWFYGRAHFAEPEYALTCQPLLDEIIDHHYAGVIQGHG
FT                   HEHLAQWKCVAERIACGLDYIPFSETEWANVTRYKWNTSWAGLAFFTERACGCPLDAPP
FT                   SEIKQGEIVIEQEDRKMWEMSWNISQLREFVKYIFPFERMDDEPVRPLWARLEREVGSG
FT                   QQRLFSWPAVLILATKK"
FT   misc_feature    491139..546293
FT                   /note="contig 1.124 531..55685(-1)"
FT   gene            494098..495188
FT                   /locus_tag="ANIA_07263"
FT                   /old_locus_tag="AN7263.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(494098..494898,495096..495188)
FT                   /locus_tag="ANIA_07263"
FT                   /old_locus_tag="AN7263.4"
FT                   /note="transcript_id=CADANIAT00000179"
FT   CDS             join(494098..494898,495096..495188)
FT                   /locus_tag="ANIA_07263"
FT                   /old_locus_tag="AN7263.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000179"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000179"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000179"
FT                   /db_xref="GOA:Q5AWR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR7"
FT                   /protein_id="CBF78743.1"
FT                   /translation="MAPQTILGHSFFSPKDVHLASLVPNIKDIDLDALESVIPLQDADF
FT                   TIKEIDDFTSVFGSQIDNNFQALLSRIVSWTIKRTDEAKVTLTARKGRVYTLRKPSSWF
FT                   RSLCEEPQVRTWLQEQIEDGNHDGVYFVVGLHTLFDAAISGGLALASDFGGGIAVSAPA
FT                   MPAGTDNIAPLQDPGQLALSAGLERSRNTSHSCTAPGEQIFALRLKNVILRTWSTQDVA
FT                   NVRLEQHSHWIMASDNRGSDDDSSELLEAFLEGDSEGDDDIKEDSALDDPHDCQGQVIK
FT                   TPIRAIVTRTKHFSSN"
FT   gene            497993..502803
FT                   /locus_tag="ANIA_07262"
FT                   /old_locus_tag="AN7262.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(497993..498053,498086..502803)
FT                   /locus_tag="ANIA_07262"
FT                   /old_locus_tag="AN7262.4"
FT                   /note="transcript_id=CADANIAT00000180"
FT   CDS             join(497993..498053,498086..502803)
FT                   /locus_tag="ANIA_07262"
FT                   /old_locus_tag="AN7262.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000180"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000180"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000180"
FT                   /db_xref="GOA:Q5AWR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR8"
FT                   /protein_id="CBF78745.1"
FT                   /translation="MAAQVGETVAVPIADEQLKDGVIANKSWEPGTTSSVTPATSADEA
FT                   VEQVAEKAKELAKDIGAVPAEDKNDAPVQNGTHTDEDKERGAEQNPGVDEKPEPALELL
FT                   SRPDGPEAEPAVAVSEKPESNGVTPEQAPVAEPTSTQVKSDTPAVEEKSKPVPEPLDRP
FT                   DVAADEKSSVAEPATTEVAPQAPVVDAPTVEGSTKAEAAEEKVNESAEESPAESKSTET
FT                   PAATEPVQEATSAPPADEAEANLKAETPEETEKEPVAETAAAADEPSVEESKPAEPEPT
FT                   PEAAGPAAQPVVEAEPEQQESSAEKSAESTTEETKAAAESVKEHTPETPAAEPTPEAEN
FT                   KPAESEAVKEPVTEQQAAESTEMTSTGSAGEAKTEEPTVEAKPADEEPLKESKAEEVTT
FT                   ETPAVDAVEEAPKATEEQPSTEGAAEQLTQEAAVEKSASETPFPEAVAAEEPAKEAVTE
FT                   EPKAEETAAPTDSTEAQKEAAEEPVKEAVTEEPKAEETAAPTEPIEAQKEAAEEPVTEA
FT                   STEEPKAEEAAEEPVKEAVTEEPKAEETAAPTEPIEAQKEAAEEPVTEASTEEPKAEEA
FT                   AEEPVKEAVAEDPEAEETAAPAEPIEAQKEAAEESKVEEPAVAPEADEPVREAAGDLKG
FT                   EEVATATDAVKSVETTTVEPAVEAEAATEKAKVEESTTVDEVAETEVAETAKEVASEEP
FT                   KTEEPVAVAEAVDEPAKEVANTEPSEAAVPENPAPTEEPEKGATNEEPKPAEAVAEPMT
FT                   EPANVAVETEESKEATEAAAESAAEPAVAETAVENVSEAPAAEKEAVSEEPKAEEPIAT
FT                   AESPEVPGKETVVEESAPDSVTESKDAPAEVAAEASITEVPAVLKSSEEQADKAVAEAP
FT                   ADTTPTAKPVESATQEPATETADAPSATEPATTESPKEPASEAPTEVPTVETVATEEVT
FT                   EAAHDKPAEEQPETVDGASGKTVDAEVPGETQSTTTAEAIAAAPIEKFATEETVSKIPV
FT                   EGVSKEETTVGEPGTEKPDEAAAPEVSEVEVAEESKAPETTPAEIAPAESTNATPEASK
FT                   AEYAPAETAEEEPPVEKQLPDETAAPASVEEQPAGESSTTDAVNTTELTSADAASEPVP
FT                   EAATDDTTATAPVVTAEPAAEAATSAPEEQKEEAAAQEPDSKPVDKDSTAVEATPAETL
FT                   KEEPVTESVTENAAEADKVEPEVVEPSKDASPVEVIEEPVAEAATETTVAEENTPATTE
FT                   NEPASIKEEVTEPAEPVIDEAAVEEPVAEKPAANAPAIEAGASTVPQETSEEFEAPSKP
FT                   AAPLDEAAIVEAPAVASEEQKLDEVSASEIRPETSQQAPEETTPVPEKEPTAPEPAESK
FT                   VEVKDAEVHPVESVATTEETTAETPNTSVAGASQEVPAQVEEEKVFKDEDSFPTSEVIA
FT                   GGAAAAAAAAVVAGAAAVAHKEEPAAAPVKESEVRPSQPETDRDAATLPAQRQPSVTDE
FT                   QPEADPALAALAGDGEALLKKLEQPSTEQLPVHTENAPKAPENANQENETQTATESGPS
FT                   ATLQPPSTTEETADDAAASKGDDSRSPSQNRSVTAVSLNHKNDSWLKNILRAVFVNFIG
FT                   SIFAPFRRRGRAN"
FT   gene            503753..506802
FT                   /locus_tag="ANIA_07261"
FT                   /old_locus_tag="AN7261.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(503753..503845,503878..506802)
FT                   /locus_tag="ANIA_07261"
FT                   /old_locus_tag="AN7261.4"
FT                   /note="transcript_id=CADANIAT00000181"
FT   CDS             join(503753..503845,503878..506802)
FT                   /locus_tag="ANIA_07261"
FT                   /old_locus_tag="AN7261.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000181"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000181"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000181"
FT                   /db_xref="GOA:Q5AWR9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWR9"
FT                   /protein_id="CBF78747.1"
FT                   /translation="MSPVEHNAWAQMKAREREQRLSDSDRGKYSLLHKTKVNSGQVPTR
FT                   KPSTITKPSGLDNNAELALLKPEPHPASPKEMPTADKPGVTSKPNVTKKRSTTEPSMPS
FT                   DRSSGSTDKKKKSKVATLRSKFSLKDLAKEYRKDIPPMSSMPKLGGSSGSGTQHTSSDS
FT                   EEQSKFTHTFSEAKLYVPKTRTGDMVPNSAPPHTSEFRDSASTDKQSILSCRSVQIPPT
FT                   KGNDDGKTEAKFKHSLVHNTGVGQGTPNARLETMLLDGSSPPARTGEYKNTGQPELIRV
FT                   HDRVMSLKAGKNETVMPSSPRTPPPISVRSDAAAYSPSVYDTAKEVGWKAAKSSLPEVK
FT                   DIKPKHPFIVSSSDFKEKAREEQDEDHMFLDPREPPLPPLPLKSRDRAVRSNPVDSNAI
FT                   NEAQYLTGVTSHGGYAPPPPHPGYQNTVTLDQQLASHVDSLHYHLDTTVNRLARTFENG
FT                   NNWSADQILKQVDSVFDLARMINTRSATQADIMKNLSQISMEARNQAYLARQETSLVEE
FT                   RMKSFVQQEVAKLKNELSDLILSSHDNPKAQVQGQDSRADTSHTGDQEGPKLTIGKRNQ
FT                   HQNKNKSRLVTAKRDALTKPTDNRNGIAESQEGKLDSVRQAEPRTDKEPTPQNNQNISD
FT                   DVPTPTAAYRTPKPRIDDVASPVPVKREVRENPGEESSGSPKGKAGKLRISGPMPISES
FT                   PSASGDGQRENSDTNRPSSPQRESESKPRRVSSSDNLKTPKKKGSVFSFRRKCDGDNQS
FT                   GSRFLRTPRRTKETKSVSSQESQSPRFAISTPTKTRAAPAPLDSITSTTSSNATANALE
FT                   GGQIQRQESPSMIHPALRNSQQRQVMAERERLAQLNRHPRESTQIQAQGQSNPHNTSHP
FT                   LQNLGNRDSPSTSTSPPPSFVSFDGPNPYASAVSVATSSSASFHDVRQYQSSMHYPQLP
FT                   SSLSLPSQGHGLGVGQPQFFAPPPGFSPTLSGENNGISHGHGHSNVSDQLDGVSIDWFR
FT                   NMNMPMATNYPDSDFF"
FT   gene            complement(507476..509536)
FT                   /locus_tag="ANIA_07260"
FT                   /old_locus_tag="AN7260.4"
FT                   /product="nuclear export protein Noc3 (AFU_orthologue;
FT                   AFUA_2G17050)"
FT   mRNA            complement(507476..509536)
FT                   /locus_tag="ANIA_07260"
FT                   /old_locus_tag="AN7260.4"
FT                   /note="transcript_id=CADANIAT00000182"
FT   CDS             complement(507476..509536)
FT                   /locus_tag="ANIA_07260"
FT                   /old_locus_tag="AN7260.4"
FT                   /product="nuclear export protein Noc3 (AFU_orthologue;
FT                   AFUA_2G17050)"
FT                   /note="transcript_id=CADANIAT00000182"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000182"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000182"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWS0"
FT                   /protein_id="CBF78749.1"
FT                   /translation="MAPGRTTKRRRVSPPDEEENVSNRKGDFYSHAAEWDLEQDYEQRP
FT                   RKLNKKEKERTRLPIKTAEGFQNVEASESEPEDDDSFLATDDDDMDEDGDAEVDETEES
FT                   EEEAPKIPLKQQIIQAKEEIARTATLINEDPEEHISSFKSLAEMVDGGSHVAVKKLALA
FT                   AQAAIYKDVIPGYRIRPLSEEEASAKVSKDVRKLRNYEQSLLSGYKHYIQKLLAFTKPS
FT                   KERAGTDNGMKTVAINCACNLILSVPHFNFRAELLRILVNQLARKRVDDDFVKCRDTLQ
FT                   EVFARDDDGIVSLEAVRLLSKMMKARDFKIHGSVLDTFLHLRLLREFSSKGSRDRVDRD
FT                   NEEETSGGKKMKQKKEWRTKRNRKLEKERKAVEKDMKEADALVSHEARDKNQAETLKLV
FT                   FGIYFRILKLRVPNLMGPVLEGLAKYAHMINQDFFGDLLEALKDLIGHAEDDELNEVDD
FT                   NEDDEHINSASSTTRDSTRESLLCTVTAFALLEGQDASKAAAALHLDLSFFIKHLYRSL
FT                   YTLSTNPDVEFNPNASNALRLPDPSSSQQQQQNAQDRKKKVNFQTPIVLLLRCLNASLI
FT                   SRANGLPPPVRLASFAKRLMTTTLQVPEKSALATLALLNQVAKHNARRISSLWYSEERK
FT                   GDGLFNPYATDFEATNVFAGTIWEGELLKLHYCPDVREAAAGVEKMIATRD"
FT   gene            510074..511678
FT                   /locus_tag="ANIA_07259"
FT                   /old_locus_tag="AN7259.4"
FT                   /product="Defective in cullin neddylation protein 1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AWS1]"
FT   mRNA            join(510074..510157,510275..510318,510434..510479,
FT                   510722..510869,511022..511196,511249..511678)
FT                   /locus_tag="ANIA_07259"
FT                   /old_locus_tag="AN7259.4"
FT                   /note="transcript_id=CADANIAT00000183"
FT   CDS             join(510074..510157,510275..510318,510434..510479,
FT                   510722..510869,511022..511196,511249..511678)
FT                   /locus_tag="ANIA_07259"
FT                   /old_locus_tag="AN7259.4"
FT                   /product="Defective in cullin neddylation protein 1
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AWS1]"
FT                   /note="transcript_id=CADANIAT00000183"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000183"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000183"
FT                   /db_xref="GOA:Q5AWS1"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWS1"
FT                   /protein_id="CBF78750.1"
FT                   /translation="MPPYTAAQKQQITQFVSFTQANNTTAAKFLRQSRWNTEEAIDAFK
FT                   NRIAPASMGLIFRPCATAGVREAVLRISIFQKLIPGLPAGNDALADWVLYLYGFTFLLK
FT                   EFRDSPEENPDTIGIEGAMRYLGDIEVELDEVTCLAIAELLQSPSMGEFTREGFLNGWR
FT                   SVQCDSIAKMAAHAANLRTRIPSEPDLFRRVYRYTFPLCLVQGQRNLQFEIAVEQWNLF
FT                   FTTPKGGIAWNTTTTPWLDWWVEFLEERGKKPVNKDLWQQVEVFMRKTHEDEAFGWWSE
FT                   DGAWPGTLDDFVAWVRKKRGDEGAMEE"
FT   gene            complement(511918..513587)
FT                   /locus_tag="ANIA_07258"
FT                   /old_locus_tag="AN7258.4"
FT                   /product="hypothetical protein similar to 25D9-6 (Broad)"
FT   mRNA            complement(join(511918..512310,512362..512628,
FT                   512690..512965,513030..513209,513441..513587))
FT                   /locus_tag="ANIA_07258"
FT                   /old_locus_tag="AN7258.4"
FT                   /note="transcript_id=CADANIAT00000184"
FT   CDS             complement(join(512242..512310,512362..512628,
FT                   512690..512965,513030..513176))
FT                   /locus_tag="ANIA_07258"
FT                   /old_locus_tag="AN7258.4"
FT                   /product="hypothetical protein similar to 25D9-6 (Broad)"
FT                   /note="transcript_id=CADANIAT00000184"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000184"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000184"
FT                   /db_xref="GOA:C8VCV2"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCV2"
FT                   /protein_id="CBF78752.1"
FT                   /translation="MSVKFKDVQNAATAAASAADTSIRADTKELAHKVGERLTGGNPQT
FT                   GYLALYLRQLQSNPLRTKMLTSGVLSSAQEFLASYLANDVSKHGHYFSSRVPKMLLYGM
FT                   FISAPLGHVLVGILQKVFAGRTSLKAKVLQILASNLIVSPIQNVVYLTCMAIIAGARTL
FT                   HQVRATIKAGFFPVMKVSWITSPLALAFAQKFLPEHTWVPFFNIVGFFIGTYVNTHTKR
FT                   KRLEALRKRYDSRRGGPGSEYEKGPGPDYR"
FT   gene            514153..515103
FT                   /locus_tag="ANIA_07257"
FT                   /old_locus_tag="AN7257.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            514153..515103
FT                   /locus_tag="ANIA_07257"
FT                   /old_locus_tag="AN7257.4"
FT                   /note="transcript_id=CADANIAT00000185"
FT   CDS             514153..515103
FT                   /locus_tag="ANIA_07257"
FT                   /old_locus_tag="AN7257.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000185"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000185"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000185"
FT                   /db_xref="GOA:Q5AWS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWS3"
FT                   /protein_id="CBF78754.1"
FT                   /translation="MDGEEVGSYPVLIGVSPDTDPDPDMASFQHVESVDTAEDCVEATN
FT                   ESQEPGNSNHQPYATAPVVAPYPRQQSRHDSCSHSTAIRQWRIDQHETCNTCGRRPFLR
FT                   WFYLCTEDTTDYSASTDRNGSLLSEWITDAILEGEYTDEQRDKLWQQKLEVLELCEMER
FT                   TLSMSGSCYDPSHGAEQQYEFHQFETHQSRLSADVHSRPGRCQYRACHHCDRKLQERTW
FT                   VSLNAVCNDPDTTPPSVWDLWETPVSDVKVVKNLGLRPPCPPAPPPHFSQCSYRAFHRR
FT                   RVRSISHLAGYESSLNMGAMSNLSTIEEITEEFDI"
FT   gene            515653..516775
FT                   /locus_tag="ANIA_07256"
FT                   /old_locus_tag="AN7256.4"
FT                   /product="putative microbody (peroxisome) proliferation
FT                   protein peroxin 11C (Eurofung)"
FT   mRNA            join(515653..515903,516010..516775)
FT                   /locus_tag="ANIA_07256"
FT                   /old_locus_tag="AN7256.4"
FT                   /note="transcript_id=CADANIAT00000186"
FT   CDS             join(515761..515903,516010..516775)
FT                   /locus_tag="ANIA_07256"
FT                   /old_locus_tag="AN7256.4"
FT                   /product="putative microbody (peroxisome) proliferation
FT                   protein peroxin 11C (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000186"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000186"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000186"
FT                   /db_xref="GOA:C8VCV4"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCV4"
FT                   /protein_id="CBF78756.1"
FT                   /translation="MADDKAPNPEESVSPAGSTPPMTSRQAAQRRLLAALLTADRLNGR
FT                   LNKILSTSAGQERLFAFIQYTSHILHHLLASAPWVALQTRLSLLARLRSSSSSSPSASA
FT                   STGKAAAPSTATQKPRLLALYSLMSEARYMLRLLDLPTLIAWGSATLKSPPADKTMYAL
FT                   TLLQVLANIIYQALENAAFLTTKGVIPEQFLKRWGGAAKVELWSTRAWLGHIVLQYFVL
FT                   WRARELRKKAEIEGSSEEKQKELKAEVRAWKKSLVNNVCWTPLCLHWSFENGIGFPGSL
FT                   VGVGSFMAGAWGFADLWASTA"
FT   gene            complement(517041..517745)
FT                   /locus_tag="ANIA_07255"
FT                   /old_locus_tag="AN7255.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(517041..517745)
FT                   /locus_tag="ANIA_07255"
FT                   /old_locus_tag="AN7255.4"
FT                   /note="transcript_id=CADANIAT00000187"
FT   CDS             complement(517041..517745)
FT                   /locus_tag="ANIA_07255"
FT                   /old_locus_tag="AN7255.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000187"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000187"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000187"
FT                   /db_xref="GOA:Q5AWS5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWS5"
FT                   /protein_id="CBF78758.1"
FT                   /translation="MLGLCFTLAESCKSSESHLRCRFAARSNPSVAANMRCKDSYPEDF
FT                   QTAIKRSPLKEGELQELCAKSSYPPVFVYGHLMLPTALKYIVDIPQTTTVDMVYATLPG
FT                   YTLHHFAENGKPGLPTIKPSSSSSDVVEGMLVFGLTREQRSDVQEVECVRPGHSIFIDT
FT                   QVQVSLIDKIHGYEVKSQKSVDAGTFVWSWTSENTELQPMETSFWPIDDFLSGQLYANM
FT                   VREQNKVPFSYN"
FT   gene            518507..521598
FT                   /locus_tag="ANIA_07254"
FT                   /old_locus_tag="AN7254.4"
FT                   /product="Cell division control protein 48
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AWS6]"
FT   mRNA            join(518507..518754,518817..518844,518897..518952,
FT                   519021..519270,519331..520822,520877..521598)
FT                   /locus_tag="ANIA_07254"
FT                   /old_locus_tag="AN7254.4"
FT                   /note="transcript_id=CADANIAT00000188"
FT   CDS             join(518723..518754,518817..518844,518897..518952,
FT                   519021..519270,519331..520822,520877..521463)
FT                   /locus_tag="ANIA_07254"
FT                   /old_locus_tag="AN7254.4"
FT                   /product="Cell division control protein 48
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AWS6]"
FT                   /note="transcript_id=CADANIAT00000188"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000188"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000188"
FT                   /db_xref="GOA:Q5AWS6"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWS6"
FT                   /protein_id="CBF78760.1"
FT                   /translation="MSSEEHKKKLLDASGAEKKEELDTSTAILKKKKKPNSLIVTDAVN
FT                   DDNSTISLSNNTMDTLGLFRGDTVTVRGKKRKETVLIVLADDDLDDGSARINRVVRHNL
FT                   RVKHGDIITVHPCPDIKYAKRIAVLPIADTVEGLTGSLFDVYLAPYFRDGYRPVKQGDL
FT                   FTVRGGMRQVEFKVVEVDPPEFGIVAPDTIIHSEGEPIQREDEENNLNEVGYDDIGGCR
FT                   KQMAQIRELVELPLRHPQLFKSIGIKPPRGILMYGPPGTGKTLMARAVANETGAFFFLI
FT                   NGPEIMSKMAGESESNLRKAFEEAEKNSPAIIFIDEIDSIAPKREKTNGEVERRVVSQL
FT                   LTLMDGMKARSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDPTGRLEILSIHTKN
FT                   MKLGEDVDLETIAAETHGYVGSDLASLCSEAAMQQIREKMDLIDLDEDTIDAEVLDSLG
FT                   VTMENFRYALGVSNPSALREVAVVEVPNVRWEDIGGLEEVKRELIESVQYPVDHPEKFQ
FT                   KFGLSPSRGVLFYGPPGTGKTMLAKAVANECAANFISVKGPELLSMWFGESESNIRDIF
FT                   DKARAAAPCVVFLDELDSIAKSRGGSVGDAGGASDRVVNQLLTEMDGMTSKKNVFVIGA
FT                   TNRPEQLDAALVRPGRLDTLVYVPLPDQASREGILKAQLRKTPVASDVDIEFIASKTHG
FT                   FSGADLGFVTQRAVKLAIKESISAEIERQKQREAAGEDVKMEDEEEGEDPVPELTRAHF
FT                   EEAMKTARRSVSDVEIRRYEAFAQSLKNSGGSSFFRFPSANEAADSGNTFGEAGNDDSL
FT                   YD"
FT   gene            complement(521816..522448)
FT                   /locus_tag="ANIA_07253"
FT                   /old_locus_tag="AN7253.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(521816..522448)
FT                   /locus_tag="ANIA_07253"
FT                   /old_locus_tag="AN7253.4"
FT                   /note="transcript_id=CADANIAT00000189"
FT   CDS             complement(521816..522448)
FT                   /locus_tag="ANIA_07253"
FT                   /old_locus_tag="AN7253.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000189"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000189"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000189"
FT                   /db_xref="GOA:Q5AWS7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWS7"
FT                   /protein_id="CBF78761.1"
FT                   /translation="MPSSPTNSSHTAQPSPADLESDLLAHLASTHALEDLHTNLLSTLQ
FT                   RLGWTEKIRRLSTELLRANRCERFDDVVEAVVASAQGRSHPFLVDSNSDNNTGSRANHT
FT                   HNHNGDVDGVESNSAYSIENADLRIPSVVVEQGVRAIKDILREVVILEDEGDGAGDSSS
FT                   ATGTVSNNAVDVVGETATKRQGEKVVNGDTSPTKKGDKKAKQGKQIR"
FT   gene            525109..526948
FT                   /locus_tag="ANIA_07252"
FT                   /old_locus_tag="AN7252.4"
FT                   /product="MAPKKK cascade protein kinase regulator Ste50
FT                   (AFU_orthologue; AFUA_2G17130)"
FT   mRNA            join(525109..525373,525432..525593,525642..526948)
FT                   /locus_tag="ANIA_07252"
FT                   /old_locus_tag="AN7252.4"
FT                   /note="transcript_id=CADANIAT00000190"
FT   CDS             join(525109..525373,525432..525593,525642..526699)
FT                   /locus_tag="ANIA_07252"
FT                   /old_locus_tag="AN7252.4"
FT                   /product="MAPKKK cascade protein kinase regulator Ste50
FT                   (AFU_orthologue; AFUA_2G17130)"
FT                   /note="transcript_id=CADANIAT00000190"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000190"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000190"
FT                   /db_xref="GOA:Q5AWS8"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWS8"
FT                   /protein_id="CBF78763.1"
FT                   /translation="MSLHTSYHADSDADDEYERSVITSPHLATDSEGSASESEFPSAEP
FT                   TPTFAHNEDNSKIPDTIITEWTAEECASFVASLGLRQYCQAFIENGIVGEALIALRHDE
FT                   LKEMGIASVGHRLTILKSVYEMKVKQDIPLDADHYIPLSADQSMNESATQEDIARLIQS
FT                   IRLRDEKIMTVETELRRVLEDYRRLREELLPVFKMAKDKSQPLPPPTAVSSSDGYYDDR
FT                   LSGSTLTGQQSGITILDRSGSILSRNLSKRVHGGTTPKNNSPTHIPPSIHENRAYNDGT
FT                   NLDPSAAAVAASSHLSTMNGKSQLSPNLPSPTSPSNHYGAPQTLASRAYTQPGSARNPH
FT                   DHYDDNPQSQSRSDRLNTTSSSATRSEIPSRSESRAGGETPSVEIFKSFRVSVDDPCYK
FT                   VLPAALKKYNINGDWKQYALYIVYGDQERCLGLEERPLILFKQLEKEGRKPMFMLRKQQ
FT                   QAPESTTAYPPSGGSAPNSAGFEPRQAQINLPGGVL"
FT   gene            529153..530953
FT                   /locus_tag="ANIA_07251"
FT                   /old_locus_tag="AN7251.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(529153..529631,529687..530953)
FT                   /locus_tag="ANIA_07251"
FT                   /old_locus_tag="AN7251.4"
FT                   /note="transcript_id=CADANIAT00000191"
FT   CDS             join(529153..529631,529687..530953)
FT                   /locus_tag="ANIA_07251"
FT                   /old_locus_tag="AN7251.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000191"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000191"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000191"
FT                   /db_xref="GOA:Q5AWS9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWS9"
FT                   /protein_id="CBF78765.1"
FT                   /translation="MDLTNSRSMELLRTLGLVNACRAIPGSIAEDVSFECVFVTSLHPE
FT                   NGRELGRWSVPCVAEQTSESKGTNDGSFPAEPGQRCSQILVEKWMRGLVLDCKNVEFRG
FT                   NWRYVGHAEEEDRVRVRAVDLHGNEHTFVGRFLVGCDGRKSAVRKAAGIEMIGAKVPAH
FT                   FHLVHFRSRALSSILDRSKSRFWHAFPAGSGFLIDQDGKDTFTAHCPLTEYEARVSSAD
FT                   DRVFPSNLDPKTTIWRVLGGYGVTGECWELPIDEILVDSIWQPSLRIAAAYSTPSFLVF
FT                   LAGDSAHLSPPHGGYGLNSGIVDAVSLAWRLAAVIKGYGGSYLLSSYSLERRPMMMRAL
FT                   CRSYRHLLEHVKLGSLYEEFGDVIEAEGDEGENVRMYLGRWIAESGPDILDRGVELDLR
FT                   YEGSPCIWTEPQSEGEEDDAWDVHRYRPSTRPGRRAPHVFLKDGKTSTYDFLGTEWTLM
FT                   QFITHESESETSKAETLLRTAKQRGFPLQHVLLCGEEQVRRIWRRDLVLVRPDTHVAWR
FT                   GKGRLAVAEAEMVLDVVLGKSVRPEYTPPTNTEETLFLKTVDQLVSMGKSTGERAGPRD
FT                   VKARL"
FT   gene            complement(531406..534709)
FT                   /locus_tag="ANIA_07250"
FT                   /old_locus_tag="AN7250.4"
FT                   /product="sodium ion/proton exchanger (Eurofung)"
FT   mRNA            complement(531406..534709)
FT                   /locus_tag="ANIA_07250"
FT                   /old_locus_tag="AN7250.4"
FT                   /note="transcript_id=CADANIAT00000192"
FT   CDS             complement(531557..534709)
FT                   /locus_tag="ANIA_07250"
FT                   /old_locus_tag="AN7250.4"
FT                   /product="sodium ion/proton exchanger (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000192"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000192"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000192"
FT                   /db_xref="GOA:Q5AWT0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWT0"
FT                   /protein_id="CBF78767.1"
FT                   /translation="MAWDHLDIDKPHLAYMILGGFTGLFMLCSLFVKEKLYIGEATVAT
FT                   ICGIIFGPHAANLFNPIEWGNVDKITLECSRIVLVVQCFAVGVELPKAYMERHWKSVTL
FT                   LLLPVMTWGWLITSLFIWSLIKPLTWLEALVCAACVTATDPVLASSVVGKGKFAKRVPR
FT                   HLRDLLSAESGCNDGMAFPFIYLSYYILHYRPDANAVSLHWFCVTILYECVFGAIFGFT
FT                   IGYAARHAIRFAERKQLIDRESFLVFYFVLALFCAGSGSLLGMDDLLIGFAAGVGFSND
FT                   GWFTEKTEESHVSNVIDLLLNLAYFVYLGAILPWADYNNADLGLDAWRLVVIAILVIFF
FT                   RRIPIMLLLKPIIPDVKTWREALFAGHFGPIGVGAIFACILARAELETGSTQPVVSDDL
FT                   PKPHTHNYYVVQIIWPLTTFMVVASILVHGSSIAVFTLGKRINTLSITLSYTQANEEGP
FT                   SWMNRLPRVQSLAKGSMSFRKADDSEGSSPNEPEYPPGTLPPIGLPGNFLRRVQEDDSG
FT                   SPTGRVSTRRGRRRRRKADGAGGPISQSAIAPQRPSEVESEDAEKTVGDTESTTPSPPP
FT                   ATWRDAIVNVYVEGHDLIYEDKDGNVLKTEHVGHMSAEEQKRHVQAERSKLNLEFQQPP
FT                   DETKPGSSEEQPTAGERLEKSIGDKAKRRRFGQWLGFGKQRSENQEQKDAKTEKKSAEE
FT                   AGPKAPKGKGRSAHAYQFGNTIIVEDEDGEVIKKYSIPSVDKSEAKGNAPVRRGLVRMG
FT                   TWFGKEEEGEPSQAGKKTHENEWLADDGLRFTLANDETVGKHGISHKGRRMTKQEFADQ
FT                   IRNLGPKARQSIVEDSDAPKRVKDAARDDAQQADKRERRASAAGSAHQTGAPHDDLESV
FT                   SSGSDDEPDSEEGPGPNVAETLARIAAGTATGTAADERRKDLSPGTSSRERSPRSRRDS
FT                   DDDGTERVPPSKLREAAGLALPQQALDLDDTGETPAERRRRLAALGEYSDSEDDVDSDA
FT                   VSEGEDDHNNRKGPGKISFADGTNLEAGSTYDREGNGLGSSRMHSRRSRSRISWGGEKG
FT                   RE"
FT   gene            complement(536214..538843)
FT                   /locus_tag="ANIA_10918"
FT                   /old_locus_tag="AN10918.4"
FT                   /product="sorting nexin Mvp1 (AFU_orthologue;
FT                   AFUA_2G17180)"
FT   mRNA            complement(join(536214..536655,536711..537304,
FT                   537351..537472,537553..538843))
FT                   /locus_tag="ANIA_10918"
FT                   /old_locus_tag="AN10918.4"
FT                   /note="transcript_id=CADANIAT00000193"
FT   CDS             complement(join(536446..536655,536711..537304,
FT                   537351..537472,537553..538843))
FT                   /locus_tag="ANIA_10918"
FT                   /old_locus_tag="AN10918.4"
FT                   /product="sorting nexin Mvp1 (AFU_orthologue;
FT                   AFUA_2G17180)"
FT                   /note="transcript_id=CADANIAT00000193"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000193"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000193"
FT                   /db_xref="GOA:C8VCW1"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCW1"
FT                   /protein_id="CBF78768.1"
FT                   /translation="MSLFGTSPDDSPAADSARRSKTSLFADEPSFGTGSANFGGSSLFA
FT                   DDDDLGSPWNSNTAKRTSKQQLVKTLLPDSDVPESYIDAYDLVLSAGERAGTGVSLTTV
FT                   RELLSGGGLSATDQAKILNLVLSGDTDRSNGLSRGEFNVLLALIGLAQEGEDLTFDTVD
FT                   DRRKSMSFASEDYIETNRLAELPVPNSSYLDALRAKQESIMPPSHERPSTPPAPPIPVQ
FT                   EPSPAQSRRARGDSMGGLDADPWGSPQLHRGHAHTQREAERGMLNGYGSVRSATNAWSK
FT                   TGDSVNPDAPSNSSYTNGRSEIRSSNSADYGWGDHFAQSSQGGSLGGPVQPGLGDFGRP
FT                   GIGRGEPNPSRQSLNIDRAINNHVKEVVTVTLLPEKEGLFMFQHRNYEVKSARRGSTVV
FT                   RRYSDFVWLLDCLHKRYPFRQLPLLPPKRIAADSNSFLEKRRRGLVRFMNALVSHPVLS
FT                   QEQLVVMFLTVPTELSVWRKQATISVQDEFAGRVLPPDLEDSLPSTLMETFETVRSGVK
FT                   RSAEVYINLCTLLERLAKRNEGLAADHLRFSLALQSLTEMTRDTYALDTNDVPLLNEGI
FT                   KATARHLSASQSLLEDEARAWEDGVLEDLKRQRDSLVSVREMFDRRDRYARNNIPQLER
FT                   RIEANERKLQDLRARPQGTVKPGEIEKVEESIFKDKESIVQQHARGVFIKECIRDELIY
FT                   FQQSQYHISRLHQDWSQERVKYSELQADNWRSLGDQVEGMPLGD"
FT   gene            complement(539158..542706)
FT                   /locus_tag="ANIA_10917"
FT                   /old_locus_tag="AN10917.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(539158..539915,539973..542605,
FT                   542655..542706))
FT                   /locus_tag="ANIA_10917"
FT                   /old_locus_tag="AN10917.4"
FT                   /note="transcript_id=CADANIAT00000194"
FT   CDS             complement(join(539217..539915,539973..542605,
FT                   542655..542706))
FT                   /locus_tag="ANIA_10917"
FT                   /old_locus_tag="AN10917.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000194"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000194"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000194"
FT                   /db_xref="GOA:C8VCW2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCW2"
FT                   /protein_id="CBF78770.1"
FT                   /translation="MAMGQGEQRAIHAFFRKDFEGPTPLVQSVENSLACPTSSQEANGS
FT                   PVLQTTPVAALDHDPNINRRKRRKTSNDAEEISSNDLVTTDGEQTVTGVSAPVEDGTAL
FT                   TSTQTTGTLVAVETTNDTPAEAEQKKQKVIKLNANGKLLSSPVANRFTDMSKKKGTKRG
FT                   KPAPQHSDSLERKLVVIKYLDKTGFSQSIGRQIDDILSGRRKYIVSNHATRQINTVTAA
FT                   PTSKQPAKATHPFFLKKTAQKAEVPSSHVECHDSVSPPSGDRLATKSQSAQSRSLSKSS
FT                   PFRHAFNKVPEPMHPLWPPSGLIHVRNLSNELDLRNDGDRQATATDNRKSKTPAVQVID
FT                   EENVLSFLKSSDILPALRKPSKQVISGRVLQAKVGKRLMGRGASSDTDEAPSPDTLHSA
FT                   VARLYTSLPSSMSAFERGDYEAQLWAHKYAPSTAKQVLCATKEALMLRDWLNHLVVSSV
FT                   DVGSSSRDNEKAKRKQEKKRKRRKRTDKLDGFVVFSEDEYSLGEISGSDDELAGDVTVS
FT                   NKRTVIRTGDLTFNLKSSSDRSRIANAILLSGPSGCGKTASVYAVAKEMDFEVFEINAG
FT                   SRRSAKDILDRIGDMTQNHLVHNLHDKENVNQPFGTSSQAEELEDAKQNQLTGFFMPAK
FT                   KAGRPQPKAPSKENVMKHSRTQKQSLILLEEADILFEEDKQFWSGVLTLINQSKRPIVI
FT                   TCNDESLIPLDDISFHAILRYRAPSQGLAVDYLLLMAASEGHILQRTAVERLYSSTRND
FT                   LRKSIMELNYWCQMAVGSEKSGLDWMIDRWPQGVDLDSNGDKLRMLSADTYDNYMGWFS
FT                   RDIMISPGLATESELREEALHWWHLSLQEADVMEDSQLQSFREPKTSLSKIEHIESLCS
FT                   QSEYMESRSVLDLLAAPCSLDARMDAIDTSIPPISEKQKLNFVDGYKLLHADKLPDYAT
FT                   LTLDIGSTFQTLLGRVFRGTCEADSKDMLASNMLEAVSKPKAAEPAKELLEVLVPIAKP
FT                   DCGYPPPSGGAELAFEYGQQSIVEDLAPYVRSIVAFDLRLENYRRELSGLLSGDAKGTK
FT                   RMRTTRASRAALEGGSKAETRKERWFSPAVNVQRILATGNREWQDLLVQNGYFTVPVAL
FT                   EQATMERSELPSGSASDGSI"
FT   gene            543085..546016
FT                   /locus_tag="ANIA_07248"
FT                   /old_locus_tag="AN7248.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(543085..543249,543300..546016)
FT                   /locus_tag="ANIA_07248"
FT                   /old_locus_tag="AN7248.4"
FT                   /note="transcript_id=CADANIAT00000195"
FT   CDS             join(543085..543249,543300..545930)
FT                   /locus_tag="ANIA_07248"
FT                   /old_locus_tag="AN7248.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000195"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000195"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000195"
FT                   /db_xref="GOA:C8VCW3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCW3"
FT                   /protein_id="CBF78772.1"
FT                   /translation="MDLQPPSVLAQLPRPLHASTGKTYISEVYSLANAKKRKRYEVAVA
FT                   VDGEAVNLYNIQNPKLVTSYAVPPQSSFSCPPCSLRRKLLKASGVKRQTFVAMKKEIKA
FT                   FTEESAASGTGAPVISSSSFGVDDSTSPTVFIGIVPGSEIEDKDPFDVLAIHRDGRVRR
FT                   ISPDLETQRWSMQHSEIPQGSWEIHGCFLLEFDDAKKSLLKRRPDIVSLAAGSSMIAGG
FT                   SDPSILLLVSYPVGTEQISLSEVKIQMFSIPAEASNRGVDESQQMRHLMTANLPNIGEK
FT                   VDKKNLQWHFHSNSAGLNLSFEKGFVNFDLSQYKPTATSIFILEDENFSSVMRVSAQSV
FT                   IGAGKSMIALYDTQYKSIQRSIVTEDLPSAATNNARTTFINYFAKLDLVVASKGNSLLA
FT                   FDLGSSHSISGAPSKRSRDGLLIDAIGRGIGSTSQWENVSKKHRSNAAAALGLTSAEEI
FT                   EKWNNFSRAVRECAKKNDTGGFDRAVHSYFQIGDTQALPEPGQYVNLEMVLFLLSLIFT
FT                   VGDNSENTDKLSASSSVNVTVAVWPTETCNWLIRLGYLYPGNVEAALHRAHKPRILPQL
FT                   PIGTFAQALQTSDPSLQRLISVLKGPAAFSADELAHVLKIFLNAARSISIPTEQGEEAE
FT                   TKALTNGDGKTNTALALTKTSAESDFPPSPPSTLQTTFTGLNTTLLSLHTHPHPSIKSS
FT                   LRSTLSRNDIITTIHHLRLSLATGGHATRFTETPPTPISPHLTSPSLPLKTIVDLLNAA
FT                   VDAIGPSGWVSIAPGDLNFSLNSEAELSGLRDMALIAEMKSEVSAALAGVEEATLLTGI
FT                   LREYLRYAKSVTNDSRSLTSSTLALPDDMLNAAPSSTSVRHEKLNGADLLVFGAQDDDA
FT                   DGGDCDASGKLLPLSLKAAKDVSKTKVLKGTGKVVQRSKREIGYLRRKAVGKYTFERLV
FT                   L"
FT   misc_feature    546294..551592
FT                   /note="contig 1.205 1..5299(1)"
FT   gene            complement(547254..550755)
FT                   /locus_tag="ANIA_09492"
FT                   /old_locus_tag="AN9492.4"
FT                   /product="DNA binding regulatory protein AmdX
FT                   [Source:UniProtKB/TrEMBL;Acc:P79045]"
FT   mRNA            complement(join(547254..550612,550662..550755))
FT                   /locus_tag="ANIA_09492"
FT                   /old_locus_tag="AN9492.4"
FT                   /note="transcript_id=CADANIAT00000196"
FT   CDS             complement(join(547254..550612,550662..550755))
FT                   /locus_tag="ANIA_09492"
FT                   /old_locus_tag="AN9492.4"
FT                   /product="DNA binding regulatory protein AmdX
FT                   [Source:UniProtKB/TrEMBL;Acc:P79045]"
FT                   /note="transcript_id=CADANIAT00000196"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000196"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000196"
FT                   /db_xref="GOA:Q5AQD8"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQD8"
FT                   /protein_id="CBF78774.1"
FT                   /translation="MLIGPMVDQSLGTSPKLESLSSISEVPGDVNAVSKDTSKKDTVVP
FT                   ANIPPPKTDKPRPHGCTTCGRSFARLEHLKRHERSHTKEKPFECPDCSRCFARRDLLLR
FT                   HQQKLHMTTTPSSRPRNARRESTGAAGAGAGAGAGTNRVRKNSVAGASSNMRPRANTIS
FT                   HIDGAALGITNNTNAGPGTTGHPGHAYHPSLSSSVGSNIDYRGFSSSHQPPVNGLSKID
FT                   THGLPMDLSGGLRTAPVYGSFDFNIPDFMSQGSTINPAQLHFGGSPQTYGNEAPSSPYG
FT                   THQMPHGNDAIMEDDYNFDWMQRFDPSLPIGKNESAIDESSPSAMSTGSQSGISEPMMD
FT                   GSNQFSMSSVNWQNQFPSQPAIARQFSDYSTTFNDLGIPPETVSPKSLMAQNPFAEAYA
FT                   TPPSMTSVGQQPMLGAHSQSSMFSSSMATSGDSPNPFNLPFANSALRTHHTPASTDTFT
FT                   DSTRRALLASMAQPASFSHRKYSQPATGMIQCRDLYSRSSSSPTSTNQLPSTADMQRFI
FT                   SAYITYFHPHLPFLHIPSLNFQAPEYTNNLRTPSGHLNLSSTGVVGGGGCLILSMAAIG
FT                   ALYELDTAASKDLFEASKKMIQLYLEERRKADMSTAVSRSSKPGDNSVHNTPLWLVQAM
FT                   LLNVIYGHTCGDKTSADIASTHCAALVSLARAAELTRHIDAKDLPQDYLHAGFAGKSDF
FT                   QGQDLVEDSWSQSFGAPKEKKDWLDWKIVEERKRTLFAIFAASCFLVSAYNHAPALTNS
FT                   EIRLDLPCEEDIWAAESPQAWKQMGGHLSSKKNVAFSSALTTLLTAGRRVQNSAALSPD
FT                   DSKSSDLRPSSFGCFVLIYAIHNYIWETRQRHMGRQWTTRETDAMRAHIEPALRAWQTA
FT                   WATNPLHSLERPNPYGAGPLSADSIPLLDLAYVRLYVDLGRCKEAFWQRDWNAMADELA
FT                   RGTDVENALDGIPSDVLDPSITEDALSMDARRDSIASLGVGELAISQTPSQEHPMQPLL
FT                   GAYRPGQTKREKLLRRAACYAADSFAMSDQLGSTFADFTCRELPLQSAMCTFDCAQVLA
FT                   EWTTTVQERVGPYLGMLSREDFDFEQAIQSQLLEDEDCKLLQKTRSILASIEQKMQKDI
FT                   ANTMSVSQGSSGDADEGFGCKILVATAGLLDRASVWPGKIARM"
FT   misc_feature    551593..679213
FT                   /note="contig 1.123 816..128436(-1)"
FT   gene            552622..553537
FT                   /locus_tag="ANIA_07247"
FT                   /old_locus_tag="AN7247.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(552622..552712,552750..553537)
FT                   /locus_tag="ANIA_07247"
FT                   /old_locus_tag="AN7247.4"
FT                   /note="transcript_id=CADANIAT00000197"
FT   CDS             join(552622..552712,552750..553537)
FT                   /locus_tag="ANIA_07247"
FT                   /old_locus_tag="AN7247.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000197"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000197"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000197"
FT                   /db_xref="GOA:Q5AWT3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWT3"
FT                   /protein_id="CBF78775.1"
FT                   /translation="MGRRGDRLQRQSWLSCGDSGAAVVGDFRGACKIVPDCLGFWKRAK
FT                   RGNKPTSQRGNPPNDPTSSEPEHRCIRCTSPARASLFFAFFICISSPTGTESSANGVLH
FT                   ENHVFTVANLSEYPRFSLRLVVRPEYLSSSSPKALQTAFIPVAIDEPADQASWYHLGHL
FT                   VPTRYSLRTAPHAMTSRLEPCPVRCRCLLPIFGLSPDFVVFSSWGRLIYPGVDHGSMLR
FT                   EALAGKLRQQQTLELFSFLLPFFSIFAVFNKASAADLPSHRRSRCRGTDYSRLLKATRG
FT                   YPRLLKDYSGY"
FT   gene            complement(555659..562902)
FT                   /locus_tag="ANIA_07246"
FT                   /old_locus_tag="AN7246.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(555659..556932,556978..557742,
FT                   557812..558711,558758..559518,559569..559905,
FT                   559958..561397,561447..562902))
FT                   /locus_tag="ANIA_07246"
FT                   /old_locus_tag="AN7246.4"
FT                   /note="transcript_id=CADANIAT00000198"
FT   CDS             complement(join(555659..556932,556978..557742,
FT                   557812..558711,558758..559518,559569..559905,
FT                   559958..561397,561447..562902))
FT                   /locus_tag="ANIA_07246"
FT                   /old_locus_tag="AN7246.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000198"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000198"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000198"
FT                   /db_xref="GOA:Q5AWT4"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWT4"
FT                   /protein_id="CBF78777.1"
FT                   /translation="MASRSERLAKFFTLVLSGKRLVSTVENFTLLLEAIQWQTDHAACV
FT                   ERIVASPPARSAIHAGIRLDVSPEFLNNHTSLFILYLSQPSVKNRCNGQFLQELLELIF
FT                   DPPTVWNAFMGAFQDELLTERGMEAFAWLLIELLAHQSVGQINVVADAQNVADNGALLR
FT                   SLSPETRRYGHKLQHILQIKASNMVVHNLDYFPGGRHDNDHADFRRIAIYPTSSEFHSK
FT                   EKPFYRRADEILELAENTRPVMHLDNQFRLLREDMLSEIREEFLAARGKKQKRRTATLL
FT                   EKLDLVNVFYGTDKRGSPCSLVISCLGGLVQLTSRDRDARKAFLENEQSFLRHRSFGCL
FT                   IRGEEIVSFAMVDRQIDYLLKSPPSVVLRVIGDEAVRKTLSYFKLYDDIRFLLVDAPVF
FT                   AYEPILRQLQEKIELPLAEELLGFQPVDVVAPSGTIPSTVIESLGDQERTLQDILGTEK
FT                   PLSLDPSQMESLLSGLTQRVSLIQGPPGTGKSFVGALIAKALYKHSKETILVMCYTNHA
FT                   LDQFLEDLMDIGIDESAIVRLGSKSCQRTKPLRLSAQQAIRPRKSKATWSIIDGLKSKA
FT                   RDISEELDMAFSAYSSFKLNYDTLQEYLEFEEPEFLEAFVPPRDPDGMTIVGRGKKPIS
FT                   SQYLYDQWAYGKHHSLPSLSHLSAEARRVWEMDKAIRQEKIAYWKEKLLEEHVVNVQGL
FT                   IARLDRCQKKLDEMWNERTRDVLLSKRIIGCTTTAAAINASVLNTTSPGVVLLEEAGEI
FT                   LESHVLTALGSHTKQLIMIGDHQQLRPKINNYALSVEKGSGYDLNRSLFERLVESGYPH
FT                   STLAKQHRMAPEISALVRRLTYPDLLDGDKTKTRLAPRGLQNRVVFIDHSQPEGFLHGV
FT                   SDRDGDGGKGSKQNTFEVKLVLKIVKYLGQQGYGTDKLVILTPYLGQLHLLREELRKDT
FT                   DPVLNDLDSYDLVRAGLISHASAQHVKRPIKLSTIDNYQGEESDIVIATLTRSNKDGDI
FT                   GFMSAPQRLNVLLSRARDVLIMIGNSNTFTNSRKGKEVWKPFFDQLQTNGYLYDGLPVK
FT                   CEQHPQRTAVLQTPEDFNKLCPDGGCDEPCGTKLNCGLHDCPHKCHQLSDHSKMNCRKV
FT                   IDWTCTRDHRFKRPCFQQHESCHRCAEEDKERERRRQRDMDLELQSERKRQEYARQLAQ
FT                   LQEEIAHERRLQKEDRDEQERQRILSQHRDDLQKMRFRAPERFSVSPHASKVRKSGPAT
FT                   QGTNSQETVRQEPSHEAEQAEPNRPPSANSPDVETALSSAEQDWKYQKDYEGAESDELD
FT                   KLMGMIGLEGSKTKFLSIKSKVDTALRQNVDLKGERFGSVLLGNPGTGKTTVARLYAKF
FT                   LTAMGIIPGSSIIETTGSRLANGGVSGCEKQINGILNKGGGVLFIDEAYQLAQTNGQGS
FT                   QVLDFLLAEIENLTGKVVVVLAGYRRQMEKFFAHNPGLPSRFPHEFVFEDYNEQELRRI
FT                   FEYRIKTKFGGRMKVAGGMGGLFCRIVARRISKQRGHEGFGNARTVENVLDRILERQAK
FT                   RLAEERRNQTFSDDLLLTKEDLIGPEPSNALRNCSAWKKLQSMIGLTSVKATVKALLDS
FT                   MQSNYERELNEKPLVEFTLNRVFLGSPGTGKTTVAKLYGQILVDLGYLSNGEVIVKNPA
FT                   DFIGSVIGGSEQNTKGILASTLGKVLVIDEAYGLYGGGTRDPASSNSNQFKTAVIDTIV
FT                   AEVQGVPGDDRCVLLLGYEEQMREMFQNVNPGLSRRFSPDNAFVFEDFSDTELEQILEL
FT                   KVKEQGFVTSEKGKKVAMEILSRARNRPNFGNAGEIDIMLNGAKVRQQQRRSSKKGILA
FT                   LDYFEPQDLDPEYDRGERAETNIPMLFQDIVGCESIISKLEEYRQSVKNMRELDMDPKE
FT                   HVPFNFLFRGPPGSGKTSTARKMGKVYYDMGLLSSAEVIESSATDLIGQYIGHTGPKTQ
FT                   ELLEKSLGKVLLIDEAYRLAEGQFAKEAMDEMVDCITKPKFFQKLIIILAGYDNDINRL
FT                   MTINPGLTSRFPEELEFNGLAPADCLQLLTKLLQRRKADFLPKVNSFDLDALDSPSSLF
FT                   QKKLLNRFQSLIRTANWANARDIQTLAKTIFRVAIQKMQNKNVSVTEELILRHVDHMIS
FT                   ERTNREAKQSALRNPVADLLQAQSFGSTTAPPVLTTVSNPPTLHEEKKEEDPTALRSEN
FT                   CSDVVPRDDGVADDVWHQLQQDKKAAEAAEKQYQKLLREERAAENAVAELPDPPVEASE
FT                   PDGEAKKQHERRRLEELKRRAELEILRKIREAEEQARRKEQQLQQKLRHMGRCVAGFQW
FT                   IKQATGYRCAGGSHFVSNEALGV"
FT   gene            563376..564851
FT                   /locus_tag="ANIA_07245"
FT                   /old_locus_tag="AN7245.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(563376..563625,563686..564851)
FT                   /locus_tag="ANIA_07245"
FT                   /old_locus_tag="AN7245.4"
FT                   /note="transcript_id=CADANIAT00000199"
FT   CDS             join(563376..563625,563686..564851)
FT                   /locus_tag="ANIA_07245"
FT                   /old_locus_tag="AN7245.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000199"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000199"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000199"
FT                   /db_xref="GOA:C8VCW7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCW7"
FT                   /protein_id="CBF78778.1"
FT                   /translation="MTEPRRETIRGRGRGSWRRSRKSRADAEPSAPAVGPLLSTITRED
FT                   LDSNITSSSGKEFSMITDCRLVGSYNWLNRKSPTILVPGAPPEWTPTGTSERLPQDKGT
FT                   YFRDQNSARYAAHVFQPAANSILNQDPDFDFTQIDIVACNSTLGNLRRFIAEPDKQFRF
FT                   IVEAVGSTVFFVRRENSPTQALSNVVGFGHTFPEANTTWGSDVKGSESHQRILQYRFAG
FT                   LSCLVRYGGDGYLPQLYQPHGPRREPAATAPDDLLASFNQVSVSTVSPEGEQALRVESG
FT                   GELVPQSAMFDLKTRSATKQYSNILRDELPRLWISQIPNFVVGFHTDGEFHDVRVEDVR
FT                   EEVRKWEERNEVQLRKLSTLMKLLIEFADGQPNRRFEVVYNGTDGNGELELREVGDEVN
FT                   CCLSDVMKRRWAAGYLDGRGKEKKDEREEVDDAGQSKHIEREDSEWSGESESEKDFTAC
FT                   SASTCGYCGHCAY"
FT   gene            complement(565202..565612)
FT                   /locus_tag="ANIA_07244"
FT                   /old_locus_tag="AN7244.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(565202..565375,565460..565612))
FT                   /locus_tag="ANIA_07244"
FT                   /old_locus_tag="AN7244.4"
FT                   /note="transcript_id=CADANIAT00000200"
FT   CDS             complement(join(565202..565375,565460..565612))
FT                   /locus_tag="ANIA_07244"
FT                   /old_locus_tag="AN7244.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000200"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000200"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000200"
FT                   /db_xref="GOA:Q5AWT6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWT6"
FT                   /protein_id="CBF78780.1"
FT                   /translation="MRSTDCERDNGHTGTKDSVDFVASPSHCFMSVSFLHCYTGLALGH
FT                   MMGLLMCMEIQAHFAYAARLSQTYVFSRLATLGANFAREGNVKSWSLANIWRYKLRGIA
FT                   PCKL"
FT   gene            566720..568673
FT                   /locus_tag="ANIA_07243"
FT                   /old_locus_tag="AN7243.4"
FT                   /product="methionine transporter, putative (Eurofung)"
FT   mRNA            join(566720..566888,566902..567238,567310..567398,
FT                   567435..567531,567585..568174,568282..568673)
FT                   /locus_tag="ANIA_07243"
FT                   /old_locus_tag="AN7243.4"
FT                   /note="transcript_id=CADANIAT00000201"
FT   CDS             join(566720..566888,566902..567238,567310..567398,
FT                   567435..567531,567585..568174,568282..568673)
FT                   /locus_tag="ANIA_07243"
FT                   /old_locus_tag="AN7243.4"
FT                   /product="methionine transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000201"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000201"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000201"
FT                   /db_xref="GOA:C8VCW9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCW9"
FT                   /protein_id="CBF78782.1"
FT                   /translation="MIPRSGGEKVYLEAAFRRPKLLITVVFAVQAVALGFTGTCAYLPS
FT                   SLIRFLFAHADTSGCIVFASNMIVASGKEATEGEERGIAIAVISFITLLHVFLPNWGVR
FT                   GMNVIGVVKVVLLLFIVVTGWVVLSGRLNSIPDPYASFHCSFVGSATSSNLYATALFKV
FT                   LNSFAGWSNAAYVLNEIRNPVRTLKIAAPTGLGICAAATPEEIANSGTTVASYFMGKVF
FT                   GTAAERALSVLITISAFGNVMTVTFAQARVNQGLAKEGVIPFPTFWASSWPFGSPSAGL
FT                   LLHFILSVIVIVAIPFGDAYNFILDLEGYPSPIINLLVVAGLFYLRYSEPRLPRPFKVY
FT                   WPVAVFFMAGQAFQVVAPFIRLPEGKGDTSLPYWLYPIVGIAVLLAGVVYWGIWQLLLP
FT                   WLGGYRLVPEHQVLKDGTTVAVYKRENKILARKLARRPFAFKTYPILILSNPIHLLKWV
FT                   AAEDSRCTFSFNRILQLTPLFTGRTTVRSRVQTYDDQSSTRHSSESIAFEELLFNETYD
FT                   RPHYILIRDRARTPIAALVWVRRTKAKACLFVAQHRKENT"
FT   gene            569353..571047
FT                   /locus_tag="ANIA_07242"
FT                   /old_locus_tag="AN7242.4"
FT                   /product="proline transporter, putative (Eurofung)"
FT   mRNA            join(569353..569687,569742..571047)
FT                   /locus_tag="ANIA_07242"
FT                   /old_locus_tag="AN7242.4"
FT                   /note="transcript_id=CADANIAT00000202"
FT   CDS             join(569353..569687,569742..571047)
FT                   /locus_tag="ANIA_07242"
FT                   /old_locus_tag="AN7242.4"
FT                   /product="proline transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000202"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000202"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000202"
FT                   /db_xref="GOA:Q5AWT8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWT8"
FT                   /protein_id="CBF78784.1"
FT                   /translation="MEKKFPSVKDDPVASAEGTIVPHNTTKRGLSSRHLQLMAIGGSIG
FT                   TGLFVGIGQYLRESGPLSVVLGYLLYGLLFIWPCYLCVGEMCAYLPIPGSIFELAARYV
FT                   DPAFSFAMGWVYFYACVMLVCVEYSSVATVIQYWNTDVNPAVWIAIVMVVCIALNIVAV
FT                   EWYGESEFIMSSTKVLLLLGLVFLTFITMVGGNPKHDVYGFRNWTDGVMYEYYGSGNTG
FT                   RFLGLFNVMVYAAFSLPGPDMPALAAGEIQNPRYTIPRVVKMTFWRIVGFYIIGTLAVG
FT                   TICNPNDPRLIGAIEDGSAGSAASPWVIGIENLGIHGLPDLINALIMLSGWSCGNAFVY
FT                   VSSRTLYSLAKDGQAPRFLIKCTKAGVPIYCVAVVSLITCITFLACANSTVTVFNWFID
FT                   LTTSGLIVTYTCMIVVFLCWYRALRAQGIDRKTYLPWVAPLMPYWAILAFLVGFAVTVF
FT                   NGFTVFSPWSTQGFVTSYFAIGFFVVMFAFWKTWHRTSFVKPAEADIYSGKAEVDAECR
FT                   IWEDGGVEELRRAELARMHWARRWWEKMW"
FT   gene            571983..574157
FT                   /locus_tag="ANIA_07241"
FT                   /old_locus_tag="AN7241.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            571983..574157
FT                   /locus_tag="ANIA_07241"
FT                   /old_locus_tag="AN7241.4"
FT                   /note="transcript_id=CADANIAT00000203"
FT   CDS             571983..574157
FT                   /locus_tag="ANIA_07241"
FT                   /old_locus_tag="AN7241.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000203"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000203"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000203"
FT                   /db_xref="GOA:Q5AWT9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWT9"
FT                   /protein_id="CBF78786.1"
FT                   /translation="MRVTVALLCLAGSAYTASAAQYAKFRYLESSDFRIIIDAGSGALL
FT                   SIVNPHDNASMSWISGPEDTPWQPAGSRWGLGYVNLGPLHRSFWQDAIVTFNGNRVSAA
FT                   YALDGLDVNVTRTLNRDGVLEECYVFTNTGAEPLALDDHGPESFAIYTPFNDHYTSTTD
FT                   VLEHRAHAHVWANGGASSWVKLTRMGLRGPHLGIVLTQGALQGYSIEGRSRLTSSDTRG
FT                   IFLLHPAIPTLESGGSGRVCWELFWHEDWDEFFKKAKQRSSQFLHVTADRWTAAAGETV
FT                   NLTVSGQRSGEAVVLNGQRAELQLVPSGNDSYSTTIQADKQGEQEVSFTVGESEEQTNS
FT                   TITINVVPDIDTLIANRVKFITTNQQLSLDFPDESKAGAYAVYDNQMEGIVTFDTSSDR
FT                   NTGRERVGMGVLIARWLQQNPNSSPDIEDSLRIYYDYVNNKLQETDGYVRSWPIGATDG
FT                   SLRLYNWPWVMQLHLQMAKLGNKEVTSHGDYKATPSQRLLVTIERFYAEPEAIDYYPIN
FT                   LPIHESLVYFTGKRDEDTVARLLTLFTAHGDRITSVGSAYPSSEVNYEQSIIAPAAIIL
FT                   LELYRSTNESRWLDAAHGHFDRLEAFSGRQPNFHLHDVAIRHWDGYWFGKDRMWGDTFP
FT                   HYWSTLTAIAMHHYAVATGDEHYSRRAEGILRANLVLFDEEGRGYCAFIYPTSVDGRPG
FT                   SYLDPYANDQDWALAHLLALREDGLGEGDP"
FT   gene            574773..576278
FT                   /locus_tag="ANIA_07240"
FT                   /old_locus_tag="AN7240.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G17270)"
FT   mRNA            join(574773..574945,575012..575586,575636..575828,
FT                   575880..575952,576020..576053,576091..576278)
FT                   /locus_tag="ANIA_07240"
FT                   /old_locus_tag="AN7240.4"
FT                   /note="transcript_id=CADANIAT00000204"
FT   CDS             join(574773..574945,575012..575586,575636..575828,
FT                   575880..575952,576020..576053,576091..576278)
FT                   /locus_tag="ANIA_07240"
FT                   /old_locus_tag="AN7240.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_2G17270)"
FT                   /note="transcript_id=CADANIAT00000204"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000204"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000204"
FT                   /db_xref="GOA:Q5AWU0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU0"
FT                   /protein_id="CBF78788.1"
FT                   /translation="METLQIEAEPPAPRLLLLKLISSGFSFFVAGLNDGSLGALVPYIR
FT                   QEYDIDTNMVSIVYGTTFFGWFFAALTNSFLGQYFNTGVLLLLGAALQVLAHALRTWAP
FT                   PFPLFAVTFFIAALGQAYQDTHANNFVATVKGAHRWLGFIHAMYMGGCLVGPFVSTAVA
FT                   SSGKSSHWELFYTTPLGMGVVNLGLVWVAFHEWATMRQREQGGRVEGPASRKQEAATEI
FT                   KRTLATPAVWLLSLYFFFFLGAAITAGGWIVEYLVHVRNGDLDKMGYVPAGFYGGSFIG
FT                   RLVLAEPTYRFGERRMILLYVVLCLALELVFWLVPNIITEAVAISLLGLFSGPFFATLF
FT                   AAEIRSPALVPLTTAAFIFLMGQIGGSIFPAVTGVIAARSGVKVLQPMLVGLLGATGVS
FT                   WLIIPKPRLHHD"
FT   gene            complement(576520..577292)
FT                   /locus_tag="ANIA_07239"
FT                   /old_locus_tag="AN7239.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(576520..576546,576621..577292))
FT                   /locus_tag="ANIA_07239"
FT                   /old_locus_tag="AN7239.4"
FT                   /note="transcript_id=CADANIAT00000205"
FT   CDS             complement(join(576520..576546,576621..577292))
FT                   /locus_tag="ANIA_07239"
FT                   /old_locus_tag="AN7239.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000205"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000205"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000205"
FT                   /db_xref="GOA:Q5AWU1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU1"
FT                   /protein_id="CBF78790.1"
FT                   /translation="MESTLHRMSQSPHPQLSRLSRAWRNETFPIRHPETGKLLLEIERS
FT                   ASTLFGIFTSGVQLTCFVDDPDRGLLLWIARRSLTKQTYPGLLDNTAAGGLETRFWEKP
FT                   VEAVVREAVEEASLDEDLVRRGLCGGGAISYYHVKRPSERCEAGPLQPEVEYVYELRLD
FT                   PSTMPVPGDGEVEGFYLWTVEEVMRALREGEFKLNSAVAVIDFLVRHGVVTAENEAGYL
FT                   EIWMPKRIRL"
FT   gene            complement(578625..580063)
FT                   /locus_tag="ANIA_07238"
FT                   /old_locus_tag="AN7238.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(578625..578677,579036..579290,
FT                   579342..579753,579800..580063))
FT                   /locus_tag="ANIA_07238"
FT                   /old_locus_tag="AN7238.4"
FT                   /note="transcript_id=CADANIAT00000206"
FT   CDS             complement(join(578625..578677,579036..579290,
FT                   579342..579753,579800..580063))
FT                   /locus_tag="ANIA_07238"
FT                   /old_locus_tag="AN7238.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000206"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000206"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000206"
FT                   /db_xref="GOA:Q5AWU2"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU2"
FT                   /protein_id="CBF78791.1"
FT                   /translation="MASHSIQTIGVIGTGVIGSSWTALFLSRGLKVIVTDPAPEAETKL
FT                   RDYLEKTCPLVPGCTLTLETCLSNLTFVTNIDPYLEIVDFIQESGNLIVVNQNGPERLP
FT                   IKRSLIAHLDALTPRHIPIVSSSSGIPSSMFIADCKNNPARILIGHPFNPPHLVPLVEI
FT                   VPHPRTANEHIAAAYDFYKSLDKDPVIVRQETPGFIANRLQAALCAEAYSLIERGVVSP
FT                   EDLDKTMTSGLGLRWAVTGPVMTNTLGGGGDFGHFMDHLGPALKYWLGDMHKHGFDFES
FT                   QEKTDDLKKRVSVWVSNLDLSDLERRRDEVSEYSLMLTYSRIITLP"
FT   gene            580781..582621
FT                   /locus_tag="ANIA_07237"
FT                   /old_locus_tag="AN7237.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(580781..581740,581827..582621)
FT                   /locus_tag="ANIA_07237"
FT                   /old_locus_tag="AN7237.4"
FT                   /note="transcript_id=CADANIAT00000207"
FT   CDS             join(580781..581740,581827..582621)
FT                   /locus_tag="ANIA_07237"
FT                   /old_locus_tag="AN7237.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000207"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000207"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000207"
FT                   /db_xref="GOA:Q5AWU3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU3"
FT                   /protein_id="CBF78793.1"
FT                   /translation="MPHETVPSDTIYGPGTYVDETFLPAPQDACRIFEYLASSTPGFTT
FT                   DRALWETIHFSGSEHPVIPGPIKAPLVSAALHAMCGVVAHEIVQDRDGTPAASQTVNVN
FT                   TDHAAIWLGTVLAATLNVDGTRKDMSEVARSGELRSLFDRDFEGGFMSTPMRQRTTALY
FT                   KTATPGVWYQLHGSLDAPPVLRALGIDPEYPAKTSHEAYKHIAQRIEQWTADELEMLNI
FT                   KNGFCGSICFTPKGWSETLMGKRLASHPLVNYKRQTHAIPTPVVPWRQVEDGDDRRPLA
FT                   GIKVVELVRIIAGPIIGSTLAAFGADVIRVNCSRLVDLNVLQLTLNAGKRTIDLDLTLE
FT                   SDRTRLRELLADADVFVQGFRPNAIARKGFGVNDLLEIAGHRGKGIVYVEENCYGPDGP
FT                   YHERPGWQQIGDAASGSSYVMGRSLGYKDGTSVLPPLPISDMNTGLIGALGTLMALRDR
FT                   ARYGGSYRVASSLVKADVIALEPEVGLYSPAVVEKASEIFQWGHIGPEQFVTEILLVVM
FT                   DGWKRVFPQYFGTGEESLLTSFESGEGPWVNMSILRPVVRLGDEGVSPRWLTPSVPNCF
FT                   HDKGIQWL"
FT   gene            complement(584042..584680)
FT                   /locus_tag="ANIA_07236"
FT                   /old_locus_tag="AN7236.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(584042..584680)
FT                   /locus_tag="ANIA_07236"
FT                   /old_locus_tag="AN7236.4"
FT                   /note="transcript_id=CADANIAT00000208"
FT   CDS             complement(584042..584680)
FT                   /locus_tag="ANIA_07236"
FT                   /old_locus_tag="AN7236.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000208"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000208"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000208"
FT                   /db_xref="GOA:Q5AWU4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU4"
FT                   /protein_id="CBF78795.1"
FT                   /translation="MSSLYSDCSAMSFRTKARYIEATVASSTASFAASNAATNYATATT
FT                   YIRTALEAIAKTATGRMDAESCAAVLGGCLVGAETAASEAAKAAENARAAAVIAEEAAS
FT                   AATEIAYINVSGWALNESFSAGTDNISVLDDEEFETDSVLAEWTALKADWAKYPGEEEV
FT                   EDEDNEYDTPCSTGSYASLYTLAHDETIKAQHPGFIVIGASAKPSFSKD"
FT   gene            complement(585849..587070)
FT                   /locus_tag="ANIA_07235"
FT                   /old_locus_tag="AN7235.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(585849..586883,586963..587070))
FT                   /locus_tag="ANIA_07235"
FT                   /old_locus_tag="AN7235.4"
FT                   /note="transcript_id=CADANIAT00000209"
FT   CDS             complement(join(585849..586883,586963..587070))
FT                   /locus_tag="ANIA_07235"
FT                   /old_locus_tag="AN7235.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000209"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000209"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000209"
FT                   /db_xref="GOA:Q5AWU5"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU5"
FT                   /protein_id="CBF78797.1"
FT                   /translation="MFRKIDVALWAALAAHQVPFCSGYNFAPDQDPSITDPRIPVLFDV
FT                   PVPEKLLPSPANPVAGHWTSSFLTTTTGSQYFFASGVVLSSPEQTAGYGFSLLDLATLN
FT                   RVTHSNMTTLAHAGIAPINFISTAYAISSLPPDDAAIAVHGIADNISVDLTVHQTSRAL
FT                   YYGGSGAWMYVDKPLYGWAMPAASTSGNISMPIPPGASPADEDDIDVEIATEIIDPSAS
FT                   LTWYDHLWGHLDLQAGNLTWFNLFVNDRPGGELNLALVSYMLDSIEPPFFSRSIHVRSR
FT                   NRNESGLAIIPVDRFEPITDPNTVWKSPRSGLVYPQRWELGIEGRGLLEISSVLGDQEM
FT                   VDPGSGAVTYLGFVTVKGVIDGKNVTGYGSAEVKFVQRLP"
FT   gene            complement(588633..589316)
FT                   /locus_tag="ANIA_07234"
FT                   /old_locus_tag="AN7234.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(588633..589316)
FT                   /locus_tag="ANIA_07234"
FT                   /old_locus_tag="AN7234.4"
FT                   /note="transcript_id=CADANIAT00000210"
FT   CDS             complement(588633..589316)
FT                   /locus_tag="ANIA_07234"
FT                   /old_locus_tag="AN7234.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000210"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000210"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000210"
FT                   /db_xref="GOA:Q5AWU6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU6"
FT                   /protein_id="CBF78799.1"
FT                   /translation="MASYMPLAVYIHDGESHRTYTTTPFNVRNTVTNSNNPNSVNGNIT
FT                   RNIAYNITNTIMHVNASTSGLVPATQHFLDDRTRRIHQQVRALSPFPGMFEHGHGIHES
FT                   PDGFLRPAQGWICGFIDYKVAIFVKPEGDYFAARMFYQMRMGDLFELERMANERNTPRV
FT                   GSFGHGLWLAPDGSLKFGYGIVMQAFRNAILAILQTPSEPDAAPVTGFAGKDPHPAYRP
FT                   VLRFG"
FT   gene            complement(591162..592197)
FT                   /locus_tag="ANIA_07233"
FT                   /old_locus_tag="AN7233.4"
FT                   /product="alpha/beta hydrolase, putative (AFU_orthologue;
FT                   AFUA_7G06650)"
FT   mRNA            complement(join(591162..591338,591393..591746,
FT                   591832..592197))
FT                   /locus_tag="ANIA_07233"
FT                   /old_locus_tag="AN7233.4"
FT                   /note="transcript_id=CADANIAT00000211"
FT   CDS             complement(join(591162..591338,591393..591746,
FT                   591832..592197))
FT                   /locus_tag="ANIA_07233"
FT                   /old_locus_tag="AN7233.4"
FT                   /product="alpha/beta hydrolase, putative (AFU_orthologue;
FT                   AFUA_7G06650)"
FT                   /note="transcript_id=CADANIAT00000211"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000211"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000211"
FT                   /db_xref="GOA:Q5AWU7"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU7"
FT                   /protein_id="CBF78801.1"
FT                   /translation="MPTTQTIRVPHLGGISAGYALSGDKYDASKPTCVLINSMCMTTAL
FT                   YNDQFEDASLTSAVNLLAIEPLGHGSTSCATEHFTYWDSAIMALQVLDALGIQNAFALG
FT                   TSQGGWIVTRMALLAPERVLGLILLGTSMDYESVDSRSKGCWDPLPLLKPFFDGWTSDA
FT                   PTPDFVVEETWCKMVGAVGFGTFATEERVNFWTKTLQEVYRGDEGRKKVRMALTCLLER
FT                   DGLLLRLVDIKCPVYWLQGTDDTPFATTVPAEQIKLFTRSKEAKLEIIEGGAHYLNATH
FT                   PKQVDEAILELVKKYAV"
FT   gene            593987..595255
FT                   /locus_tag="ANIA_07232"
FT                   /old_locus_tag="AN7232.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(593987..594163,594193..594671,594751..595255)
FT                   /locus_tag="ANIA_07232"
FT                   /old_locus_tag="AN7232.4"
FT                   /note="transcript_id=CADANIAT00000212"
FT   CDS             join(593987..594163,594193..594671,594751..595255)
FT                   /locus_tag="ANIA_07232"
FT                   /old_locus_tag="AN7232.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000212"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000212"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000212"
FT                   /db_xref="GOA:Q5AWU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU8"
FT                   /protein_id="CBF78803.1"
FT                   /translation="MADNDSLQPWTLATVVSVTVLAFVTVALRLLARYERKQKLWWDDW
FT                   MILWSMVYTPLGNVGWNLIVVAFIFLMYHNGMGLHADTMPPGKVVLVAKYLVVAEVLYV
FT                   YNLVWTKMSILLFYYRIFRFPYFKRWAYIISTFIVLWVICITFLFIFICVPVEKLWYPQ
FT                   LPGRCINQVATWIANAISTIVTDLAILMLPIPQIWSLQLRSSEKMALTFAFGLGFFVVF
FT                   ASAYRFSVLFSYDPLDSTYTLAPTVGWTAIEMSAGIVSACLPTLRPAFHFFFRILGLQS
FT                   IMPSLLRTGQSQTTTTNIVGNDVSLGTSKTAQTSAGRANRRSFYHLPDEDDSLESEHGS
FT                   PPFRPEYDSAHTKIVVQGKGQEGDLTGDEVPLQGIRVQREFTQRDS"
FT   gene            598345..599904
FT                   /locus_tag="ANIA_07231"
FT                   /old_locus_tag="AN7231.4"
FT                   /product="hypothetical serine carboxypeptidase (Eurofung)"
FT   mRNA            598345..599904
FT                   /locus_tag="ANIA_07231"
FT                   /old_locus_tag="AN7231.4"
FT                   /note="transcript_id=CADANIAT00000213"
FT   CDS             598345..599904
FT                   /locus_tag="ANIA_07231"
FT                   /old_locus_tag="AN7231.4"
FT                   /product="hypothetical serine carboxypeptidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000213"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000213"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000213"
FT                   /db_xref="GOA:Q5AWU9"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWU9"
FT                   /protein_id="CBF78805.1"
FT                   /translation="MLLSLLPLFAGVSLAATYQAYNFSVPIDHFHNETRYAPHSNGTFN
FT                   LRYWFDSTYYQPGGPVFVIAAGETDGEDRFEFLSQGIVTQLAEAYNGLGVILEHRYYGE
FT                   SYPFPGADVTVDELRFLSTEQSLADYAYFAKHVIFPGLEAYDLTAPNTPWIAYGGSYAG
FT                   AQVAFMRKLYPSIFHGAVSSSGVTAAIIDYWKYFEPIRNYGPRDCIESIQTLTDLIDRI
FT                   LIDHPGNRTLHAQLQSAFGVNPAIDNRDFVNMLSTPLGSFQSRNWDPSVGSYEFRHYCD
FT                   NITSTEPLYPANNATALLPGLVKAAGYNASNTTLLSSFRNSIGYISSSSSSAESESAED
FT                   DNDNGTSLPKSSGTSWNYQVCTEWGYFMPGSSVPPNIKPLISRLIDLNYTSSFCASSYK
FT                   IPFPPNVTLINQHGGFNFSYPRVAIIGGTADPWRDATPHAEGLPGRESTDEEPFILIDI
FT                   EPEHVWDGIRGAVHHWDQNGLPEGANESEGVEVPEEIVAVQKEIVRFVGGWLDSFEAGE
FT                   DL"
FT   gene            complement(600202..602922)
FT                   /locus_tag="ANIA_07230"
FT                   /old_locus_tag="AN7230.4"
FT                   /product="cellobiose dehydrogenase (AFU_orthologue;
FT                   AFUA_2G17620)"
FT   mRNA            complement(join(600202..600812,600873..600966,
FT                   601042..601166,601229..602561,602640..602770,
FT                   602874..602922))
FT                   /locus_tag="ANIA_07230"
FT                   /old_locus_tag="AN7230.4"
FT                   /note="transcript_id=CADANIAT00000214"
FT   CDS             complement(join(600202..600812,600873..600966,
FT                   601042..601166,601229..602561,602640..602770,
FT                   602874..602922))
FT                   /locus_tag="ANIA_07230"
FT                   /old_locus_tag="AN7230.4"
FT                   /product="cellobiose dehydrogenase (AFU_orthologue;
FT                   AFUA_2G17620)"
FT                   /note="transcript_id=CADANIAT00000214"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000214"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000214"
FT                   /db_xref="GOA:Q5AWV0"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR015920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWV0"
FT                   /protein_id="CBF78806.1"
FT                   /translation="MHSFLRSFAALVAAGSDPDTGIVFDTWTVEASSSSAGFTFGVSLP
FT                   EDALDTDATEFIGYLSCSSSSTSEFTGWCGLSMGSSMNSNLLLVAYAQDDTVLTSFRFS
FT                   SGYAMPSVYSGNATLTQISSTVTADKFEVLFRCEECLRWDHEGVSGSATTSAGQLILAW
FT                   AQAEESPTNADCPDDLSLVQHEAQGIWVGKLSGDAATSNYETWAALATNVVDGTCGTDG
FT                   GGGGDNGNGTTPGVPVPTNVTYDYIIVGSGPAGMVLADRLSEAGAKTLLIEKGPPSIGL
FT                   WNGTMKPDWLNGTDLTRFDVPGLCNEIWKNSDGIACPDNDQMAGCLVGGGTAVNSGLWW
FT                   KPYSKDFDESFPETWKYDDVRDAVTRVFTRIPGTTTPSTDNRLYLAEGPSVIMNGLLAS
FT                   GWKGTTFNDEPEEKYKSVGYSPYMFSHGQRNGPMATYLLDAYQRPNFDLWVNTVVRRVV
FT                   RDGATVTGVEVEPFNDGGYEGSLQLNEGGRVILSAGAFGTPKILFRSGIGPEDQLAIVN
FT                   GSASDGETMISEDQWINLPVGENLMDHPNTEIVVQHPDVVFYDYYAAYDDPIEADAQSY
FT                   LVNRTGPLAQSAPNVNPVFFDQVTGSDNVTRQLQYQARVEGSHNVADGHTISISQYVGR
FT                   GQTSRGKLTITSALNTVVSTLPWLQDDNDTDAVIAGLERLRDSLSTIQGLTWAYPKANV
FT                   SMAEHVNSMAKTGRGSNHWMGSCKMGPDDGRDGGSSVVDLNTKVYGMDNLFVVDASIFP
FT                   GMISTNPSAYITVVAERAAERILALQG"
FT   gene            complement(604013..606865)
FT                   /locus_tag="ANIA_07229"
FT                   /old_locus_tag="AN7229.4"
FT                   /product="sulfatase domain protein (AFU_orthologue;
FT                   AFUA_2G17610)"
FT   mRNA            complement(join(604013..606483,606540..606865))
FT                   /locus_tag="ANIA_07229"
FT                   /old_locus_tag="AN7229.4"
FT                   /note="transcript_id=CADANIAT00000215"
FT   CDS             complement(join(604032..606483,606540..606865))
FT                   /locus_tag="ANIA_07229"
FT                   /old_locus_tag="AN7229.4"
FT                   /product="sulfatase domain protein (AFU_orthologue;
FT                   AFUA_2G17610)"
FT                   /note="transcript_id=CADANIAT00000215"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000215"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000215"
FT                   /db_xref="GOA:Q5AWV1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWV1"
FT                   /protein_id="CBF78807.1"
FT                   /translation="MRTVHQLKLYRSCISVWNRLRSSPAAFFDVFWDWTRRFFFTLSLL
FT                   ALFSAKSLHLYAHLHSLPADKFLLWGVTFFTQDVACTLLIRICTQKFPWRWLDALAALV
FT                   VIPFSLTMSGMASANISFFVTAGAEINWRQAKSFHRDAAAIRTLLTGLTGFLIVEAIMT
FT                   VIAWLVAPFLHRLVGGVLHILAEPFKILFRPLFTRAASLSSRIWRRRLGSETLPDPDVY
FT                   EQIAVEDYHDYKSDEEDEYSDYSQRPPQRISLIKRLVVWLPLLCLGLLRSVRPPYPSYI
FT                   FLSSALPMTPFAGMHRPTLGEQAGNIPDYAWLEGKTSLGKPPNWDWMPEETLPGFRDWH
FT                   NKREHYTPSQDPLHLSNLQAPVLDELKDVLASGEVNIKHVILLKLESTRGDVFPLRNGS
FT                   FMWNKIVDSFDGKEMPESAVRTVANLTRTAEYLTGFDSGFDQYRDGERKSYGGISASNA
FT                   FTTGTYTIKSVAGTVCGISPLVADFNREYKYHLYNPCMPHVVNALSHQADITNGSDYRT
FT                   WPWESIWMQSVTDTYDHQDLLTPRLGFRDIYTKERIENPGAKHYPVKSKEVNYYGYPDT
FT                   ELKEYIRDAFDDAEENNKRLFLAHLTGTTHHPWGMPDDNYENIMGPSFKGKNNDMNKYL
FT                   NTIGFADRWIAQILDILEEKGVRNETLLVMAGDHGLSLPNDGGITPYSNPHIGSFHVPI
FT                   VLAHPKLPSIEVKDPVISLQIVPTIIDLLIESSSLGPNSTQAARDIRGLYEGQSLIRPL
FT                   FQEANGMQDWQFSVMNTGGSWLAVRSAARPQWRIVVPLIDDVEWRFTDIEKDPQETKPL
FT                   TSFSFFDLMDTLWREYRDDKSNTPEEHDEEPVERDGHEFFKHPPPPPPPGHHPHHPPPP
FT                   GGGPPPPPITITPSRPHPEDAPWEPEVVRWARDAAHMAEWWIADNHRRYGYKKP"
FT   gene            complement(608234..610119)
FT                   /locus_tag="ANIA_07228"
FT                   /old_locus_tag="AN7228.4"
FT                   /product="flavin-binding monooxygenase, putative
FT                   (AFU_orthologue; AFUA_2G17490)"
FT   mRNA            complement(join(608234..609327,609402..609800,
FT                   609853..609972,610035..610119))
FT                   /locus_tag="ANIA_07228"
FT                   /old_locus_tag="AN7228.4"
FT                   /note="transcript_id=CADANIAT00000216"
FT   CDS             complement(join(608234..609327,609402..609800,
FT                   609853..609972,610035..610119))
FT                   /locus_tag="ANIA_07228"
FT                   /old_locus_tag="AN7228.4"
FT                   /product="flavin-binding monooxygenase, putative
FT                   (AFU_orthologue; AFUA_2G17490)"
FT                   /note="transcript_id=CADANIAT00000216"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000216"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000216"
FT                   /db_xref="GOA:Q5AWV2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWV2"
FT                   /protein_id="CBF78809.1"
FT                   /translation="MGSATINQPVGNTDYTQSTVAIIGAGISGMCMAIDLLRRNHRNFV
FT                   ILEKGSSVGGTWNDNKYPGCACDVWSALYSYSFEQRSTWTREYPGQEEILHYLTGIAGK
FT                   YGLYPHIRFNSTVEEARWDDEARKWKIKVSVSGAKDAQFQEGYELSANVLISGVGQLNQ
FT                   PAWPNIDGMNEFKGKSMHSARWDWTYDFKGKRIAVIGNGATATQIVPEVAKTASHLTVY
FT                   QRTPQWIIPRDDKPVHPAQKALLSFPFFRNCKRSFMMLYREMSHDFIVKSDAKNSQEVR
FT                   ELCIGHIKKGLPSKPELWDVLTPSYPPGCRRILASDDYYPALGRENVKLDTRNIQRITE
FT                   TGIQTADGETTDFDLIVYATGFRTVEFLHPIKVYGAGGRDLAEIWDGGATAYYGVTVEE
FT                   MPNFGLLYGPNTNLGHNSIILMIEAQSRYLAALIDPVIRAKEAGVSLAIQPKTEIVRAF
FT                   NADIQKRLGKSNFADPACNSWYKTADGRITNNWPGTVVEYQQALSRVRWTDYIVDEETM
FT                   KFVGKNETRIGHVEEVWPVSKSTLLLGLSVAVAAGGWYLQGARASRRR"
FT   gene            complement(611069..612698)
FT                   /locus_tag="ANIA_07227"
FT                   /old_locus_tag="AN7227.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(611069..611681,611739..611954,
FT                   612004..612201,612353..612459,612537..612698))
FT                   /locus_tag="ANIA_07227"
FT                   /old_locus_tag="AN7227.4"
FT                   /note="transcript_id=CADANIAT00000217"
FT   CDS             complement(join(611069..611681,611739..611954,
FT                   612004..612201,612353..612459,612537..612698))
FT                   /locus_tag="ANIA_07227"
FT                   /old_locus_tag="AN7227.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000217"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000217"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000217"
FT                   /db_xref="GOA:C8VCY5"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCY5"
FT                   /protein_id="CBF78811.1"
FT                   /translation="MPRAPSSTFPSPNVSYTILLAFGWSEIKAPISVLSLDCSSTIIRL
FT                   LQARSAIAATGSLLVILVITPTFDQLRPLGAFPPPPPPPSSSTFRMSTATVTESVTITK
FT                   DNVRMRLDGRDPKFGDFRDDLARDGFAVVKGAIPRERALKYADEMHSWLEGFNLGYDRN
FT                   DPSTVHKDRLPLINEKGMCMHYSVAHEKFVWDVRSEPGVVEAFEKVYNNKDLIVSFDAV
FT                   NFGFPNRTDLPPNKPWPHQDQDPDKPDFRCLQGLVNLLPNGPNDGGLIVCRGAHLLSDE
FT                   FHSDPVIRAEERIPAWTPEWYGFTETGMKWLADHNCEWVKVCAEPGDILLWDSRTPHYN
FT                   LSPKGQTPRFCIYTCYMPVADASQEDLVRKKESFENRLGTTHWPNANHTGSNVATRDGK
FT                   ECPYNRFKPVMEPVLNERAFRLTGIPYLRSQA"
FT   gene            612968..613975
FT                   /locus_tag="ANIA_10916"
FT                   /old_locus_tag="AN10916.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(612968..613082,613197..613346,613397..613508,
FT                   613553..613592,613645..613827,613871..613975)
FT                   /locus_tag="ANIA_10916"
FT                   /old_locus_tag="AN10916.4"
FT                   /note="transcript_id=CADANIAT00000218"
FT   CDS             join(612968..613082,613197..613346,613397..613508,
FT                   613553..613592,613645..613827,613871..613975)
FT                   /locus_tag="ANIA_10916"
FT                   /old_locus_tag="AN10916.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000218"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000218"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000218"
FT                   /db_xref="GOA:C8VCY6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCY6"
FT                   /protein_id="CBF78813.1"
FT                   /translation="MACKYKSPFAFRLTVSRHSVLRKYVLEDEITPLPTGHSDILEEQE
FT                   PEFCSKINPRSPFTSMMVAHDCRLIMGPGRQGEVFGIVALLPDERMNEDPNAKQSWVSE
FT                   GSLEKMLDTFSEFPDWIISIFKHSRDLGLWQLHDINPLRTWYRGRVLLIGDAAHAMLPT
FT                   QGQGASQAIEDAEALGAFFAEQADSPSGEEIGRIFEVDVFRSRHNRAGLIQAYSRQAAK
FT                   PGTAKGAKTVTM"
FT   gene            614438..617513
FT                   /locus_tag="ANIA_10910"
FT                   /old_locus_tag="AN10910.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT   mRNA            join(614438..614642,614693..614747,614796..614928,
FT                   614980..615554,615607..616036,616085..616219,
FT                   616257..616387,616436..617513)
FT                   /locus_tag="ANIA_10910"
FT                   /old_locus_tag="AN10910.4"
FT                   /note="transcript_id=CADANIAT00000219"
FT   CDS             join(614438..614642,614693..614747,614796..614928,
FT                   614980..615554,615607..616036,616085..616219,
FT                   616257..616387,616436..617513)
FT                   /locus_tag="ANIA_10910"
FT                   /old_locus_tag="AN10910.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000219"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000219"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000219"
FT                   /db_xref="GOA:C8VCY7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCY7"
FT                   /protein_id="CBF78815.1"
FT                   /translation="MVQLLLLHMPFCTHRTIFSDRYITIKNASMSFPSKAPRVTKDAAS
FT                   LHQCPECDRAYERPDHLARHLDSHRNERNFHCPTCHRGFNRRDVLQRHRLIHTSGTPLS
FT                   KHAGRAVEACEQCAIAKASCDNDSPCNRCQRKGIPCIPRKQRHRCFRTMAKATPEAETP
FT                   QGQGGSEPGVDLSTTPRTESIAHSENRQAPPALEAGMNPLYSTASLASPVISFPTGISD
FT                   QSNPVDNLSEFPAFFEHVMMPSDLFSTGVPGVQQPRGVLDIMCDPGFTSADANLFGSGI
FT                   ITDLDKILEYNLSPAPTSSDQELNTEEESTKKRVAAFRKSLWLRVPEKNQNGFSGDGQI
FT                   PLRDGDMTASISSLHRSRLEALNIRGKLTQQMRDNIFQLVLATGGSRLSVPSFPTAESL
FT                   DALIKIGISKRTETDAWIHPYTLYRQDSRPELLTALTAAGCVCSAIPSVGKAGVLLLEI
FT                   VRVSLADLVESDNSVLRDLQYFQASMMWLDIGIFCGYKRKMQIAESHLQPLCTDQALRR
FT                   AGTFDRSFYSDNQPVQALGGESIEDAWLQWIQQESLKRLAYHLFGHDVEVAAAMNRPAL
FT                   TSYAEFTVPFPSARDLWLAPTATAWKELLETKYSHAVSSNLSLRDLLSDLSILNDLPVN
FT                   IDTGVVNSAVLHGLMSQVLMFRQQASLSDSRTNDQPVTRLWLQTRQDDLYGTLLSLEEL
FT                   KANQDIARSQCIKTVSENIVDAPPLATLICEFAMMHLHVNLDSIQRFAGQFGEMEARRE
FT                   YPKLREWALTKEARTSIWHAGQVLRAARLVLPFQLRGFDSLAIYHAILVLWVFGLLCCG
FT                   EKQRDNNTNPTSGHPNLVVSLDGPETELIKSFINRSVGQHGLTLHFAGAENSTVFCPLS
FT                   SPRLVMDVGRQVYEGNFQGATDYVPPLVENLRNLIHELGSLP"
FT   gene            617755..619609
FT                   /locus_tag="ANIA_07225"
FT                   /old_locus_tag="AN7225.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(617755..617947,618096..618158,618254..618354,
FT                   618407..619609)
FT                   /locus_tag="ANIA_07225"
FT                   /old_locus_tag="AN7225.4"
FT                   /note="transcript_id=CADANIAT00000220"
FT   CDS             join(617755..617947,618096..618158,618254..618354,
FT                   618407..619609)
FT                   /locus_tag="ANIA_07225"
FT                   /old_locus_tag="AN7225.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000220"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000220"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000220"
FT                   /db_xref="GOA:Q5AWV5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWV5"
FT                   /protein_id="CBF78816.1"
FT                   /translation="MEEKGAIELAESVEVGKPDVELGQVLVDGEGQVQRLPVPSKDPND
FT                   PLNYTRWEKVGIIVSCCWFFWLSTFPSLFVGVGRSIHSSHFLLAATIGCAVCNTWEQHL
FT                   GLRILQGLSAGVTESVLPLILAEVTFVHQHGMVYGMYWAAQSTITGCLNLAASYEVAAL
FT                   GWRWYYWVFAITVAVGLLLVIVFGLETSYQRSSQFVHGRMVVTDQFGVTRVLSEDETRQ
FT                   YLGTHGHPYSRDDGHIPEELRPKKTYFQMLIPWASPTESPLILIPRTTLQIFSAFLSPG
FT                   ILYATLVASVVLGSSIGMSLSYNTVLQYNYHWPAKSIGLINLGGVFGGFGGMLYAGFFG
FT                   DKFIVWMAKRNGGIHTPEHRLPLLILPGILGVVALLLYGLTADGSATWSGPYMGWTLFQ
FT                   ITFVSVLILSTSFAAEAWEKNPGPAIVAVVGVKNIVAFALSYGINPMTELYDYPVAMGI
FT                   LAAIVGGVFLLGVPVYFLNPRVSSSVSSLSPEFKMRSNEGHLSQWRRWMDMKERRQRRT
FT                   AN"
FT   gene            complement(620010..621187)
FT                   /locus_tag="ANIA_10915"
FT                   /old_locus_tag="AN10915.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(620010..620255,620340..621187))
FT                   /locus_tag="ANIA_10915"
FT                   /old_locus_tag="AN10915.4"
FT                   /note="transcript_id=CADANIAT00000221"
FT   CDS             complement(join(620010..620255,620340..621119))
FT                   /locus_tag="ANIA_10915"
FT                   /old_locus_tag="AN10915.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000221"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000221"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000221"
FT                   /db_xref="GOA:C8VCY9"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCY9"
FT                   /protein_id="CBF78818.1"
FT                   /translation="MLPWVHPHLAQSVNPDKGRQLQAAQSIQRGEVLLIDPPYAIIPIS
FT                   DVDATTSLRKAICSNPQCNKPVSRDTASRCPNRCNNDVFWCNDSCEETDKARHDFECTW
FT                   LAKYTTSLLSKWGEYNFGMLWLIVRILSRRYTESSYPHNIEDKPPAHDSHPSLSRFKFG
FT                   WPAIDSLCGTPETWSHAQVREWTVLVKKYLGSSTLPHDLSNSDVLALICKEEANSFGLY
FT                   PRETGVFPPPNPPVSRGEQFAAAVYPRASIANHSCCPNIIHKPDKVGRMVFTAGRDIAA
FT                   GEECCISYFDMTQYVSLQDRRRHLQGLFRFKCGCPRCLEEETAAADTANETHWDAFPGF
FT                   A"
FT   gene            complement(621463..622528)
FT                   /locus_tag="ANIA_10909"
FT                   /old_locus_tag="AN10909.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(621463..621676,621741..622528))
FT                   /locus_tag="ANIA_10909"
FT                   /old_locus_tag="AN10909.4"
FT                   /note="transcript_id=CADANIAT00000222"
FT   CDS             complement(join(621463..621676,621741..622528))
FT                   /locus_tag="ANIA_10909"
FT                   /old_locus_tag="AN10909.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000222"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000222"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000222"
FT                   /db_xref="GOA:C8VCZ0"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCZ0"
FT                   /protein_id="CBF78820.1"
FT                   /translation="MSFTARSLRQVLTSTSRNFHCSRTMAASDWSARQYLKFEAERTRP
FT                   ARDLLAQVPLDSPHRVVDLGCGPGNSTAVLVSRYPDARVTGMDSSPDMIGKARETLPGI
FT                   EFTVDGLSTYTPREPVDLFFSNAVFQWLPRDQRLEIIKRLIQSQPSGGVFAFQVPDNLA
FT                   EPSHVTMREIAANGPWSSTLQSVARESFQSPHELYDELKPLCAEVNIWHTYYNHSLENH
FT                   KAVVEWVKGTGLRPFIDPLSQPDRESFLKAYLGRLEQLYPNSRLQPFGSWQEQLCHTAS
FT                   PAHYPPPALVLVAVLHIVHIAEIPTLFNVSILALPLRRPWFEISLPLQQSLS"
FT   gene            623996..625652
FT                   /locus_tag="ANIA_07223"
FT                   /old_locus_tag="AN7223.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(623996..625144,625530..625652)
FT                   /locus_tag="ANIA_07223"
FT                   /old_locus_tag="AN7223.4"
FT                   /note="transcript_id=CADANIAT00000223"
FT   CDS             join(623996..625144,625530..625652)
FT                   /locus_tag="ANIA_07223"
FT                   /old_locus_tag="AN7223.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000223"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000223"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000223"
FT                   /db_xref="GOA:Q5AWV7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWV7"
FT                   /protein_id="CBF78822.1"
FT                   /translation="MAEMPAPIFSPTAATTAIVPPHRDDRPLRSSCGQCNQAKVKCSKD
FT                   RPTCRRCATRNTPCVYSISLRGIKRPRPRQEADQTCPPKEKKRVLSIPSPVSSETLPTT
FT                   TVDITVQPACPPNFGNSDIYSEGFVDDDLAGLLSLNPFDTPLSDPTAFPFSLDVPDSRL
FT                   VPSTQPAVAPQMVPHSMTIPLSPISPPSSRDGHSHYGATGPTTTTTSGLNSPVPASVTC
FT                   WCQQSISFKLTELSMPKPPSSTFILDDFLTEHRANMALCTNVLNCPDPHRTHGMILLTQ
FT                   MIALLHHMTAAFDQLLPRGDTSGQQQPPPPPPTPSSRATSTSPIDHRKEQISNANTLRA
FT                   ELAKLGVLIQEFDRRYCALDNSGFGNETFLLSPLFANLQWKTQCNSHPVQRCQTCQTPF
FT                   KQSASIRSYSVPILLGATPHNGPP"
FT   gene            complement(628209..634637)
FT                   /locus_tag="ANIA_07222"
FT                   /old_locus_tag="AN7222.4"
FT                   /product="NACHT domain protein (AFU_orthologue;
FT                   AFUA_2G01760)"
FT   mRNA            complement(join(628209..633393,633447..633722,
FT                   633919..634114,634167..634637))
FT                   /locus_tag="ANIA_07222"
FT                   /old_locus_tag="AN7222.4"
FT                   /note="transcript_id=CADANIAT00000224"
FT   CDS             complement(join(628292..633393,633447..633722,
FT                   633919..634114,634167..634637))
FT                   /locus_tag="ANIA_07222"
FT                   /old_locus_tag="AN7222.4"
FT                   /product="NACHT domain protein (AFU_orthologue;
FT                   AFUA_2G01760)"
FT                   /note="transcript_id=CADANIAT00000224"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000224"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000224"
FT                   /db_xref="GOA:C8VCZ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCZ2"
FT                   /protein_id="CBF78824.1"
FT                   /translation="MAPSILSPITSTMDGIFRQKRISNSRRVSGLQDGESVTSGVARSV
FT                   HSPRVTSRRFNSMGTTNISSVVTSLQRRSGEELGTNTSSRLLTATHASILEWIRSERMS
FT                   LLPPEGSDYDKVLAWAQLFIDRLHSFDMAIEQFAGDSYLAAQLSYGYCAMLLELGRENA
FT                   AALMLSFGFFYSISMTLVNLLERTELFGVSQDIQEQLILALADLVTLVASVSTHFHKAI
FT                   LSEVKAIRAWLAPEDRVVESIADHNSHLAHDREELTCLWLGPYLTRFLKTQQRHLSITG
FT                   QPGSGKTVLASVIVDHLQHPHGGVSYQALHVPINGRIAVQTSSLAIAKTILSQFFEKRI
FT                   GNVQLFRILSDALHRSKVTADYETYDNLLWDTVEQALASALKGAKGLVLVVDGVDEATC
FT                   GEEQLLQRLIRASTQSSNVRLITLGSRNPPEAPGQARVRITEDIIFEDISAVVRGCFGN
FT                   SQAFKGLSAIEQETVVERITAASKGSFLIAKLITKRVRREQSTESLRKSVDSLISAKPA
FT                   VTDFVLHSLQQAEATTEAKLMLLWLATVERPLHVQELSALASIQTEKQTISDTRVDILH
FT                   ALKPFNSLVFLQYDYVSLRHGLIRSAVVEIFTQGKLVPSLKDRHSDLLARLLVYIKTTI
FT                   TEQHEPSSVPSLDHQETNMLLGKYPLLEFSLRYWVSVFRQTTVFTKDGEPAASKTIAKL
FT                   LPTSTVVVRLLRTVLDNVSTPILVTFQTLITNVYRTILTTENVTTLQAIITLATLLRQV
FT                   NRPETFTLFYEAANLSQKLLTARHIVTQQMVTTFLEITTESITEAKTDIMIKREEMLQV
FT                   LVQSYKLHYGNTSEKVIAVLEQLAEHYRKVKDIKRAETIIADIQSITSTDYGSSTAGST
FT                   GSLDIRLVGRGKPGYEGGYILRLDLEEEDDLLETTESLEVEALIERAKKYIEEGRVDLA
FT                   ERLYVEYWQRATREARVHSSAVWDEKKLKIILAYSVFLRTEKREHEASSVLTSFWQDYQ
FT                   QTSVSLSESSVVHLEEIAKVMKSVRLSTTALSVFKQISEYYQSTRRTETSSYQQVQQLL
FT                   HSTSQEIIKSATSASIVSESTLEEMILEVSTSSTSINQTFYSSTETLAALYISQRRWQQ
FT                   ASRMIKRILHNTWASFFAATLQDVTLPQKHVDSSLVLAERLAQCYHSRHRLAKEQDTRL
FT                   RIYYAVRSGLSVEDKLRQHHVSELLRLLERTSQTELTISVYQELLNDYAKHYGPDHPTV
FT                   IQTLRTLAELTRPRPIFLDYYQQIIQALNKDGKYHPESLEPLDIVAAELWNQGRYSEAL
FT                   HYCHILYTAWLNHPKLSPKFQDEKFVKGIFTRYTQCLRAVRTEYSALHKVTLDYQEKCK
FT                   AVFSATASVTVQATLTLAQLCQESKHYEVEAIRLYEELLKINSSEVQLDEIRATLDSLY
FT                   EEQSAILSNSQLTESASSTQVEQAVRVLKKRITTLRESYGWAHEESLLRMKEVISFYSR
FT                   QSKTEQVVQELQEATVHILSSETSTTRLSEAAATIVSSYIETKQTQKAVELTNEVYRQI
FT                   IRKDTTNVKSSKFDLTTKSRQSLIFLAQLEHHLYRQTSTVTEILASLTTELVYFEEFQQ
FT                   LIRSNSTFLSASASAARLHYFLVANKRQHVAAEITNEFITYLLANEGKRVGFKSTEEVK
FT                   VFVMMVLSYFSTRHSKDIVRSIGIASNSHVRELIKLNKFEEACELALASFKYIAAQSSY
FT                   RHPAIARFVLALSINVSGRGLHLNEATRKRMLAVSATIIQDVLKVLGELKINLAQVGLE
FT                   HLNSLIGVLGEQADYPTLAAVLTSIWHSREAQRDWDPYITLSLGRLYIMARYFVGDTTA
FT                   AVRLAEDIVYNCRRVHGARHPSTLQMSILLSQLYTGIGQRYQAHKDAQELANRYYKRAA
FT                   ALHENILRALSDPTFADLDGSLDGGMSTDGSVIDLDSDLANAALSDDQVRQHFRLFKLA
FT                   IQRLGGWPKDYSEYERLNADLFREYPDALKGIEGVEKWDLKSFGAGKAESDEDQVDVNF
FT                   SDWRLFGESQLVHSANGVNGAE"
FT   gene            635738..636598
FT                   /locus_tag="ANIA_07221"
FT                   /old_locus_tag="AN7221.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(635738..635825,636072..636187,636396..636440,
FT                   636479..636598)
FT                   /locus_tag="ANIA_07221"
FT                   /old_locus_tag="AN7221.4"
FT                   /note="transcript_id=CADANIAT00000225"
FT   CDS             join(635738..635825,636072..636187,636396..636440,
FT                   636479..636598)
FT                   /locus_tag="ANIA_07221"
FT                   /old_locus_tag="AN7221.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000225"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000225"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000225"
FT                   /db_xref="GOA:Q5AWV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWV9"
FT                   /protein_id="CBF78826.1"
FT                   /translation="MSQMVVPTRTGEILSVDEMKKMGMELEIVGISGVPDVGPSWCSIL
FT                   LEVNAILATGTPQRIVQWSESQTYYQRDMFAFIHFSLLMLLRLQLFRIPGLTAMNTPGH
FT                   WRTCARTSREDIAIAIAA"
FT   gene            638383..638712
FT                   /locus_tag="ANIA_11551"
FT                   /old_locus_tag="AN11551.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(638383..638512,638555..638712)
FT                   /locus_tag="ANIA_11551"
FT                   /old_locus_tag="AN11551.4"
FT                   /note="transcript_id=CADANIAT00000226"
FT   CDS             join(638383..638512,638555..638712)
FT                   /locus_tag="ANIA_11551"
FT                   /old_locus_tag="AN11551.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000226"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000226"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000226"
FT                   /db_xref="GOA:C8VCZ4"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCZ4"
FT                   /protein_id="CBF78827.1"
FT                   /translation="MHYSKTATACTINHRPQLPAAASRLAGPDDEFSLSGLANRCHNSK
FT                   LQVPASICGAPKRKHIVTRPRLANSRQHSPIIILRATHRYEGGEKLGGMQ"
FT   gene            complement(639687..640296)
FT                   /locus_tag="ANIA_07220"
FT                   /old_locus_tag="AN7220.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(639687..639795,639863..640296))
FT                   /locus_tag="ANIA_07220"
FT                   /old_locus_tag="AN7220.4"
FT                   /note="transcript_id=CADANIAT00000227"
FT   CDS             complement(join(639687..639795,639863..640296))
FT                   /locus_tag="ANIA_07220"
FT                   /old_locus_tag="AN7220.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000227"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000227"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000227"
FT                   /db_xref="GOA:Q5AWW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWW0"
FT                   /protein_id="CBF78829.1"
FT                   /translation="MAANPQTYQPIISGPGDIRTAQKRRQIYIRPFLLFWLASLLAETV
FT                   FLAVGIFVMTGTRDLVYKVLWTLVFCPLGMGGAMGGLINVFIVDHYYGTKAAHFTGVLA
FT                   LLVLSSCNYLCYNLDRHFGWFGASEHPMWFHWRYPMIWAVGSMRQDQISYGSPGEYTVG
FT                   LKDAFARGNSRARSSWQ"
FT   gene            640616..641991
FT                   /locus_tag="ANIA_07219"
FT                   /old_locus_tag="AN7219.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(640616..640648,640936..641397,641527..641991)
FT                   /locus_tag="ANIA_07219"
FT                   /old_locus_tag="AN7219.4"
FT                   /note="transcript_id=CADANIAT00000228"
FT   CDS             join(640616..640648,640936..641397,641527..641991)
FT                   /locus_tag="ANIA_07219"
FT                   /old_locus_tag="AN7219.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000228"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000228"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000228"
FT                   /db_xref="GOA:Q5AWW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWW1"
FT                   /protein_id="CBF78831.1"
FT                   /translation="MSCTALILSNQRRRQQVLLAQTGVPGTKRGTHQGATAAVARLESA
FT                   LERMCQAIISSTDVVIGARIPTSHQQIAHRLRDTVKTCLLSAMDGNGCQDDFACSNQSE
FT                   QLPKQSQAQGDHEKWPRPSQHAGLGVLPPARNAPFAPQSMPPAADATTMKAALFANQLR
FT                   LYARLNNKQPDRCSDIPYFRLGGAGTHYSGVSGQNQTELGKEQNSREIRIPDTLSAFSP
FT                   EVQKDLDGDWFDLFDLVGYVRTHGVALSMAPPVEDTAYRKVNAVDFAAGRLTFRVLCHA
FT                   RGGYLTIISSGRKGICLGHSPGFKRSDVEIAIDSSCWK"
FT   gene            complement(642128..643342)
FT                   /locus_tag="ANIA_07218"
FT                   /old_locus_tag="AN7218.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(642128..642367,642400..643168,
FT                   643227..643342))
FT                   /locus_tag="ANIA_07218"
FT                   /old_locus_tag="AN7218.4"
FT                   /note="transcript_id=CADANIAT00000229"
FT   CDS             complement(join(642128..642367,642400..643168,
FT                   643227..643342))
FT                   /locus_tag="ANIA_07218"
FT                   /old_locus_tag="AN7218.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000229"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000229"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000229"
FT                   /db_xref="GOA:Q5AWW2"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWW2"
FT                   /protein_id="CBF78833.1"
FT                   /translation="MTATITASHSSIFETAIAVIQIDANTYSAYLDPHSALKGPSRRLH
FT                   GQRALRTAATHFARKHAATDAGPKRGQRQGRIRSPEPIAFQITFQRTFVAGPAILTVKE
FT                   FKLGARISTIHVTLSQTRDGGDAVGSGDRTKLEVKVLAYITLAPPDMEESPRVRGVGPW
FT                   TDLSPGMPQGSLHGGAIDFSALAKDGRDGEWRAGPQAPPSLHAVKHLKVYSPSSTLLPK
FT                   TVEERAGQVVEQWTQFAPGGMPARWSNGAGVPCGYLSCGVGSDGGDGGNETSCHWCGWD
FT                   ERSLPKRATVMISMFWYPPVIMDIDLKTRLPPSGMEWLYSRVVTRMVRGSLADLEVLIL
FT                   DQDGELIATSTQVALVVDPARNVKGRLQADLGKL"
FT   gene            complement(644082..644457)
FT                   /locus_tag="ANIA_11550"
FT                   /old_locus_tag="AN11550.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(644082..644215,644346..644457))
FT                   /locus_tag="ANIA_11550"
FT                   /old_locus_tag="AN11550.4"
FT                   /note="transcript_id=CADANIAT00000230"
FT   CDS             complement(join(644082..644215,644346..644457))
FT                   /locus_tag="ANIA_11550"
FT                   /old_locus_tag="AN11550.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000230"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000230"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000230"
FT                   /db_xref="GOA:C8VCZ8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCZ8"
FT                   /protein_id="CBF78835.1"
FT                   /translation="MRALAAPGTIAHMHEQLKPEMSEGIWLTHLPGGQIPPLRLVVAGD
FT                   AVYGDVHQYFGEATTVEKRKEWLRVLDRSRPWNRIP"
FT   gene            647055..648626
FT                   /locus_tag="ANIA_07217"
FT                   /old_locus_tag="AN7217.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(647055..647428,648061..648225,648288..648626)
FT                   /locus_tag="ANIA_07217"
FT                   /old_locus_tag="AN7217.4"
FT                   /note="transcript_id=CADANIAT00000231"
FT   CDS             join(647055..647428,648061..648225,648288..648420)
FT                   /locus_tag="ANIA_07217"
FT                   /old_locus_tag="AN7217.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000231"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000231"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000231"
FT                   /db_xref="GOA:C8VCZ9"
FT                   /db_xref="UniProtKB/TrEMBL:C8VCZ9"
FT                   /protein_id="CBF78837.1"
FT                   /translation="MVDFPVGDTHAARLPRLYPRSSKHPYSPNSPTNPHTQLHCQEEQS
FT                   RNESIGRSPFLFLLTSVPSLTMPMAMNRGQVDPAPTSARHEEVAGPMEALILRESWDKD
FT                   AIRFEQDSGLGCSRACHCQISFFLPPTAEPKSTQPATTKPNQSNQPTSQNSTSKCLPAT
FT                   ATAAPATATPALAAPAPTKYLFCRVVLCPCSAISTSQLYLNQATTRAYSSIRPCKPQIR
FT                   Y"
FT   gene            651171..652898
FT                   /locus_tag="ANIA_10914"
FT                   /old_locus_tag="AN10914.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(651171..651260,651322..651531,651703..652356,
FT                   652403..652534,652581..652898)
FT                   /locus_tag="ANIA_10914"
FT                   /old_locus_tag="AN10914.4"
FT                   /note="transcript_id=CADANIAT00000232"
FT   CDS             join(651171..651260,651322..651531,651703..652356,
FT                   652403..652534,652581..652898)
FT                   /locus_tag="ANIA_10914"
FT                   /old_locus_tag="AN10914.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000232"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000232"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000232"
FT                   /db_xref="GOA:C8VD00"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD00"
FT                   /protein_id="CBF78838.1"
FT                   /translation="MFQINRELAALGIEWNPRRIYYLETWRYPEVESPTRWNIRDGLLE
FT                   DFQVEEWLNQRGEFSPPVPPAEVGNGSHGGIRLLACNYHLFPKISVGMSPETFGLAPQK
FT                   YEIGNYMLSLTYDMSSHWTTALLAGESIVDTASTIFNRSSLPLAPLSPCDVVREYLMSS
FT                   PTLWDHPLMLPCIVLSHHLRRLQHHCNRDLTPIVMGIEAQLGVTRVGRRNFDARPRSIN
FT                   AIKDGPVARVQSEHLTVTINTQLTRVGFTARNPKWNYEASALLEKIVTELAAYTPALRP
FT                   EANEEILGVLDHNITLAKSLEDNVLGLQKRLELQLNVLYSFVAQTDNRLSARLAATAGR
FT                   DSTSMKILAFITTIFLPGSYVASLFSMNMFNWEDGASGSEGPGSGGSTISPQFWIYWTV
FT                   AAPLTALTLAGWALWWSFEKHRYDEHLEGNRQDTRVKIPPWWRRILETRHTLNPGLAGP
FT                   LGVAGGTRS"
FT   gene            653133..654532
FT                   /locus_tag="ANIA_10913"
FT                   /old_locus_tag="AN10913.4"
FT                   /product="Glutamate-1-semialdehyde 2,1-aminomutase,
FT                   putative (Eurofung)"
FT   mRNA            join(653133..653341,653392..654532)
FT                   /locus_tag="ANIA_10913"
FT                   /old_locus_tag="AN10913.4"
FT                   /note="transcript_id=CADANIAT00000233"
FT   CDS             join(653133..653341,653392..654532)
FT                   /locus_tag="ANIA_10913"
FT                   /old_locus_tag="AN10913.4"
FT                   /product="Glutamate-1-semialdehyde 2,1-aminomutase,
FT                   putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000233"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000233"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000233"
FT                   /db_xref="GOA:C8VD01"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD01"
FT                   /protein_id="CBF78840.1"
FT                   /translation="MTSLTQKADDYLRFAQQRYETSRPRSKAQHQRATSHLPGGNTRSV
FT                   LHATPFPLCMQAGKGNRLVDVDGYEYIDCMGDMTACLYGHSHPVIMETVDSTMKSIGMN
FT                   LGSSTSAEAHFAEALCDRFASIDHIRFCTSGTEANLYALSVARQSTNRTKVIVFEGAYH
FT                   GGVLSFSHGIAPNNVDKDDWILGQYNDIDGAVQLITENKDIAAAVVVEGVQGAGGCIPG
FT                   SAGFLHAIQDAARENGIIFILDEVMTSRLAPGGLQSILLHPDHGTPLKPDLTTFGKWIG
FT                   GGLSIGAFGGRRDLMSVYDPRTSIIHHSGTFNNSTLAMNVGCKGLTSVYTPEACTSLNN
FT                   LGDELRSGLQELAKGTKMVVTGLGAVMNIHFVRASGSRVVARTSDLEVNSGSVEEALRD
FT                   LLWFYLIERGFWIARRGMISLILGTGVEEVEQLKGVVGDFLEDFRELVSA"
FT   gene            654831..656904
FT                   /locus_tag="ANIA_10908"
FT                   /old_locus_tag="AN10908.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(654831..655366,655432..655510,655571..655687,
FT                   655745..656056,656091..656221,656289..656386,
FT                   656603..656677,656759..656904)
FT                   /locus_tag="ANIA_10908"
FT                   /old_locus_tag="AN10908.4"
FT                   /note="transcript_id=CADANIAT00000234"
FT   CDS             join(654831..655366,655432..655510,655571..655687,
FT                   655745..656056,656091..656221,656289..656386,
FT                   656603..656677,656759..656904)
FT                   /locus_tag="ANIA_10908"
FT                   /old_locus_tag="AN10908.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000234"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000234"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000234"
FT                   /db_xref="GOA:C8VD02"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD02"
FT                   /protein_id="CBF78842.1"
FT                   /translation="MLFETFLSLLPVAALATAVSTHPQTPSDLIVATSSGIVHGIYNDT
FT                   AHKVRAFLGIPYAEPATGDLRFAPPQPRAPSQHPINASSFGAPCPQVYNYDNESIWNVL
FT                   PYRIRNVEDMSEECLFVNIWTPAEHQTKKSGAGRKGKAVMLFIHGGGFGEGAGSVGFYD
FT                   GVDLASSEDVVVVTFNYRLNVFGYPNAPGLDPAEQNLGLLDQRLAVQWVHQNIANFGGD
FT                   PDRILLFGQSAGGASVDAYAYAYPEDPLVSGFVLQSGTVSLFNNADTAHANWNRLSTAV
FT                   GCSAGDGSLACMRSVSFSRILEVLGNGSYTFTPVADNRTVFSDYIARAKAGGLARLVRI
FT                   RTPLTRCQPTLAGINAREFSAGFPLSQSSINETAVTEDLFGSFSCPAYQAVKTRLRQHI
FT                   PTWRYVYHGNFTNLSPKPWLGAYHSGAWVAFAQNRHTGLEDYGWPLFTFNETTLVNLAV
FT                   DNRPGAVLGSAEDWDRHCRGDVYIGYTIPDSLQLHVYNM"
FT   gene            658444..659173
FT                   /locus_tag="ANIA_07215"
FT                   /old_locus_tag="AN7215.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(658444..658465,658552..658627,658786..659173)
FT                   /locus_tag="ANIA_07215"
FT                   /old_locus_tag="AN7215.4"
FT                   /note="transcript_id=CADANIAT00000235"
FT   CDS             join(658444..658465,658552..658627,658786..659173)
FT                   /locus_tag="ANIA_07215"
FT                   /old_locus_tag="AN7215.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000235"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000235"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000235"
FT                   /db_xref="GOA:Q5AWW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWW5"
FT                   /protein_id="CBF78844.1"
FT                   /translation="MVLLYYCGRDSMIKAASRQSVARHKGTACLQERMRFFTTTALFAL
FT                   LATSTLANPIEIRQAANTRTVTLTNENSGHGQSSDIPTDGVDVAIPPRYPDLYSPTFRV
FT                   DSVMITAGVVEGAKCVVSGNRVSDNAPVTLVTVDGRKNYAKFPQGVAKPESLKINCV"
FT   gene            complement(660056..661487)
FT                   /locus_tag="ANIA_07214"
FT                   /old_locus_tag="AN7214.4"
FT                   /product="NADPH-dependent FMN reductase Lot6, putative
FT                   (AFU_orthologue; AFUA_7G06600)"
FT   mRNA            complement(660056..661487)
FT                   /locus_tag="ANIA_07214"
FT                   /old_locus_tag="AN7214.4"
FT                   /note="transcript_id=CADANIAT00000236"
FT   CDS             complement(660081..661472)
FT                   /locus_tag="ANIA_07214"
FT                   /old_locus_tag="AN7214.4"
FT                   /product="NADPH-dependent FMN reductase Lot6, putative
FT                   (AFU_orthologue; AFUA_7G06600)"
FT                   /note="transcript_id=CADANIAT00000236"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000236"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000236"
FT                   /db_xref="GOA:C8VD04"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD04"
FT                   /protein_id="CBF78846.1"
FT                   /translation="MRLGALLSVTLLSTAATAAFNAQDTIDRDVVILGGGATGTFAAVQ
FT                   LREQGYTVALVEQKSKLGGHAETLYLPSGDYVNYGVEGYFNNKITKDFFAQLDVDYEPL
FT                   LPGAILTQHVNFRTGERVLPGNELLTTTAAALLYRGAIEQFNYLAQGLYDLPEEVPEIL
FT                   LRPFREFVDKYALWGAVDLIFTFAENVGNMLDRPTLYVIQYFGIPHIDALLNGGYIRPK
FT                   NGTDVLFNKAANYIDEVNNIFYDSMAVRTTRDETGVEVVIQNARTGAQKLIRAKKLLIA
FT                   FPPVLEKLAGFDLTEQESALFSKWTYVNYYAAVLTNTAVPNDFNILNTDPTNQPGSLPT
FT                   TPFNWALEYSGVPGYFMNKIIGDANLTEAEARALIIDDLKRMSSAGTFGIKDGQEPEIA
FT                   AFASHSPETLMVSVEDVKGGFYKKLYGLQGQASTFYTGYTFCTDYSTMLWNYTNTIVDR
FT                   IVQEL"
FT   gene            complement(662962..664683)
FT                   /locus_tag="ANIA_07213"
FT                   /old_locus_tag="AN7213.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(662962..663711,663754..664683))
FT                   /locus_tag="ANIA_07213"
FT                   /old_locus_tag="AN7213.4"
FT                   /note="transcript_id=CADANIAT00000237"
FT   CDS             complement(join(662962..663711,663754..664683))
FT                   /locus_tag="ANIA_07213"
FT                   /old_locus_tag="AN7213.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000237"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000237"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000237"
FT                   /db_xref="GOA:Q5AWW7"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWW7"
FT                   /protein_id="CBF78847.1"
FT                   /translation="MALYLHTAASSGAACDGLQAPSIPDARVLWITSNTVQNFTYPPVT
FT                   GLTGEPIAGATGDSSPLTFCNVSMVLTHPGDNDTVLVSVWLPPHDTWNTRYTATGGGGL
FT                   GAGYDFNMISPLAAGFAASATDAGLTLNNTIMADTGLWGLKEDGTVNEPLFKNLGYRSI
FT                   HDMAVASKDVIKQFYGVEPKYSYWAGCSQGGRQGYAAAAKYPTDFDGILAVAPGLGFGH
FT                   VGLAAFWPVVVMYNEGEYVPSCIFDKFEAALLESCDPDDGLVDGLITDYDLLISCPRSF
FT                   NTSALIGQTVTCREAGNTNFTITERQAIIYWFGTVPGATFSGIAETVFDNATGRWLPKP
FT                   FAPAAGWLTNIIAPQMGIEAKLQHLYRDTGILTLTYNQYFVAFNISLALSSPFLSDSYL
FT                   NFRSFQKSGGKLLTWVGLADQFVHPAHLFDFHASVTKTISPGNSSNIEDFYRIFTAPGV
FT                   RHCAGGLGPQPVSPMGALIEWVEQGKAPDTLSAKADSSTAREIVRDLCLYPKKSVYKHG
FT                   ELAQHDGFECQEPEGRLQRPNEDEDEDDDYESDKTIIGDDDE"
FT   gene            complement(665111..665576)
FT                   /locus_tag="ANIA_07212"
FT                   /old_locus_tag="AN7212.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(665111..665159,665299..665576))
FT                   /locus_tag="ANIA_07212"
FT                   /old_locus_tag="AN7212.4"
FT                   /note="transcript_id=CADANIAT00000238"
FT   CDS             complement(join(665111..665159,665299..665576))
FT                   /locus_tag="ANIA_07212"
FT                   /old_locus_tag="AN7212.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000238"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000238"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000238"
FT                   /db_xref="GOA:Q5AWW8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWW8"
FT                   /protein_id="CBF78849.1"
FT                   /translation="MGLFKILAPCTPALAAAPEFQQEDIITRDGCILRGGATGSYAAMQ
FT                   LVERGHSMAVLDDLRRMGDAGTYLINKKPEYVAFDSRWPASIMAPQKISALELYPLHRR
FT                   RDDG"
FT   gene            complement(666500..667690)
FT                   /locus_tag="ANIA_07211"
FT                   /old_locus_tag="AN7211.4"
FT                   /product="cholestenol delta-isomerase, putative
FT                   (AFU_orthologue; AFUA_3G00810)"
FT   mRNA            complement(join(666500..666667,666734..666750,
FT                   666989..667387,667440..667690))
FT                   /locus_tag="ANIA_07211"
FT                   /old_locus_tag="AN7211.4"
FT                   /note="transcript_id=CADANIAT00000239"
FT   CDS             complement(join(666500..666667,666734..666750,
FT                   666989..667387,667440..667638))
FT                   /locus_tag="ANIA_07211"
FT                   /old_locus_tag="AN7211.4"
FT                   /product="cholestenol delta-isomerase, putative
FT                   (AFU_orthologue; AFUA_3G00810)"
FT                   /note="transcript_id=CADANIAT00000239"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000239"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000239"
FT                   /db_xref="GOA:C8VD07"
FT                   /db_xref="InterPro:IPR007905"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD07"
FT                   /protein_id="CBF78851.1"
FT                   /translation="MTTLHSYYPLGVEIPHYIANELSTPTLLAIFGTACTIVFSVTTSL
FT                   AKKANSQISNSELYKTLWFALCGSIHLVLEGYYALNFLTLASSSHPLAQLWKEYALSDS
FT                   RYLTPNSFVMCMESITALFWGPLSFLLAGFIATNHPLRHPLQIIISLGQLYGDVLYYGT
FT                   CAFEFLVNGLEFSRPERYYFWGYFMLLNMFWIVIPLEVFYFKLAVLAQLDGKPEPPLAG
FT                   HGIARESVLSTLLTPAYMSVWYTALRDVAVCFESAPPI"
FT   gene            668720..669313
FT                   /locus_tag="ANIA_10907"
FT                   /old_locus_tag="AN10907.4"
FT                   /product="DUF614 domain protein (AFU_orthologue;
FT                   AFUA_5G00975)"
FT   mRNA            join(668720..668861,668913..669010,669083..669313)
FT                   /locus_tag="ANIA_10907"
FT                   /old_locus_tag="AN10907.4"
FT                   /note="transcript_id=CADANIAT00000240"
FT   CDS             join(668720..668861,668913..669010,669083..669313)
FT                   /locus_tag="ANIA_10907"
FT                   /old_locus_tag="AN10907.4"
FT                   /product="DUF614 domain protein (AFU_orthologue;
FT                   AFUA_5G00975)"
FT                   /note="transcript_id=CADANIAT00000240"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000240"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000240"
FT                   /db_xref="GOA:C8VD08"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD08"
FT                   /protein_id="CBF78853.1"
FT                   /translation="MAAFEKTYRSTPINPPLYQDASPEAKNITYKKDWNYSLLDCCSPG
FT                   SLCFLTCCLPCLTFGRTQARAQDPTLKSYSSINSECLIFTGLTLCWSQWIIQTIRRGEM
FT                   RERHGISGSCCGDCCATFWCGCCTLVQEEKEMELRTRPELTGYQGTPQMAYP"
FT   gene            669908..671313
FT                   /locus_tag="ANIA_10912"
FT                   /old_locus_tag="AN10912.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(669908..670009,670069..671313)
FT                   /locus_tag="ANIA_10912"
FT                   /old_locus_tag="AN10912.4"
FT                   /note="transcript_id=CADANIAT00000241"
FT   CDS             join(669908..670009,670069..671313)
FT                   /locus_tag="ANIA_10912"
FT                   /old_locus_tag="AN10912.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000241"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000241"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000241"
FT                   /db_xref="GOA:C8VD09"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD09"
FT                   /protein_id="CBF78855.1"
FT                   /translation="MASRLVNSYTASQSRKSHKKSRLGCGNCKRRRIKCDEKKPECSNC
FT                   LRHSVYCDYKNATGDERGAELCRQPSDACDSAPEQQADDSYTFISSNQTHFKPPKRRHA
FT                   RRNVTPMQVELQIPAPEPCAAVANKPFNFSATDMVLFHHLISSKDLGGSNRMAISQFTR
FT                   LGFSFHYLLHLLLAISSFHLARHGGDDHLSQIAGHSGDYLAEGERHYSLAVGVVAAQIP
FT                   SLGKENGLALYAAALLIFLCSVARGPQPLEYLAFRDDGQAGSLALFMGVRTVLETCTAS
FT                   FAIDASLMHAADHKEPSSDGEGKLNSWARNPTVLNEYSSELSQLSQILLTVPSNCDAAS
FT                   YHQAFEHLQCIYQSLYSPDSKLNELDLWPTIFGWLYTLPSPFLTALQCRESVSLVLFSF
FT                   FLVLLKELDSAWFLRDWPEHILIGILHNLESSHQPFIRWPMEVLKCPSY"
FT   gene            672377..674526
FT                   /locus_tag="ANIA_10906"
FT                   /old_locus_tag="AN10906.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(672377..673006,673044..673222,673281..673796,
FT                   673848..674526)
FT                   /locus_tag="ANIA_10906"
FT                   /old_locus_tag="AN10906.4"
FT                   /note="transcript_id=CADANIAT00000242"
FT   CDS             join(672383..673006,673044..673222,673281..673796,
FT                   673848..674526)
FT                   /locus_tag="ANIA_10906"
FT                   /old_locus_tag="AN10906.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000242"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000242"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000242"
FT                   /db_xref="GOA:C8VD10"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD10"
FT                   /protein_id="CBF78857.1"
FT                   /translation="MFQAGEPASCITYHQYGQRCTGNAPCRNCRQRINEHGPQVDGESG
FT                   EDDYHKKLLTDIFRTIQSTDEAGSQPLLDLIRNGATFPEVRCWLDQTLRGGPMPNQAST
FT                   TDVRDSKLRAGYEVESGAPPFRSKVMDIHYLCDSAPVKVPAKPWTTVTDDDGLVSHLVS
FT                   LYFTWDYPFYAFVDPAILIRHMREGNMQSDFCSPFLVNALLANACANEIQHYSHYSEAY
FT                   AVPGDVKTKGTDFLAEAERHLQNNRFEKGSVVRLASIQATLLLYERYSMVGDDDHGYIM
FT                   LNQAVEMAEALGIINSPQLDLNNSQMSEEMIRSVQQTAWGLFQIDTIVHTNFLRKSAVK
FT                   DVSIPRLDRETSKPSDKWVAYPLNKPDRPSWLSQAFDEACKLSYIARDMSSTLIPKADD
FT                   PAGNTAEQKWELYNKLRHWEENLPATFSLAERPAPHIILLRMRYHALLINLYCDWFEGK
FT                   PPFNAITGEVNQEPSTQVADAQALDIALASAREIATLTRLHKAEYGMERAHQFAMYAIL
FT                   LALFTFLEQNSFNVLDHDFLLLTSTFSIIASRSQVGMHLFHIFRHSVKFRLQCGQWESS
FT                   VDMPPELNELFFKNTSPEIPDRWNHYAEGLQKLADNGEYIGSLDGRWQSHAASGINDML
FT                   RKYETLSVGRVDELTWKDQSAGFGFSPSPA"
FT   gene            674812..676469
FT                   /locus_tag="ANIA_10911"
FT                   /old_locus_tag="AN10911.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(674812..674944,675005..676469)
FT                   /locus_tag="ANIA_10911"
FT                   /old_locus_tag="AN10911.4"
FT                   /note="transcript_id=CADANIAT00000243"
FT   CDS             join(674880..674944,675005..676469)
FT                   /locus_tag="ANIA_10911"
FT                   /old_locus_tag="AN10911.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000243"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000243"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000243"
FT                   /db_xref="GOA:C8VD11"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD11"
FT                   /protein_id="CBF78859.1"
FT                   /translation="MEKPKSIRIGSTKVRTGCITCKSRRIKCDEGKPTCRNCIRSKRSC
FT                   TYANNHDGKPNLRIVVYTPRATFAATSAEKHSLDFFLAQMRTRFPIHFSQRVLQAAHRE
FT                   DVLAHAIIALGAMQQCFEYDDASAIGAWSPLATFSMQHYGRALRLLQERVNEAFILHPR
FT                   TKGRGRAAGAETGAGAGAEPDLILISCIFFACFECLRGSTQAAIVHMRSGLNLLREYER
FT                   DPRTGSIIPKRTMRSLFTRLDNQLIEMRGSSLSMASSDDNLEVVARDPLPEDDVHDSLN
FT                   ALWNHILHGMLDSARALAKGEAPSPSISTPQADVRENMKQLHHTFTRLCISSTSPSSPP
FT                   PPEGVDYGQDPDILRIWFLLSPMLLTSNTWDPADAWGPHNDNFARIVAIAEAYLARCAA
FT                   ANPSRRRTFAFSLGIVPPLTLTATRSRDPRVQQKALYLLSICNRREGIWDSKVSVQFAL
FT                   KTIEMDQEVRDQPTEEQAATRLKNRAAAFDDILVDDDDERLVKHEPEEDDG"
FT   gene            complement(678509..679075)
FT                   /locus_tag="ANIA_07208"
FT                   /old_locus_tag="AN7208.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(678509..679075)
FT                   /locus_tag="ANIA_07208"
FT                   /old_locus_tag="AN7208.4"
FT                   /note="transcript_id=CADANIAT00000244"
FT   CDS             complement(678509..679075)
FT                   /locus_tag="ANIA_07208"
FT                   /old_locus_tag="AN7208.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000244"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000244"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000244"
FT                   /db_xref="GOA:Q5AWX2"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWX2"
FT                   /protein_id="CBF78861.1"
FT                   /translation="MPIAVQDPTPATPTTVPGKADAKSHPQPTHPGLLHVQRSAQAFGS
FT                   SAISEVSLPAGALFAKITTATPATKAYTSVQVSRDAHIELNSDLVYCNHSCDPTLNFDM
FT                   GKMEVRVVDNRPLKKGDQLTFFYPSSEWEMDQPFQCTCGAGEKCKGFIKGAKGLGRDGL
FT                   KGYWLNAHIEELVQEEEQKKNADGQ"
FT   misc_feature    679214..684190
FT                   /note="contig 1.223 650..5626(-1)"
FT   gene            complement(679498..680529)
FT                   /locus_tag="ANIA_09514"
FT                   /old_locus_tag="AN9514.4"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein (AFU_orthologue; AFUA_6G10090)"
FT   mRNA            complement(679498..680529)
FT                   /locus_tag="ANIA_09514"
FT                   /old_locus_tag="AN9514.4"
FT                   /note="transcript_id=CADANIAT00000245"
FT   CDS             complement(679498..680529)
FT                   /locus_tag="ANIA_09514"
FT                   /old_locus_tag="AN9514.4"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein (AFU_orthologue; AFUA_6G10090)"
FT                   /note="transcript_id=CADANIAT00000245"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000245"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000245"
FT                   /db_xref="GOA:Q5AQB6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQB6"
FT                   /protein_id="CBF78863.1"
FT                   /translation="MALPKLAILDDYQGIAGPHFAHLENRVAITHFPQTLDPRNAAQQS
FT                   ELVNRLRDYEIILAMRERTPLSRETLSQLPNLKLLLTTGTRNRAIDTAYCAERGIPVAG
FT                   TETRGPGVHSTVQHTWALILALARHVARDDAALKSDRDYWQGSLGMTLSGKTLGLVGLG
FT                   KLGSAVGRIAIVAFGMKVIAWSANLTQEKADEQAEAAGLEKGSFVCVEDKQEFFARADV
FT                   VSVHYVLSERSRGVVGTPELRRMKKHALLVNTSRGPLIDQAALLDCVEHGGIGGVALDV
FT                   FETEPLPADSVWRGRQWGTDGRSEVLLTPHMGYGDEQIHGWYDEVAANLQRWLDGEDLK
FT                   TLL"
FT   gene            683301..683557
FT                   /locus_tag="ANIA_11674"
FT                   /old_locus_tag="AN11674.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(683301..683306,683531..683557)
FT                   /locus_tag="ANIA_11674"
FT                   /old_locus_tag="AN11674.4"
FT                   /note="transcript_id=CADANIAT00000246"
FT   CDS             join(683301..683306,683531..683557)
FT                   /locus_tag="ANIA_11674"
FT                   /old_locus_tag="AN11674.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000246"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD14"
FT                   /protein_id="CBF78864.1"
FT                   /translation="MQFFISAPPS"
FT   misc_feature    684191..899139
FT                   /note="contig 1.122 1..214949(-1)"
FT   gene            684545..685437
FT                   /locus_tag="ANIA_07207"
FT                   /old_locus_tag="AN7207.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(684545..684627,685110..685125,685187..685223,
FT                   685307..685437)
FT                   /locus_tag="ANIA_07207"
FT                   /old_locus_tag="AN7207.4"
FT                   /note="transcript_id=CADANIAT00000247"
FT   CDS             join(684545..684627,685110..685125,685187..685223,
FT                   685307..685437)
FT                   /locus_tag="ANIA_07207"
FT                   /old_locus_tag="AN7207.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000247"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000247"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000247"
FT                   /db_xref="GOA:Q5AWX3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWX3"
FT                   /protein_id="CBF78866.1"
FT                   /translation="MTQLILHFYSKHAWWIQRMQLLIIIPRFWQRVANFTLAFRVKALD
FT                   RLCTLHTLTSQFHAKRGKNAQRLNAQSPTVGKDTVRRKETMGN"
FT   gene            complement(685261..686837)
FT                   /locus_tag="ANIA_07206"
FT                   /old_locus_tag="AN7206.4"
FT                   /product="GTP binding protein (SPG1), putative
FT                   (AFU_orthologue; AFUA_6G10330)"
FT   mRNA            complement(join(685261..685735,685785..685859,
FT                   685907..686199,686247..686837))
FT                   /locus_tag="ANIA_07206"
FT                   /old_locus_tag="AN7206.4"
FT                   /note="transcript_id=CADANIAT00000248"
FT   CDS             complement(join(685637..685735,685785..685859,
FT                   685907..686199,686247..686724))
FT                   /locus_tag="ANIA_07206"
FT                   /old_locus_tag="AN7206.4"
FT                   /product="GTP binding protein (SPG1), putative
FT                   (AFU_orthologue; AFUA_6G10330)"
FT                   /note="transcript_id=CADANIAT00000248"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000248"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000248"
FT                   /db_xref="GOA:C8VD16"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD16"
FT                   /protein_id="CBF78868.1"
FT                   /translation="MDPAQPPVAEAPVPEAEPQHQDQYQENQPEHQHHQTELDQPDQMS
FT                   QGLSHMSETETPTIVPTAASEEPTLPSTSYHNGYSSDSRAHYEYHTPTQDPQPQPPTSS
FT                   RPSSGLSGTQKQPAQTTKNSVVIKVGMVGDAQIGKTSLMVKYVEGSWDEDYIQTLGVNF
FT                   MEKTISIRNTEITFSIWDLGGQREFVNMLPLVCNDAVAILFMFDLTRKSTLNSIKEWYR
FT                   QGRGFNKTAIPFLVGTKYDHFVNFPREDQEEISIQAKRFAKAMKASLIFSSTSHSINVQ
FT                   KIFKIVLAKAFDLKCTIPEIENIGEPLLLYKNV"
FT   gene            687013..688641
FT                   /locus_tag="ANIA_07205"
FT                   /old_locus_tag="AN7205.4"
FT                   /product="ribosome biogenesis protein (Rrb1), putative
FT                   (AFU_orthologue; AFUA_6G10320)"
FT   mRNA            join(687013..687262,687309..688566,688617..688641)
FT                   /locus_tag="ANIA_07205"
FT                   /old_locus_tag="AN7205.4"
FT                   /note="transcript_id=CADANIAT00000249"
FT   CDS             join(687067..687262,687309..688566,688617..688641)
FT                   /locus_tag="ANIA_07205"
FT                   /old_locus_tag="AN7205.4"
FT                   /product="ribosome biogenesis protein (Rrb1), putative
FT                   (AFU_orthologue; AFUA_6G10320)"
FT                   /note="transcript_id=CADANIAT00000249"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000249"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000249"
FT                   /db_xref="GOA:C8VD17"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD17"
FT                   /protein_id="CBF78870.1"
FT                   /translation="MSKRSADASEDAAALKAGERPLADAPPDDMGEFEDEFEDEFESED
FT                   EILEAGVDGRPDAEREEEEKADAMEVDQQTFIPGRTKLAPGEVLSPDPSTYDMLHTLST
FT                   PWPCLSFDIVRDTLGDNRKTYPATVYAVTGTQAEGRRAKENELMVLKLSGLGKMERENE
FT                   TDSESDSDDDEGGEAILEHKSIPLGSTANRIRAHQTPQSDITKPPQTITATMLENSQVV
FT                   IHDVTPHLTSFDVPGTMLPPSASKPLSTLRMHKSEGYALDWSPLHPLGKLLTGDNDGLI
FT                   YVTTRTEGGGWVTDTRAFRGHASSVEELQWSPNEKNVFASASSDGTVKVWDVRSKSRSP
FT                   AVNVKISNTDVNVMTWSKQTSHLLATGADDGQWAVWDLRHWKPNPSSSAPITASPVASF
FT                   NFHKEPITSIEWHPTDDSVIAVGSADNTVTLWDLAVELDEEESREAGLADVPPQLLFVH
FT                   YMESVKEVHWQAQMPGTLMATGSGGFGVFKTISV"
FT   gene            complement(688962..690296)
FT                   /locus_tag="ANIA_07204"
FT                   /old_locus_tag="AN7204.4"
FT                   /product="bifunctional oelate/linoleic acid delta
FT                   desaturase (Eurofung)"
FT   mRNA            complement(join(688962..689338,689402..690170,
FT                   690258..690296))
FT                   /locus_tag="ANIA_07204"
FT                   /old_locus_tag="AN7204.4"
FT                   /note="transcript_id=CADANIAT00000250"
FT   CDS             complement(join(688962..689338,689402..690170,
FT                   690258..690296))
FT                   /locus_tag="ANIA_07204"
FT                   /old_locus_tag="AN7204.4"
FT                   /product="bifunctional oelate/linoleic acid delta
FT                   desaturase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000250"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000250"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000250"
FT                   /db_xref="GOA:Q5AWX6"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWX6"
FT                   /protein_id="CBF78871.1"
FT                   /translation="MAATATTLAEIEKTIKNAIPKHCFNRSLLISSAYVVRDLLYASVL
FT                   FYFALHIDTLFSSQLLRILAWTAYGFMQGCVGTGIWILAHECGHGAFSPYQTWNDVVGW
FT                   TLHSLLMVPYFSWKITHARHHRYTNNTERDTAFVPWTEKEYDTRPRYFPAWFEMFEDTP
FT                   VYNLISLLAHQIAGWQMYLCFYVSAGAKSKPVPQGKQSGWFGGQQSASHFDPGSSLWTE
FT                   NQRHLIAISDLGLLLVAAANWYLAQQVGVLRMVLIYVVPYFWVHHWLVAITYLHHTHPS
FT                   IPHYTDSTWTFTKGALSTVDRDFGFIGRHFFHHIIDHHVVHHLFNRIPFYHAEEATNAI
FT                   IPVLGDMYHREETGFLWSLMETYKNCRFVGVENDVGKEGVLHWVFEEKKGAKAE"
FT   gene            690885..693148
FT                   /locus_tag="ANIA_07203"
FT                   /old_locus_tag="AN7203.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(690885..690910,691268..691383,691529..691906,
FT                   691999..692117,692211..692415,692804..693028,
FT                   693108..693148)
FT                   /locus_tag="ANIA_07203"
FT                   /old_locus_tag="AN7203.4"
FT                   /note="transcript_id=CADANIAT00000251"
FT   CDS             join(690885..690910,691268..691383,691529..691906,
FT                   691999..692117,692211..692415,692804..693028,
FT                   693108..693148)
FT                   /locus_tag="ANIA_07203"
FT                   /old_locus_tag="AN7203.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000251"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000251"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000251"
FT                   /db_xref="GOA:Q5AWX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWX7"
FT                   /protein_id="CBF78873.1"
FT                   /translation="MSGLFGVMKPVHVRRGPTLNEQSGHVRSTLLRRVLAEKKTKQRED
FT                   AASVEQGEGVRTGRDLLGLGQALRLEASPTTPANHRTLRCEHSQDGLRAGRMQDPTLTL
FT                   QASSCCPTCGRVRILPAAPAAPAAASVSHLTTNFLHELLDLTTATLWPHFRAQDYAASC
FT                   NRSWVYPLEEKSKEQLELKSLVLQELQKEVANISETYSPDALVMCILYLARIPPAALEG
FT                   RAGHRATLWRDPEPARVCASLALCLSDLMSAMQNLTKPIYPIVGVDAKPLDLQPPSLLF
FT                   HRLCNQNVSQPVILWCVAVAMSMLNMPDKTASAPSTLVPYMALLSQNAGVDSLDKLMAL
FT                   LESFAWVDAAVQYTEIVCGYQARLHETGR"
FT   gene            694111..694911
FT                   /locus_tag="ANIA_07202"
FT                   /old_locus_tag="AN7202.4"
FT                   /product="isochorismatase family hydrolase, putative
FT                   (AFU_orthologue; AFUA_3G03270)"
FT   mRNA            join(694111..694115,694175..694491,694551..694770,
FT                   694821..694911)
FT                   /locus_tag="ANIA_07202"
FT                   /old_locus_tag="AN7202.4"
FT                   /note="transcript_id=CADANIAT00000252"
FT   CDS             join(694111..694115,694175..694491,694551..694770,
FT                   694821..694911)
FT                   /locus_tag="ANIA_07202"
FT                   /old_locus_tag="AN7202.4"
FT                   /product="isochorismatase family hydrolase, putative
FT                   (AFU_orthologue; AFUA_3G03270)"
FT                   /note="transcript_id=CADANIAT00000252"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000252"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000252"
FT                   /db_xref="GOA:Q5AWX8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWX8"
FT                   /protein_id="CBF78875.1"
FT                   /translation="MLAEALLVIDDQVGLATVVRDYSTNDFRNNMVAHAAIGKAFDIPV
FT                   LTTSSDEGPNGQMLKEILDMYPNTTAVRRQGEVNAWDNEEFRNASRRRGKKQLIVGGIV
FT                   TEVCTAFLTLSIVDEGYEVYANTEASGTFNGRLAKDANRRMEKAGVTLMGFLAIVCNLM
FT                   RDRRNTPGLAQLLPFLDQYQFAYGLVARHHAAAIVNGTLADIDKELV"
FT   gene            696381..698530
FT                   /locus_tag="ANIA_07201"
FT                   /old_locus_tag="AN7201.4"
FT                   /product="alkaline serine protease AorO, putative
FT                   (AFU_orthologue; AFUA_6G10250)"
FT   mRNA            join(696381..696589,696636..696899,696949..697191,
FT                   697343..697352,697421..698530)
FT                   /locus_tag="ANIA_07201"
FT                   /old_locus_tag="AN7201.4"
FT                   /note="transcript_id=CADANIAT00000253"
FT   CDS             join(696381..696589,696636..696899,696949..697191,
FT                   697343..697352,697421..698530)
FT                   /locus_tag="ANIA_07201"
FT                   /old_locus_tag="AN7201.4"
FT                   /product="alkaline serine protease AorO, putative
FT                   (AFU_orthologue; AFUA_6G10250)"
FT                   /note="transcript_id=CADANIAT00000253"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000253"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000253"
FT                   /db_xref="GOA:Q5AWX9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWX9"
FT                   /protein_id="CBF78877.1"
FT                   /translation="MWLSLLYLVSSITAVLAFSPPAKHPLHERRDALPDYWVEDARLDG
FT                   QTVLPVRIGMTQSNLDHGHDLLMLISDPSSPEYGKYLSAKEVHDLFAPAEETVERVRAW
FT                   LESEGISDTRISQSANKQWLRFDATAQELERLLQTEYYLYSHAETRRSHIACREYHVPE
FT                   ALQKHIDYITPGVKFLEIAGPLPILPTERSLTRRDTADASSPIIDGTNLTLSQVTNDAL
FT                   GFCDQIITPACIRGMPCICQPIVHSINGGTAPTTLDNAGPESTLDLAMSYPIIWPQNPI
FT                   IFQTDDPIWADINNPKFPGIFNNFLDAIDGSYCDPSEEELDPPYPNPAPGGYKGQKQCG
FT                   VYKPTNVISISYGFAEFELPIRYNRRQCYEWMKLGLQGVSVVAASGNNGVATGGCLGKD
FT                   RSVFTPGYLICPYITTVGGTYLLPGGDPYNPLEVAVDPSTTPGNWSSGGGFSNIYERPM
FT                   YQASAVEEYFSRANLNYPYYESINNDSFAANDGIYNRIGRAYPDISAVAVNNFVFWRGG
FT                   PILGGGTSASAPIFAAILTRINEERLAAGMPTVGFVNPMLYAHPEAFRDITEGNNPGCS
FT                   TDGFTALEGWDPVTGLGTPIYPKLLEVFMSVKLGL"
FT   gene            699079..700790
FT                   /locus_tag="ANIA_07200"
FT                   /old_locus_tag="AN7200.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(699079..700077,700128..700601,700638..700790)
FT                   /locus_tag="ANIA_07200"
FT                   /old_locus_tag="AN7200.4"
FT                   /note="transcript_id=CADANIAT00000254"
FT   CDS             join(699079..700077,700128..700601,700638..700790)
FT                   /locus_tag="ANIA_07200"
FT                   /old_locus_tag="AN7200.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000254"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000254"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000254"
FT                   /db_xref="GOA:Q5AWY0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY0"
FT                   /protein_id="CBF78879.1"
FT                   /translation="MADNPSRSKGNGLSVPLNTSQREKFPEQEPAPSSDEIQYPSVLKL
FT                   TFILIGLNLSVFLVGLDNTILSSAIPKITDRFHALGDVGWYASAYLLTNCAFQLFWGKL
FT                   YTFYTVKWVYLVALFLFELGSLVCAVAPSSTALIVGRAVAGVGAGGVTNGSFLLIAHSV
FT                   EPRRRPTLVGLLGSMYGLAAIAGPLMGGAFTDNGALTWRWCFYINLPLGAVPSLVILFL
FT                   IPAFAGSENRESGIGNQIRQMDVPGSLCLLPGVICLLLALQWGGTKYNWGNERIIALFF
FT                   LAGVLLSGFTIIQYFSGDRATVPPRVFGNRNVWGAALFGSGVTAGFFLMLYYIPIWFQA
FT                   VKGASAVRSGVMNLPMVLAYVTFSLSGGFLTSLLGYYVPFAYLTVIFMSVGSGLLSTFT
FT                   VSSGSPEWIGYQFLFGAGVGLGLQTAFAAPQCTLPIEDIAIGTAIVMFLENLSAAIFVS
FT                   VGQNVFSNQLKTNVQIYAPSVDTARLIDGGATEAVLRAYNKALTGTFYVGVGLSCIGIF
FT                   GVVFMQWVNVKKSGKKTEQDNKDV"
FT   gene            complement(701196..703101)
FT                   /locus_tag="ANIA_07199"
FT                   /old_locus_tag="AN7199.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(701196..701275,701517..701548,
FT                   701839..702081,702228..702297,702349..702487,
FT                   702550..703101))
FT                   /locus_tag="ANIA_07199"
FT                   /old_locus_tag="AN7199.4"
FT                   /note="transcript_id=CADANIAT00000255"
FT   CDS             complement(join(701196..701275,701517..701548,
FT                   701839..702081,702228..702297,702349..702487,
FT                   702550..703101))
FT                   /locus_tag="ANIA_07199"
FT                   /old_locus_tag="AN7199.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000255"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000255"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000255"
FT                   /db_xref="GOA:Q5AWY1"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY1"
FT                   /protein_id="CBF78881.1"
FT                   /translation="MPSSKQWILANKPTDLPTLSGPTPTFKLTSADVPKPSSSQALVKT
FT                   LMLSNDPAQRTWIVPNADPERLYLPPVQEGSPMSAFALAEVVESGSPNELPVGSLVLCP
FT                   TNWTEYSVHEIKTLQKIQPIEGLDLGHFLGALGMTAVTAYYGIKEVAGTTKDDTVVVSG
FT                   AAGATGSMVVQIAKKIIGCKRVIGIAGTDDKCRWVETLGADVCINYKKDSFEQDLIKET
FT                   EGFVEVYFDNVGGNILDLMLTRMKRHGRIAACADDKQEVISMRLHIRGFIVLDYYHKFS
FT                   DVIAELTQAWKEGKIVVDESMQTVVEAKFEDIPNVWMKLFEGGNTGKLCTKIVSRRHRV
FT                   RRGKEKRQVLIIIAATGCLNLWSPINVKSMA"
FT   gene            704263..706070
FT                   /locus_tag="ANIA_07198"
FT                   /old_locus_tag="AN7198.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(704263..704268,704483..704503,704699..704706,
FT                   704970..704992,705059..705067,705112..705116,
FT                   705326..705368,705456..705469,705520..705521,
FT                   705856..705888,705920..706070)
FT                   /locus_tag="ANIA_07198"
FT                   /old_locus_tag="AN7198.4"
FT                   /note="transcript_id=CADANIAT00000256"
FT   CDS             join(704263..704268,704483..704503,704699..704706,
FT                   704970..704992,705059..705067,705112..705116,
FT                   705326..705368,705456..705469,705520..705521,
FT                   705856..705888,705920..706070)
FT                   /locus_tag="ANIA_07198"
FT                   /old_locus_tag="AN7198.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000256"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000256"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY2"
FT                   /protein_id="CBF78882.1"
FT                   /translation="MSLYPAPWLVIRGYWAAMLGFKRMQKEPSKVETILAAYNTEQPAL
FT                   SGKQPSSIYLMGQSSLQAVVASLSSLGADRGGAQRAAQQCSFVGRCSEPRGLFGGPSSV
FT                   "
FT   gene            complement(707749..708657)
FT                   /locus_tag="ANIA_07197"
FT                   /old_locus_tag="AN7197.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(707749..708345,708448..708657))
FT                   /locus_tag="ANIA_07197"
FT                   /old_locus_tag="AN7197.4"
FT                   /note="transcript_id=CADANIAT00000257"
FT   CDS             complement(join(707749..708345,708448..708657))
FT                   /locus_tag="ANIA_07197"
FT                   /old_locus_tag="AN7197.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000257"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000257"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY3"
FT                   /protein_id="CBF78884.1"
FT                   /translation="MEVDDSPPGGARPGTPLLGENSEPPSGPTTPTPLPRNSLKRRALF
FT                   SLQKTPTAAPVPVSYLLQAPSICKQGRPRDLAQGLAARFVSLAKQDSPQLIPLITAAAP
FT                   PQPSRQIEQPNQPPTPEACKGPLKRQTSQPTTWASLTAPRASQGNWQTIAPEHCMQAKQ
FT                   PAQQKLKQPNKTDHCIFLCLPASSSLWAIRPHGIQVTLAGKVPDRIAQVQVISTGYVIT
FT                   TTEQGKVFLLSEKAASLAGDGYFEILTEYHQVIVPWIPKQLWSLDR"
FT   gene            709018..709842
FT                   /locus_tag="ANIA_07196"
FT                   /old_locus_tag="AN7196.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(709018..709104,709179..709244,709289..709418,
FT                   709469..709557,709606..709693,709745..709842)
FT                   /locus_tag="ANIA_07196"
FT                   /old_locus_tag="AN7196.4"
FT                   /note="transcript_id=CADANIAT00000258"
FT   CDS             join(709018..709104,709179..709244,709289..709418,
FT                   709469..709557,709606..709693,709745..709842)
FT                   /locus_tag="ANIA_07196"
FT                   /old_locus_tag="AN7196.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000258"
FT                   /db_xref="UniProtKB/TrEMBL:Q5B6N0"
FT                   /protein_id="CBF78886.1"
FT                   /translation="MAKVKKDPNYIRYTKISKAELDLPDFKADNHGYLIPHVGEIYCRA
FT                   PACTNSFQTRFLNTNNLKKHIRKAHVDKFDLLEKEGGGRPTAKEEDDAIVFYKAVLEAY
FT                   DARQEDGVGKPEIPRRRDGKINQSAVKKYVREQGYSVPCDACKEADKAKDCCREANLDV
FT                   CDHFELFEPYEDEEEAESNEVF"
FT   gene            complement(709874..713220)
FT                   /locus_tag="ANIA_07195"
FT                   /old_locus_tag="AN7195.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(709874..710032,710117..710139,
FT                   710224..710304,710472..710554,710602..710614,
FT                   710738..710800,710850..710955,710995..711077,
FT                   711129..711152,711207..711305,711357..711534,
FT                   711580..711776,711827..711946,712054..712069,
FT                   712360..712456,712503..712617,712834..712846,
FT                   713050..713220))
FT                   /locus_tag="ANIA_07195"
FT                   /old_locus_tag="AN7195.4"
FT                   /note="transcript_id=CADANIAT00000259"
FT   CDS             complement(join(709874..710032,710117..710139,
FT                   710224..710304,710472..710554,710602..710614,
FT                   710738..710800,710850..710955,710995..711077,
FT                   711129..711152,711207..711305,711357..711534,
FT                   711580..711776,711827..711946,712054..712069,
FT                   712360..712456,712503..712617,712834..712846,
FT                   713050..713220))
FT                   /locus_tag="ANIA_07195"
FT                   /old_locus_tag="AN7195.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000259"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000259"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY5"
FT                   /protein_id="CBF78887.1"
FT                   /translation="MDTEYNYLNDQTVINDLINLSISSESDSLNENEAEIYHENDDRIL
FT                   HERNQAEVEVKECTHINLLDMNHQEVTDAMFNTIFQKRRDIISQRERPETRTTYSLYRS
FT                   VCKSFQNSVACLASQTSCKPVLRKHSEPLLTSPFFVSRGIHSHPPPPPNKPPQLILDEI
FT                   LDLIRKMQSPDLTPSLFLRSPALKQFCQKYNGQTLSQIHNSFVNQDRFAAIIAKEKALL
FT                   YPKGRGLAGVRCELDRHPEYREYVRRIYTDHDIVMIICGFNKQIQLLGSLDSFEVDMSY
FT                   KRVKGDFNEVIFATFLPQHGKIITLLRVFMDHESAFSYKLLFTRVFQLIADIQGYMCAK
FT                   QMSGLGHYLQELDPLQRPWTWQLMNILILCRTGDLSDYHSSARCRMESLLTCSTREEYF
FT                   HLIELLEAHETPKIAEWARHKRHSVIAAGATLSSRILDQRDIDQYLARNQYGTSHLSRI
FT                   TRRVLQDSFLHADLVPVVEVQDLDHGEAVTIQVFFRRSATANLQVQNLELQRQQLELEA
FT                   QQVRIRKEKAEAEKLELENMLRRRELGLD"
FT   gene            721120..722292
FT                   /locus_tag="ANIA_07194"
FT                   /old_locus_tag="AN7194.4"
FT                   /product="quinone oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_1G02090)"
FT   mRNA            join(721120..721180,721239..721597,721672..722292)
FT                   /locus_tag="ANIA_07194"
FT                   /old_locus_tag="AN7194.4"
FT                   /note="transcript_id=CADANIAT00000260"
FT   CDS             join(721150..721180,721239..721597,721672..722292)
FT                   /locus_tag="ANIA_07194"
FT                   /old_locus_tag="AN7194.4"
FT                   /product="quinone oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_1G02090)"
FT                   /note="transcript_id=CADANIAT00000260"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000260"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000260"
FT                   /db_xref="GOA:C8VD28"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD28"
FT                   /protein_id="CBF78889.1"
FT                   /translation="MPSQKTMRAVAIKGGKGPADALYIDNIPVPEYGPSQALVKVKAFG
FT                   LNRMDLLQREGQYPVPPQAPATLGVEFSGTIAELGDGATEDFKVGDEVFGLAYGGAYAE
FT                   YIAVATGMLIHKPKELSWEEAAGIPETWITATQALHLVGAFKPGNSVLWHAGASSVSIA
FT                   GIQLAKAAGASAIYVTAGSDEKISFCVNQLGATAGFNYRTQNWAEELSKATNGRGVDVI
FT                   VDYIGAGYFQDNLKSAALDGRIVNLAFLGGIKVENVDISYFLRKRIRYEGSTLRSRDEE
FT                   YQRKLRNMLVDNALEKLRNKEFKVFVEKVFKFDDVVEAHKLMESNQTKGKIICTI"
FT   gene            complement(722371..723668)
FT                   /locus_tag="ANIA_07193"
FT                   /old_locus_tag="AN7193.4"
FT                   /product="D-xylose reductases (Eurofung)"
FT   mRNA            complement(join(722371..722787,722843..723259,
FT                   723322..723508,723565..723668))
FT                   /locus_tag="ANIA_07193"
FT                   /old_locus_tag="AN7193.4"
FT                   /note="transcript_id=CADANIAT00000261"
FT   CDS             complement(join(722434..722787,722843..723259,
FT                   723322..723508,723565..723611))
FT                   /locus_tag="ANIA_07193"
FT                   /old_locus_tag="AN7193.4"
FT                   /product="D-xylose reductases (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000261"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000261"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000261"
FT                   /db_xref="GOA:Q5AWY7"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY7"
FT                   /protein_id="CBF78891.1"
FT                   /translation="MSLGKKVTLNTGAQIPQLGFGTWQSAPGQVGEAVYQALKVGYRHL
FT                   DLATIYQNQREVAEGIKRAYKDIPGLKREDIFITSKLWNTQHDPAVVEKALDDCLAELE
FT                   LDYLDLYLVHWPVAFKTGDNYFPLDESSDHPDGDVLIDDSISIVDTWKAMTKLPKEKAR
FT                   AIGVSNHTVEHLEAIINATGVVPAANQIERHPVLQSNDLIEYAAKKNIHITAYSAFGNN
FT                   MFNIPLLVAHPEVKAVAEEASKRLGKTVTPAQVILNWSQEGGHSVIPKSVTASRIAENF
FT                   QEVELTKEELAKVSKLGEERRRYNTPYVANKPRWNINIFGEEDEKPAKHKVIV"
FT   gene            727237..728380
FT                   /locus_tag="ANIA_07192"
FT                   /old_locus_tag="AN7192.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(727237..727565,727630..728217,728272..728380)
FT                   /locus_tag="ANIA_07192"
FT                   /old_locus_tag="AN7192.4"
FT                   /note="transcript_id=CADANIAT00000262"
FT   CDS             join(727237..727565,727630..728217,728272..728380)
FT                   /locus_tag="ANIA_07192"
FT                   /old_locus_tag="AN7192.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000262"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000262"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000262"
FT                   /db_xref="GOA:Q5AWY8"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY8"
FT                   /protein_id="CBF78893.1"
FT                   /translation="MAKRRLFRWPAPRTTGLTFLALLLSSLTLFLYGGGSFPMTPAQRG
FT                   SSLQSAQSVDSTDGVIAAQESLHDQVIRELAEITSAYSNTSRVGLVLAATQSEDLQWLL
FT                   DYCRERGPDTIPFIYSTDEKPDPRLLLPRTTRGREATAYLSFIVDHYDKLPPYSLFIHS
FT                   NINQWHNDLFGPYTSNALRNLRLEAVDAMGYVNLRCQHDPGCPTSVHPWSPTQIDIEKN
FT                   DIRAFFPEVYQTIFNVPSDQVPEHIGNVCCGQFAVSRERILQRPRHDYERMLKWAAETE
FT                   RTDSFGVGWVYEKIWHIIFGMEVIYCPRYEQCRCDVYGWCGPLADTGETLQAVRAPAPA
FT                   S"
FT   gene            complement(728747..730172)
FT                   /locus_tag="ANIA_07191"
FT                   /old_locus_tag="AN7191.4"
FT                   /product="GPI-anchored cell wall protein Pst1, putative
FT                   (AFU_orthologue; AFUA_6G10290)"
FT   mRNA            complement(join(728747..729710,729740..729770,
FT                   729803..730172))
FT                   /locus_tag="ANIA_07191"
FT                   /old_locus_tag="AN7191.4"
FT                   /note="transcript_id=CADANIAT00000263"
FT   CDS             complement(join(728747..729710,729740..729770,
FT                   729803..730172))
FT                   /locus_tag="ANIA_07191"
FT                   /old_locus_tag="AN7191.4"
FT                   /product="GPI-anchored cell wall protein Pst1, putative
FT                   (AFU_orthologue; AFUA_6G10290)"
FT                   /note="transcript_id=CADANIAT00000263"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000263"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000263"
FT                   /db_xref="GOA:Q5AWY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWY9"
FT                   /protein_id="CBF78895.1"
FT                   /translation="MTQLTTTFSGASITISSQASADSAFDKCSSISGSVTIAPSASGTL
FT                   ALDGLERISEDLIIESTDLVGISIPDIEDVGGSVTVTGNEQLNRLSLGSLSSIAGDLEV
FT                   KGNNALADLVMNSLEVVRGVGSLSAISAALFSFEELERVGGESEIVSTGSAGCAGIDAL
FT                   NQAGSEEAEGEVFRGSYTCATTSASPTSTSTSTDEATDSSAGSGLGGGAIAGIVVGVVV
FT                   GVLIILILIWLLLRRQRKNPVIHGANAAVIGGGFSSGAAAAVMAKSKGEEKGLNHNTSL
FT                   STSPREGSAPVSAAAGGAGGGSIPRRPVSIATTSMSSPSTYHPSSTFPSSLTAGTSNRS
FT                   SLPLPTALIPGTNGSSNPPGSRPSDGGDALFFFTTTPSAGRPPPRPARQPSESDVPMLD
FT                   SENVHEVSGVAVPAREEKRSERVLEEGKVFELDGGFDGARHQRAINGEPEVDAKQ"
FT   gene            complement(731583..733512)
FT                   /locus_tag="ANIA_07190"
FT                   /old_locus_tag="AN7190.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(731583..731746,731793..731892,
FT                   731939..732048,732093..732786,732835..733512))
FT                   /locus_tag="ANIA_07190"
FT                   /old_locus_tag="AN7190.4"
FT                   /note="transcript_id=CADANIAT00000264"
FT   CDS             complement(join(731583..731746,731793..731892,
FT                   731939..732048,732093..732786,732835..733512))
FT                   /locus_tag="ANIA_07190"
FT                   /old_locus_tag="AN7190.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000264"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000264"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000264"
FT                   /db_xref="GOA:C8VD32"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD32"
FT                   /protein_id="CBF78897.1"
FT                   /translation="MRIGRGCERCRLRHIKCTIGEGASSCNECSRLSRACRLDPPFRFK
FT                   TVRHVYQKCQGSSSKFELAWSSRQPWVKVPQSRMFSIRLRLYRSVLICLVMFIEESAED
FT                   PDFDVIPDVVRNNQLHSDGPSAVSQAQTPHTPSPREDMAHPGNHEHLLVQLAGTSPGER
FT                   RTISSISISPKPANGPSPLPSVSTWADFSPSLSSLSPRQNSISSMTTREASLLRSFIQT
FT                   LAPRFDVCDQNSHFSTEIPRRALQVPMIMKAILAFSARHAAIMSGSEDWEAAEYHSQCV
FT                   EMLIRALSKAEGFYDDNILITVVILRVYEELERTTDEKCHWLGSTRLLNTMSKSASSGG
FT                   LAEAVSWQFLRQAIYACLVEYQPMQLNLENYERSSVFQRMDDAAYANRIIFLCARIIQL
FT                   RSEPNGYSFTESDWQYLSDCVDQWYREKPISWQPLKHQEANAGENKPFPELWLVSPPAV
FT                   VGLQYYHACRIILATSNNHQKIVVDYERARLRRIEEQTIAYHLVNVIGLSKSNETVINA
FT                   YFMGCHLLHRYGFCLRHPAEHLGSTEFLESVEKQIGWPTAWIVRQLEAEWNELHTLDSS
FT                   WSPRF"
FT   gene            735360..737525
FT                   /locus_tag="ANIA_07189"
FT                   /old_locus_tag="AN7189.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(735360..736290,736327..736698,736735..737525)
FT                   /locus_tag="ANIA_07189"
FT                   /old_locus_tag="AN7189.4"
FT                   /note="transcript_id=CADANIAT00000265"
FT   CDS             join(735360..736290,736327..736698,736735..737525)
FT                   /locus_tag="ANIA_07189"
FT                   /old_locus_tag="AN7189.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000265"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000265"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000265"
FT                   /db_xref="GOA:Q5AWZ1"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ1"
FT                   /protein_id="CBF78898.1"
FT                   /translation="MTNRDPDFRHQLGRFRLQVDPPPSSQLPLPTSSSTPATSLHSPST
FT                   QSTAAPPPSLPHRLTSRPKRVSTACDFCRKRKKKCDFRYPNCSACTRAGVRCTIAPPGP
FT                   QITNSVPRDQLERLQDRVQWLEEIVRRKTGVAVADRPTGSALDEDGDSNSWHQLPAILI
FT                   KVDPSSPQDASTVGGSTSGLDSGASPASNDPSAVGTELPNVGEIFRDKLEHRRPSIARP
FT                   VVSASPLHFLRLASLEEAERVAGQYFDSMGYQYPFLHRVEFFDNLRRIYAGEILSPEVH
FT                   HSYHITIGISLLIGSAEDAETRAMEFYRANLTALRALLSLALYTLFATTGPSIWHVLGT
FT                   ALRLTTSLGLHKARHPTNLHDDEMTKRAFWSLYNLDRLIASTLGRPLGIADEDITLSLP
FT                   RELNDDGTETPGASSMTIPIQVIKLRRIFSRIYRYPLLKSLMPTVYSTNQPPPTPTELS
FT                   INLRHFRQELDEWRSTSPVYPPALLYSTSYFDYLHATTLLLLYRPSPRNPTPDQTSIIS
FT                   CGNASVAVIRSYWESYCAGKLKWIWLTLSQLYFAGITILWCLNRNFHSVNEGLGPVWEP
FT                   DELMMRRAIQAVVVILEAFGKRRAGVDKLAETFRTQSTTIFSHLAYQRQQQQAMVPPPV
FT                   PQPQPVVNPVYMAPPVPLAPVLDDVLLVDASRTMPVMDPQMAEQLFYSYDWFQEEMATY
FT                   YTL"
FT   gene            complement(737669..740530)
FT                   /locus_tag="ANIA_07188"
FT                   /old_locus_tag="AN7188.4"
FT                   /product="small oligopeptide transporter, OPT family
FT                   (AFU_orthologue; AFUA_6G10220)"
FT   mRNA            complement(join(737669..737862,737923..738192,
FT                   738255..738469,738526..739856,739929..740132,
FT                   740295..740530))
FT                   /locus_tag="ANIA_07188"
FT                   /old_locus_tag="AN7188.4"
FT                   /note="transcript_id=CADANIAT00000266"
FT   CDS             complement(join(737669..737862,737923..738192,
FT                   738255..738469,738526..739856,739929..740132,
FT                   740295..740342))
FT                   /locus_tag="ANIA_07188"
FT                   /old_locus_tag="AN7188.4"
FT                   /product="small oligopeptide transporter, OPT family
FT                   (AFU_orthologue; AFUA_6G10220)"
FT                   /note="transcript_id=CADANIAT00000266"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000266"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000266"
FT                   /db_xref="GOA:C8VD34"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD34"
FT                   /protein_id="CBF78900.1"
FT                   /translation="MMRESEAKPLSGGSCKESPINNVESNDTVDRNAVLDDHDAEKILP
FT                   YEADDSPFPEVRAVVRPVDDVELPLNTIRMWIIGILFTIVGSGLNQFFSLRQPSVRISA
FT                   LVAQLVAYPIGCAWAKWMPLGWLNPDRRFNIKEHALITIMANVSFGSAAATQVIEAMVK
FT                   FYHMPSQGGFQILLCITTQLFGFGVAGMVSRWLVEPATMIWPQVLSNAALLSTLHSKSN
FT                   KVADGWTITRQKFFLLVFVGGALWYFLPGYLFTALSMFSFVCWIAPTNVVVNQLFGQKT
FT                   GLGMSLLTLDWSQVVFANDSPLLVPFWAGLNVMGSFVLFFWILVPIIYYTNTWYSAYLP
FT                   LLDSNTFDNTGRMYDTRRVMNINNGTVNVEAYRNYSPMFIPAGFAVTYGVAFANLTGIF
FT                   VHTALYHGKDLLQQWSGRHKKDIHSRLMQSYTPVPWWWFGAVSLLMFILSIVNNEVWET
FT                   RLPAWGVLLAFVLPIIYFIPVGIIKALTNITSNQLNLITEFIGGYAFLGKPVANMAFKF
FT                   YGYVTVSQGLEFVADMKLAHYLHIAPRTLFFAQGLATLIGAIVQCGVTVFMLTRFEGIC
FT                   TPHADGGFTCPHGLVTFSSSLIWGALGPARNFSPGQIYGNLLWFFLAGPVVVIITYLLG
FT                   RRWKAANYISWPVAFGAMSMVPPATGINFSSWWVVNVIFNGLVKRKRPAWWSKYNYVLS
FT                   AALDSGVAVSTVVIFFCIMLPAGPLRWWGNEVFMRTADGRGTPWKTVPPHERFGPTTWE
FT                   "
FT   gene            741594..742484
FT                   /locus_tag="ANIA_07187"
FT                   /old_locus_tag="AN7187.4"
FT                   /product="FAD dependent oxidoreductase superfamily
FT                   (AFU_orthologue; AFUA_6G10230)"
FT   mRNA            join(741594..741704,741755..742152,742199..742484)
FT                   /locus_tag="ANIA_07187"
FT                   /old_locus_tag="AN7187.4"
FT                   /note="transcript_id=CADANIAT00000267"
FT   CDS             join(741594..741704,741755..742152,742199..742484)
FT                   /locus_tag="ANIA_07187"
FT                   /old_locus_tag="AN7187.4"
FT                   /product="FAD dependent oxidoreductase superfamily
FT                   (AFU_orthologue; AFUA_6G10230)"
FT                   /note="transcript_id=CADANIAT00000267"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000267"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000267"
FT                   /db_xref="GOA:Q5AWZ3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ3"
FT                   /protein_id="CBF78902.1"
FT                   /translation="MARDEPDSGVCVVDGREYVEQPPPENSSAWGKTVLNKFRDLNPGE
FT                   YPPNFNCGWAYETVVTDPSRHLPWLRGKIISLGGQFVRKRVESLEELYAMFPESRIFIN
FT                   ASGIGSKYLTDVRDDRCFPERGQNVFFRTSNCRTLYFRNGKEYTYIIPRPLSQGVILGG
FT                   VKQRDTLSPEVDMEIAKDEIARAHRLAPEIVPADPPEESLSYIIGIRPSREGGFRLDSE
FT                   KIGDRTVLSAYGFGGGGYAFSYGIADALVRMVEKAERDHIIW"
FT   gene            complement(742663..743569)
FT                   /locus_tag="ANIA_07186"
FT                   /old_locus_tag="AN7186.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(742663..742947,743039..743569))
FT                   /locus_tag="ANIA_07186"
FT                   /old_locus_tag="AN7186.4"
FT                   /note="transcript_id=CADANIAT00000268"
FT   CDS             complement(join(742663..742947,743039..743569))
FT                   /locus_tag="ANIA_07186"
FT                   /old_locus_tag="AN7186.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000268"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000268"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000268"
FT                   /db_xref="GOA:Q5AWZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ4"
FT                   /protein_id="CBF78904.1"
FT                   /translation="MPPKRRTRASKPQPEKQTYPLSPDQEGESPQRNDADQNSFKCPDN
FT                   LTDNPEEPMEPDEFESSGTFPETDEDMPEETERAAVEDEGDSADRETATEKKRGFAGGY
FT                   NALKSYNGKYYSGMAVGGSHTWNYDQGIWKETKEEPDLWKIDYRTNKRRARKAPKGSGA
FT                   PVGTEYHWLIVGHQYVKKVDANTYETVLEGSKYKLAYKSATSNSWSVPTVKKQREREVE
FT                   LLEDAKLRVQGLPPVSEKVKVEKQEKGQKKLDAMFSQGNVAGKKRKAGE"
FT   gene            745696..748277
FT                   /locus_tag="ANIA_07185"
FT                   /old_locus_tag="AN7185.4"
FT                   /product="serine protein kinase Sky1, putative
FT                   (AFU_orthologue; AFUA_4G03140)"
FT   mRNA            join(745696..746145,746214..746989,747037..747389,
FT                   747435..748277)
FT                   /locus_tag="ANIA_07185"
FT                   /old_locus_tag="AN7185.4"
FT                   /note="transcript_id=CADANIAT00000269"
FT   CDS             join(745967..746145,746214..746989,747037..747389,
FT                   747435..747872)
FT                   /locus_tag="ANIA_07185"
FT                   /old_locus_tag="AN7185.4"
FT                   /product="serine protein kinase Sky1, putative
FT                   (AFU_orthologue; AFUA_4G03140)"
FT                   /note="transcript_id=CADANIAT00000269"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000269"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000269"
FT                   /db_xref="GOA:Q5AWZ5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ5"
FT                   /protein_id="CBF78906.1"
FT                   /translation="MEGVDFQSVLNKGKQMASNVAATATNGSTNKKRRKGTDLKPIVTS
FT                   DSATPADQTGPTSDNVPPSRSGSSSSEEEIETTAEEEDSEDYCKGGYHPVQIGELYNNG
FT                   RYVVVRKLGWGHFSTVWLSRDTTTGKHVALKVVRSAAHYTETAIDEIKLLNRIVQANPS
FT                   HPGRKHVVSLLDSFEHKGPHGVHVCMVFEVLGENLLGLIKKWNHRGIPMPLVKQITKQV
FT                   LLGLDYLHRECGIIHTDLKPENVLIEIGDVEQIVKTYVKEEAKKEQKEDNRNGRRRRRT
FT                   LITGSQPLPSPLNTTFEFKHSSQNSHSSLSQVINESPGTSEAPSMRQLLGIKDEDEQQK
FT                   QREKTAYVERLLEGTSLTDDSDLLEREVSGISLDKPSSDEDIDCGIISVKIADLGNACW
FT                   VGHHFTNDIQTRQYRSPEVILGSKWGASTDIWSMACMVFELITGDYLFDPQSGTRYGKD
FT                   DDHIAQVIELLGPFPKSLCLSGRWSQEIFNRKGELRNIHRLRHWSLPDVLREKYHFSVA
FT                   QAKAISDFLLPMLEVLPERRANAGGMASHEWMKDTRGMQEVDLGLTPGSRGEGIEGWAT
FT                   EVKRR"
FT   gene            749021..750311
FT                   /locus_tag="ANIA_07184"
FT                   /old_locus_tag="AN7184.4"
FT                   /product="Pre-mRNA-splicing factor cwc26
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AWZ6]"
FT   mRNA            join(749021..749030,749284..750311)
FT                   /locus_tag="ANIA_07184"
FT                   /old_locus_tag="AN7184.4"
FT                   /note="transcript_id=CADANIAT00000270"
FT   CDS             join(749021..749030,749284..750311)
FT                   /locus_tag="ANIA_07184"
FT                   /old_locus_tag="AN7184.4"
FT                   /product="Pre-mRNA-splicing factor cwc26
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AWZ6]"
FT                   /note="transcript_id=CADANIAT00000270"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000270"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000270"
FT                   /db_xref="GOA:Q5AWZ6"
FT                   /db_xref="InterPro:IPR018609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AWZ6"
FT                   /protein_id="CBF78908.1"
FT                   /translation="MTDSEYLAKNYLTADPSPPTDRPKKKRKKTKAAEVESQGLIIADD
FT                   DPPDLRSTATLSSKENDEYGPVVTGARSAEFRKTKKSNWKTIGSSTNTGTDTATATGPN
FT                   AGRDEADAILADAMAEEDARRAAGDEDPMVVDQDDNEDDGGLRMESGARAGLQTAEQTA
FT                   AMVAAQQKKRKAEEAQYKGKQGHAQETIYRDASGRIINVAMKRAEARRLEEEKLIKEAE
FT                   AKEALMGDVQRAERESRRAALEEAKVMPLARTADDEELNEELKAQTRWNDPAAQFLTKS
FT                   TGGGRSKTGKPLYKGAFQPNRYGIRPGHRWDGVDRSNGFEKEWFAARNKKERMQALEYE
FT                   WQMDE"
FT   gene            751202..752315
FT                   /locus_tag="ANIA_07183"
FT                   /old_locus_tag="AN7183.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(751202..751643,751683..752315)
FT                   /locus_tag="ANIA_07183"
FT                   /old_locus_tag="AN7183.4"
FT                   /note="transcript_id=CADANIAT00000271"
FT   CDS             join(751480..751643,751683..752079)
FT                   /locus_tag="ANIA_07183"
FT                   /old_locus_tag="AN7183.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000271"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000271"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000271"
FT                   /db_xref="GOA:Q5AWZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ7"
FT                   /protein_id="CBF78909.1"
FT                   /translation="MSGSFDNNDLRQAGTAAKRVHDHKAKWVHGGRSARPGAAAPNGIL
FT                   PITRPAKQQSQANEHRTSWTRRQRLRDAQHSSTLAKVNFRNDVREALDEATSESSGVED
FT                   HEVLAVAATIPEVYQAEGPVDLYEVSGETLFNAVVDKAVEKFEIKETEKLVKEYEVITR
FT                   DHELSIGYLADEDEFELVDHVKL"
FT   gene            752689..754333
FT                   /locus_tag="ANIA_07182"
FT                   /old_locus_tag="AN7182.4"
FT                   /product="nuclear envelope protein Brr6, putative
FT                   (AFU_orthologue; AFUA_4G03180)"
FT   mRNA            join(752689..752842,752890..753782,753826..754333)
FT                   /locus_tag="ANIA_07182"
FT                   /old_locus_tag="AN7182.4"
FT                   /note="transcript_id=CADANIAT00000272"
FT   CDS             join(752728..752842,752890..753782,753826..754167)
FT                   /locus_tag="ANIA_07182"
FT                   /old_locus_tag="AN7182.4"
FT                   /product="nuclear envelope protein Brr6, putative
FT                   (AFU_orthologue; AFUA_4G03180)"
FT                   /note="transcript_id=CADANIAT00000272"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000272"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000272"
FT                   /db_xref="GOA:Q5AWZ8"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ8"
FT                   /protein_id="CBF78911.1"
FT                   /translation="MDKRTAESPMDFEWQSRAPGDVTSPFYQLSMQHDNQKKRSHNVFE
FT                   SPEKKQMPALREPNSQPFLFSQTKPTAPETPKSVFAQPAFMTPRKFDLDFSSGAENMSS
FT                   PENADNDDTPEQPTKTGHRNSLFGMYGRFAPSPGRGEIPRLSHYSNAVARRVQKRRLRN
FT                   KALDLQVHRDSDDESDRPSSSEGQQKVKHKGGHKDEAPSSPTSTFKKFFTLVEAHPNVP
FT                   NILSWWAQLALNFFIFSMAGYVLWGIVWTIRAEFDQAAEAASDTILAEMAACAKDYVDN
FT                   RCGGGDRLPALETVCANWERCMNRDPAKVGRAKVSAQTMAIIINSFIDPISWKAILFFL
FT                   ATISTVTFVSNWSFRSFRNRYNHDFAPPPPDYQRQSSGQHHPLPPQLPDQHTQFGYGTH
FT                   HQDDPTGFVKQDVPLLLENHPQAMNITDRSRERSRNPRTPSPVKRGRKLL"
FT   gene            755210..756709
FT                   /locus_tag="ANIA_07181"
FT                   /old_locus_tag="AN7181.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(755210..755489,755536..755753,755801..756041,
FT                   756090..756709)
FT                   /locus_tag="ANIA_07181"
FT                   /old_locus_tag="AN7181.4"
FT                   /note="transcript_id=CADANIAT00000273"
FT   CDS             join(755210..755489,755536..755753,755801..756041,
FT                   756090..756709)
FT                   /locus_tag="ANIA_07181"
FT                   /old_locus_tag="AN7181.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000273"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000273"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000273"
FT                   /db_xref="GOA:Q5AWZ9"
FT                   /db_xref="InterPro:IPR027589"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AWZ9"
FT                   /protein_id="CBF78913.1"
FT                   /translation="MKLSALSLLTVACVATASSHGAETMEYLMSLKQQSRERARSQGLF
FT                   DINRYPDEGAKKCKNGKAGEYSCENVDLLSFLSHQALGSVTREGNDVWGWTSAEGREFG
FT                   IVGQTDGVAFVEILEDGSLEYVGRLGSQTEPSTWRDIKVIGDHAYIGSEAAGHGLQIFD
FT                   LNKLTTASSSKPTVFSTKKDLTAWYRGFGSSHNIVAHEETNMIYAVGTARNLSCAGGLW
FT                   MVDVSDPANPTSPGCVNEDGYVHDAQCVIYKGPDEKYIGQEICFNFNEDTLTIADVTDK
FT                   KNPIQISKTPYVGASYTHQGWLVDENDHSYLLLDDELDEMDGTGSAANGHTTTYIFDIK
FT                   DLSAPKHTGTYQSPVRSIDHNQYVVAGLSYQSNYGSGLRVVDVSSVFEDPTASSFKEVG
FT                   SFDVHPEDDAVGGEVEFVGSWSVYPFFASGHILLNSIERGIYSLKYTGPAAEN"
FT   gene            757569..758295
FT                   /locus_tag="ANIA_07180"
FT                   /old_locus_tag="AN7180.4"
FT                   /product="CutinasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5AX00]"
FT   mRNA            join(757569..757751,757813..758295)
FT                   /locus_tag="ANIA_07180"
FT                   /old_locus_tag="AN7180.4"
FT                   /note="transcript_id=CADANIAT00000274"
FT   CDS             join(757569..757751,757813..758295)
FT                   /locus_tag="ANIA_07180"
FT                   /old_locus_tag="AN7180.4"
FT                   /product="CutinasePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5AX00]"
FT                   /note="transcript_id=CADANIAT00000274"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000274"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000274"
FT                   /db_xref="GOA:Q5AX00"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR011150"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AX00"
FT                   /protein_id="CBF78915.1"
FT                   /translation="MRFHTILLAALASLVIATPLPSDTDVSLERRQSMNSNDLEKGDCK
FT                   SVAFIFARGSTEIGNMGFVVGPGVCSNLKSTLGSDKVACQGVGGAYTAGLIQNALPANT
FT                   DSGSIKEAVKMFDLAAKCPDTQIVAGGYSQGSAVIDNAIQKLDDSTRDRVKGVVLFGFT
FT                   RNLQDKGQIPGYPKDQTKVYCAVGDLVCSGTLIITASHMTYGLNAGDAAKFLASQVSV"
FT   gene            759541..759788
FT                   /locus_tag="ANIA_11549"
FT                   /old_locus_tag="AN11549.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(759541..759548,759623..759788)
FT                   /locus_tag="ANIA_11549"
FT                   /old_locus_tag="AN11549.4"
FT                   /note="transcript_id=CADANIAT00000275"
FT   CDS             join(759541..759548,759623..759788)
FT                   /locus_tag="ANIA_11549"
FT                   /old_locus_tag="AN11549.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000275"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000275"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000275"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD43"
FT                   /protein_id="CBF78917.1"
FT                   /translation="MNAGKAARVFNNSFADAITVAAAYHLHRPSSGELAKSPPHPKHRF
FT                   LCSIQITSVKYG"
FT   gene            complement(761543..762420)
FT                   /locus_tag="ANIA_07179"
FT                   /old_locus_tag="AN7179.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(761543..761916,761996..762131,
FT                   762277..762420))
FT                   /locus_tag="ANIA_07179"
FT                   /old_locus_tag="AN7179.4"
FT                   /note="transcript_id=CADANIAT00000276"
FT   CDS             complement(join(761543..761916,761996..762131,
FT                   762277..762420))
FT                   /locus_tag="ANIA_07179"
FT                   /old_locus_tag="AN7179.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000276"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000276"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000276"
FT                   /db_xref="GOA:Q5AX01"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX01"
FT                   /protein_id="CBF78919.1"
FT                   /translation="MATTVTGDLPHDNLQAQAIGMILPFQLLRLLPSFCGCISVYGRAR
FT                   LPQGETVTSYSLSLPTTPVTVKLKIAVINYNYVGYHIWDVPSDWDSTPGRTALQPRPRP
FT                   HQDLYPALSSPPDRAEEGCAANDHCLLVLNAIAAVVTFLITTFSCLPVASNWDPNSYPN
FT                   EKCINLSDFVTGTASVSIFTDFLVLLMPTWIVYNLHIAKKQKIMLIGILSFGLM"
FT   gene            763629..764621
FT                   /locus_tag="ANIA_07178"
FT                   /old_locus_tag="AN7178.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(763629..763852,763910..764621)
FT                   /locus_tag="ANIA_07178"
FT                   /old_locus_tag="AN7178.4"
FT                   /note="transcript_id=CADANIAT00000277"
FT   CDS             join(763629..763852,763910..764621)
FT                   /locus_tag="ANIA_07178"
FT                   /old_locus_tag="AN7178.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000277"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000277"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000277"
FT                   /db_xref="GOA:Q5AX02"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX02"
FT                   /protein_id="CBF78921.1"
FT                   /translation="MRRPVRVSPGRAGTVASSCRATKSGPALTWEIFDLLGGSLIKATP
FT                   LAAYCYPDWPEYDADKCSEITTNWIISDIRMDDPVSIMLPLYEGRTCIPPGYNYTDTCT
FT                   QGGYPTYVVNATTVAQIQMAVNFARNPNLRLVVENTGHDFNGKAAGKGALSIWTHWLKD
FT                   KAFYPEYHADNGYVGPAIKFGAGAQVWEAYEFANENGVSHCHWWRGCDCWSGVGYTASG
FT                   GHSPLSSLYGMAADQVLSMEGTSLTFFEPISYPLTTQHEIANEMTVVLADGHSSRLPLP
FT                   KTLPLLSQIICNDSWHTPIPAFNVECQAYT"
FT   gene            766009..767038
FT                   /locus_tag="ANIA_07177"
FT                   /old_locus_tag="AN7177.4"
FT                   /product="WW domain protein (AFU_orthologue; AFUA_4G03322)"
FT   mRNA            join(766009..766675,766748..767038)
FT                   /locus_tag="ANIA_07177"
FT                   /old_locus_tag="AN7177.4"
FT                   /note="transcript_id=CADANIAT00000278"
FT   CDS             join(766054..766675,766748..766821)
FT                   /locus_tag="ANIA_07177"
FT                   /old_locus_tag="AN7177.4"
FT                   /product="WW domain protein (AFU_orthologue; AFUA_4G03322)"
FT                   /note="transcript_id=CADANIAT00000278"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000278"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000278"
FT                   /db_xref="GOA:Q5AX03"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX03"
FT                   /protein_id="CBF78923.1"
FT                   /translation="MSYYGEARDYYGERPPAPYERPPYDRPPYDGAPPAERPHYERPPY
FT                   ERPPYEEHRSYESRPPYERPPYEESRSYDSRPPYSGPPPSARPPSYPPPPLPIGWIQEW
FT                   EPRARRAFYVETATGRSEWALPDDVSYSEASRSGPGEYYAPPPPAPAYPPQDYGAPAYP
FT                   PHDQGYGGEYQKEEKKSDTGKILAAGAAGLAIGAVGGAILGHELAENSDEEHSHHSDDE
FT                   PHYSDDGDD"
FT   gene            767844..768603
FT                   /locus_tag="ANIA_07176"
FT                   /old_locus_tag="AN7176.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(767844..768035,768098..768155,768302..768312,
FT                   768418..768603)
FT                   /locus_tag="ANIA_07176"
FT                   /old_locus_tag="AN7176.4"
FT                   /note="transcript_id=CADANIAT00000279"
FT   CDS             join(767844..768035,768098..768155,768302..768312,
FT                   768418..768603)
FT                   /locus_tag="ANIA_07176"
FT                   /old_locus_tag="AN7176.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000279"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000279"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000279"
FT                   /db_xref="GOA:Q5AX04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX04"
FT                   /protein_id="CBF78924.1"
FT                   /translation="MVDIATNVLTTTVSVQSVSRHAISFWLRCLSPVSANHDSPLWEAQ
FT                   SVLEHPTELRINTLGIEPITRSSHYEDVRSNFNFDINQVDGETQNELLMVVTSVEPFQL
FT                   TYLEPIIFYTEHAIAVEHADSVLNRKEPWTRHTLDSISDAYCMQ"
FT   gene            complement(769523..770466)
FT                   /locus_tag="ANIA_07175"
FT                   /old_locus_tag="AN7175.4"
FT                   /product="ubiE/COQ5 methyltransferase, putative
FT                   (AFU_orthologue; AFUA_4G03321)"
FT   mRNA            complement(769523..770466)
FT                   /locus_tag="ANIA_07175"
FT                   /old_locus_tag="AN7175.4"
FT                   /note="transcript_id=CADANIAT00000280"
FT   CDS             complement(769523..770464)
FT                   /locus_tag="ANIA_07175"
FT                   /old_locus_tag="AN7175.4"
FT                   /product="ubiE/COQ5 methyltransferase, putative
FT                   (AFU_orthologue; AFUA_4G03321)"
FT                   /note="transcript_id=CADANIAT00000280"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000280"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000280"
FT                   /db_xref="GOA:C8VD48"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD48"
FT                   /protein_id="CBF78926.1"
FT                   /translation="MEVAVPSSPLDRTPRQTSPTSAPFVQTLFLPVPRSDDLATDLITT
FT                   RRMTTYTTNHAPSVLQTHSWRTAQNSAPHLLPHLQPGLKILDIGCGPGSITVDLARLVG
FT                   PTGHVTGIEYVSDPLDSAAALAASSGITNVTFQVGDIHALQFDDDTFDVVHVHQVLQHI
FT                   RDPVQALREMRRVVKQGGIVSVRESDTMSWYPCNQGIQDWLDLTGRMASAKGGNPHPGR
FT                   KIHVWAVEAGFERERIERSAGTWCFSTPAEREYWGESMARRMESSGFSEGAVRDGFSSQ
FT                   EELRAIARGWREWVAHEDGWFGLLHGQILCWK"
FT   gene            773568..775078
FT                   /locus_tag="ANIA_07174"
FT                   /old_locus_tag="AN7174.4"
FT                   /product="putative Myb-like transcription factor
FT                   (Eurofung)"
FT   mRNA            join(773568..773643,773718..773836,773904..774009,
FT                   774060..774127,774192..774292,774354..775078)
FT                   /locus_tag="ANIA_07174"
FT                   /old_locus_tag="AN7174.4"
FT                   /note="transcript_id=CADANIAT00000281"
FT   CDS             join(773568..773643,773718..773836,773904..774009,
FT                   774060..774127,774192..774292,774354..774801)
FT                   /locus_tag="ANIA_07174"
FT                   /old_locus_tag="AN7174.4"
FT                   /product="putative Myb-like transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000281"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000281"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000281"
FT                   /db_xref="GOA:Q5AX06"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX06"
FT                   /protein_id="CBF78928.1"
FT                   /translation="MTEPRRRWTAAEDALLWDLYQVQEKAPTGKCQKINWNEIARHIPG
FT                   RTNKDCRKRYYNRFTGGLRKGSWTQEEDERLFRLVERYQYRWATIAQKMETRNADQCSK
FT                   RWHHCLNPELERSPWTVDENMLLLSAVNTHGSSWKDIQKCHFPTRSANNIKNQYTILSR
FT                   KNISLAPAHLHPCCDSPSPSKSSRRPPSTPTSTPQVPGSRQGSSYDPYDYGSLSSTPQL
FT                   SATDYLPATPEAPAVNFDMAMGAFGDSCGYMPQYQPSPSFYANSPDGSELMMPETMGMR
FT                   MRYDFRDGLEQEGVRYPGQETFGY"
FT   gene            complement(777130..779878)
FT                   /locus_tag="ANIA_07173"
FT                   /old_locus_tag="AN7173.4"
FT                   /product="Vacuolar Ca(2+)/H(+) exchanger, putative
FT                   (Eurofung)"
FT   mRNA            complement(join(777130..777605,777655..779622,
FT                   779808..779878))
FT                   /locus_tag="ANIA_07173"
FT                   /old_locus_tag="AN7173.4"
FT                   /note="transcript_id=CADANIAT00000282"
FT   CDS             complement(join(777349..777605,777655..779622,
FT                   779808..779811))
FT                   /locus_tag="ANIA_07173"
FT                   /old_locus_tag="AN7173.4"
FT                   /product="Vacuolar Ca(2+)/H(+) exchanger, putative
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000282"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000282"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000282"
FT                   /db_xref="GOA:Q5AX07"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX07"
FT                   /protein_id="CBF78930.1"
FT                   /translation="MHRIRSWAKAHASISPNSQSQGASLESTERPDDPDIRTQNDQVNK
FT                   PAGDPVTGSPTDDNSQKKGLVPRMKNGSIRFFRHTKTAICHSWVNVLLVFVPVGIAAEA
FT                   AGLNPSVIFAMNAVAIIPLAGLLSHATECVASRMGDAIGALLNVTFGNAVELIIFIIAL
FT                   VKNEIRIVQASLLGSILANLLLILGMAFLLGGLRFQEQIYNSTVTQMSACLLSLAVTSL
FT                   LLPTAFHASFKDSDVAMDKTLKVSRGTSVVLLLVYVLYIVFQLKSHAYLYASIPQQIID
FT                   EESHPGVLADLMDSSSDSSSSSSSDESDDTTTSWTTAKRIKRAMKYRRYRKASTSSRGT
FT                   NSPELTQKSSVIDVSSLPPRQSSATSASSEERRDETGSYIAAVEQGQEKNGPRSRDFGD
FT                   DGLNVDAITIASRSEGPQSRDFGQTPSIHLAEKGRRGTKRERKKKRKAAKEEAKQSTAP
FT                   ELAQPAANPRVSALSVGQGESADIPRKWSPFRPSLPSLLSNTVFATPPPTTSNDPWGNF
FT                   NGLRRTHSLPSLSQRPPQRVQRPPPVGNAVQFARVAARMPPAGSPTSKQQPQEHEEPGM
FT                   SRTAAVVMLLLSTGLVAVCAEFLVDAIPAMVESSHVSEAFIGLIILPIVGNAAEHVTAV
FT                   TVATKNKMDLSIGVSVGSSIQIAIFVTPLVVILGWIMDKEMTLYFTLFETISLFVTCFV
FT                   VNFLVLDGRSNYLEGALLCAAYVIIAVAAFFYPDNDQSSALGQAGSAS"
FT   gene            781559..784821
FT                   /locus_tag="ANIA_07172"
FT                   /old_locus_tag="AN7172.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(781559..781602,781639..783550,783759..784588,
FT                   784656..784821)
FT                   /locus_tag="ANIA_07172"
FT                   /old_locus_tag="AN7172.4"
FT                   /note="transcript_id=CADANIAT00000283"
FT   CDS             join(781559..781602,781639..783550,783759..784588,
FT                   784656..784752)
FT                   /locus_tag="ANIA_07172"
FT                   /old_locus_tag="AN7172.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000283"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000283"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000283"
FT                   /db_xref="GOA:C8VD51"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD51"
FT                   /protein_id="CBF78932.1"
FT                   /translation="MFPVSQWLRYTSLSKNFSPSKWLRTLHLDARTCLLMLKGALPPTI
FT                   VIAIYQSSAISNITLTIGYLSALISVLSQALLPRAKFTKIVFFDVLSTCIAASLCCLAV
FT                   FCAVKAQEHHAPPVPPQDAYSSDACAVSAVWLIVMIWAANAIRAWKPAELQDPMVAFSV
FT                   FSSVTLTRTGTFVSLSDGLEFISRLLKGFMLGFAIATGVSLLVYPVTSRGDVFQDVREY
FT                   AAQIHIVLKAQGEFVGDGFALCAGQALSSSGRDGTPAMSDSPQALRKKLQAAVTGLHAI
FT                   QAKLQSDLFYSKDEIAWGKLSASDLTQFGGLFKNLFLPLSGLAMLPDILDMVSSQEAQA
FT                   TLDIALNHLGEVSSRSGTEHVAAFLHSRLEDCSELVNAGLQYALLKLEIMKPIQLDRHR
FT                   DEEAGQPLNPLSPHFPAQFEKRKLEYHSRRRQLPQAFVSLEALSYEKSADGVSDDESAA
FT                   TDVDVEQSFFLVLYILQLQDKLLKATQDFVEFANSKVMDGTMARKRIILPALTICEWLS
FT                   ITYKHRNKQSPHPNPEHLPPSTAWEKASSVLPLICRVLRSSESVFGFRVAAASFCVGIL
FT                   AYLHQTQDFFIRQRCIWAMIVIVIGMSPTSGQTLLGFITRIAATVISLALSLMVWYIPD
FT                   QHTAGVIVFLYLANVFEMRKLGTDVGTSNGQPYYPIYLFAPYKLLAVAAGCAISFIWVV
FT                   LPYPVTSKSTLRKSLGEGLYLLARFYSCLHATIELWMKGELGEGSVQSTNSAITQDLQK
FT                   TRQRVFKEGMILLTKLRTLSHFSTFEPRIGGKFPKSTYDAIIREIQRMFISMALMAQTA
FT                   QSFQDPSLLSTRGNTRMEDKFTKKWSSRLASIALQSTDFKSHATTSLLCHLGSAVLNAQ
FT                   PLPPYLSTGASFPLARAVRQTDKDLMSIRHIHDPAFSAFASLEVLRSVVGAGLGKLLGN
FT                   VKSLVGELSFDVRDQGGDEGAELRTLMDDL"
FT   gene            785608..786296
FT                   /locus_tag="ANIA_07171"
FT                   /old_locus_tag="AN7171.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(785608..785689,785748..785963,786208..786296)
FT                   /locus_tag="ANIA_07171"
FT                   /old_locus_tag="AN7171.4"
FT                   /note="transcript_id=CADANIAT00000284"
FT   CDS             join(785608..785689,785748..785963,786208..786296)
FT                   /locus_tag="ANIA_07171"
FT                   /old_locus_tag="AN7171.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000284"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000284"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000284"
FT                   /db_xref="GOA:Q5AX09"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX09"
FT                   /protein_id="CBF78933.1"
FT                   /translation="MPAAECEAFFEIEERARRRVMEGLKHYYLDTLVVHPNYQRRGAGS
FT                   MLVQWDCGLADEEGVALYADASRAGAPLYERFGFVDESKGDSGQAEVASMIRRALPTTQ
FT                   AYNMTLSNYRRLNIPVPLQLGYKP"
FT   gene            complement(790088..791516)
FT                   /locus_tag="ANIA_07170"
FT                   /old_locus_tag="AN7170.4"
FT                   /product="putative bHLH transcription factor (Eurofung)"
FT   mRNA            complement(join(790088..790984,791092..791516))
FT                   /locus_tag="ANIA_07170"
FT                   /old_locus_tag="AN7170.4"
FT                   /note="transcript_id=CADANIAT00000285"
FT   CDS             complement(join(790364..790984,791092..791304))
FT                   /locus_tag="ANIA_07170"
FT                   /old_locus_tag="AN7170.4"
FT                   /product="putative bHLH transcription factor (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000285"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000285"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000285"
FT                   /db_xref="GOA:C8VD53"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD53"
FT                   /protein_id="CBF78935.1"
FT                   /translation="MAYMSPDPLSANWSYDSAIDLFSLNTMIPEPFPLDIPNDMLWDAK
FT                   ELPADFFAAPTDINGFTVSHDESLSSDQESDDQSFSPNNFMASTPPSASTLDLPSPMAM
FT                   PMNIKTEPQTTINPCSTQSQQPKRKASMISDSSSRYSSPELSPQQPSPPPRQTTTTGRR
FT                   SRAANATNGDENTARGRNAAKRAAHNIIEKRYRTNMNAKFVALEKAMSVKTSGVSKAVS
FT                   STNSSSNGVKSSASLKKSEILSNAITYMQELQEMNERLRKEVAALTRERRANAYC"
FT   gene            complement(794099..795579)
FT                   /locus_tag="ANIA_07169"
FT                   /old_locus_tag="AN7169.4"
FT                   /product="expressed flavohemoprotein (Eurofung)"
FT   mRNA            complement(794099..795579)
FT                   /locus_tag="ANIA_07169"
FT                   /old_locus_tag="AN7169.4"
FT                   /note="transcript_id=CADANIAT00000286"
FT   CDS             complement(794316..795548)
FT                   /locus_tag="ANIA_07169"
FT                   /old_locus_tag="AN7169.4"
FT                   /product="expressed flavohemoprotein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000286"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000286"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000286"
FT                   /db_xref="GOA:Q5AX11"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX11"
FT                   /protein_id="CBF78937.1"
FT                   /translation="MSLSPEQIQLIKATVPVLQEHGTTITKVFYDNMLTAHPELKTVFN
FT                   VSNKVHGHQPQALAGALFAYASYIDNLGVLSPAVERICHKHASLAIQPDGYQIVGKFLL
FT                   EAMGQVLGDALTPPLLEAWAAAYWQLANIMIGKEAELYKSADGWTDFRDFRVARKEPES
FT                   DVITSFYLEPVDGKPLPSFLPGQYVSIQVQVPQLNHAQCRQYSLSDQPKPTYYRISVRK
FT                   DLGLDASDPSAPAHPGYVSNILHDNINVGDIVKLTHPYGDFHLTDAAASSPLVLISAGV
FT                   GLTPMTSMVNTLRTAESNTRPVHFIHGAHTSASRAFQAHLQSLPNLKTTYFLTAPTESD
FT                   KQGENYTYKGRVDLSKIADEDLFLGDKQTEYYICGPTAFMLDTQKALVARGVDQSRVHM
FT                   ELFGTGGVPAA"
FT   gene            796405..797545
FT                   /locus_tag="ANIA_10902"
FT                   /old_locus_tag="AN10902.4"
FT                   /product="MIP aquaporin (Eurofung)"
FT   mRNA            join(796405..796743,796804..797104,797160..797545)
FT                   /locus_tag="ANIA_10902"
FT                   /old_locus_tag="AN10902.4"
FT                   /note="transcript_id=CADANIAT00000287"
FT   CDS             join(796405..796743,796804..797104,797160..797545)
FT                   /locus_tag="ANIA_10902"
FT                   /old_locus_tag="AN10902.4"
FT                   /product="MIP aquaporin (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000287"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000287"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000287"
FT                   /db_xref="GOA:C8VD55"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD55"
FT                   /protein_id="CBF78938.1"
FT                   /translation="MRSRIPNILKPWGRQETQGDTPVVRRNRNQLPMLHLADTTRNNLI
FT                   AMTGEFVGTFLFLFFSFAGTQVANTPKPVEGAPPNTDALLYSALAFGFSLMVNIWAFYR
FT                   VTGLLFNPAVTLALCLVGGMPAYRGLFVFAAQIVGGIAAAGVVSALFPGDLNVSTRLGG
FT                   GASISQGLFIEMFLTAQLVFVIIMLAVVKHKGTFLAPVAIGIAFFVTEMIGDYYTGGSL
FT                   NPARSLGPDVINRSFPGYHWIYWVGPLLGSLLACGFYYFLTFFSYESVNPGQDFNEWEA
FT                   KWGPGPTSWDSSMRQHSHSDTTTLNRGMSPRDSRAARNGNGDWNGAHGAHVPPPPGEEQ
FT                   V"
FT   gene            797995..800239
FT                   /locus_tag="ANIA_10905"
FT                   /old_locus_tag="AN10905.4"
FT                   /product="GABA permease (Uga4), putative (AFU_orthologue;
FT                   AFUA_4G03370)"
FT   mRNA            join(797995..798280,798365..798560,798649..799181,
FT                   799238..799324,799394..799778,799861..800239)
FT                   /locus_tag="ANIA_10905"
FT                   /old_locus_tag="AN10905.4"
FT                   /note="transcript_id=CADANIAT00000288"
FT   CDS             join(798065..798280,798365..798560,798649..799181,
FT                   799238..799324,799394..799778,799861..800078)
FT                   /locus_tag="ANIA_10905"
FT                   /old_locus_tag="AN10905.4"
FT                   /product="GABA permease (Uga4), putative (AFU_orthologue;
FT                   AFUA_4G03370)"
FT                   /note="transcript_id=CADANIAT00000288"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000288"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000288"
FT                   /db_xref="GOA:C8VD56"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD56"
FT                   /protein_id="CBF78940.1"
FT                   /translation="MGKQTDVRPPSPGLGDTYDQQLLAKLGYKQELRRSYSTLQIFAIA
FT                   FSIMGLVPSIASTIPFSLPAGPAGMVWGWLTASILIFTVGLAMSDMASSMPTAGGFYWW
FT                   THYFAGKKFKRPLSFLVGYSNTLGLIGGICSVDYTLSLLILACISIARDGNWSASNGII
FT                   YGLYAGLILVHSVATIVTSNIMPRIQTACIFINVGLIIATVVALPVGKVTRGGTLNSGS
FT                   FVFGHIDNLSNWPTGWNFVLAFMSPIWAIGFFDSCVHMSEEARDAPKAVPRGILFSAGS
FT                   ACLLGFLVLSVLAAVMDPDVAKTAGTVYGQPMAQIYYDSLGKRGALGFMAVLILIQFLI
FT                   GLSLIVAASRQVFAFSRDYALPFSPILRKITSLNGQPQPINAIVFLGGICVIFGLLALI
FT                   NSVAANALFSLFVASNYVAWGTPILCRLIWSKRFVPGAFYTGPKVSSIIAGIAVAWLGF
FT                   GLLLSMFPTVKNPGPAEMNYTVVINGFVWIASMLYYAVYARKVFTGPRVTLAEGEGVSS
FT                   SFIGTQAEAAREVNNEKEVGTDTSPAG"
FT   gene            complement(801441..803072)
FT                   /locus_tag="ANIA_07167"
FT                   /old_locus_tag="AN7167.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(801441..801999,802066..803072))
FT                   /locus_tag="ANIA_07167"
FT                   /old_locus_tag="AN7167.4"
FT                   /note="transcript_id=CADANIAT00000289"
FT   CDS             complement(join(801441..801999,802066..803072))
FT                   /locus_tag="ANIA_07167"
FT                   /old_locus_tag="AN7167.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000289"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000289"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000289"
FT                   /db_xref="GOA:Q5AX13"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX13"
FT                   /protein_id="CBF78942.1"
FT                   /translation="MHVLDDDNLSSQPAVHGHQSGTKKAAASATVTAVSEPYCVTSTHG
FT                   KVFIISLTSIAMVITMIATNIVLPVLPILQAEYGVTTTQMNLLVTVFSLVQGITPALMS
FT                   SLSDLQGRRIAWMFTLALYTVANIGLAAQDSYIALIVLRCLQSLGSSCAIPFGFAVAAD
FT                   ISSPAERGRYIGPLQGSVMGAFAFGPVIGGLLAPSFGWRSIFWFLAIGSGAALLAYIFI
FT                   IPETARSIVGNGSIEPAGWWRRTVVQNIQRSLQRGSDYKRSGTQHGRSAASPQRRIGAA
FT                   EVLRAFTILAEKDALILVVFTSLFYSGVTAMWATTGSYYSSLYGLDTLSVGFSYLPYGI
FT                   AGCIGSIIGGRLLDINYRRIQRHQAQALKDADVHKPADADFPYEVARLQVAAPFALLAS
FT                   LSLITYGWIVQTRQSLAAALALQGLIGLSGTPLLGIIYTLLIDLYPTQAVATQGAADLV
FT                   RCWLGALFAAVIDYMLESMGWGWSFTLLGLNMAVVMPLVGLVYVHGPRWRLRKAMQTNE
FT                   KEDS"
FT   gene            complement(804700..805649)
FT                   /locus_tag="ANIA_07166"
FT                   /old_locus_tag="AN7166.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_4G03360)"
FT   mRNA            complement(804700..805649)
FT                   /locus_tag="ANIA_07166"
FT                   /old_locus_tag="AN7166.4"
FT                   /note="transcript_id=CADANIAT00000290"
FT   CDS             complement(804943..805548)
FT                   /locus_tag="ANIA_07166"
FT                   /old_locus_tag="AN7166.4"
FT                   /product="GPI anchored protein, putative (AFU_orthologue;
FT                   AFUA_4G03360)"
FT                   /note="transcript_id=CADANIAT00000290"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000290"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000290"
FT                   /db_xref="GOA:Q5AX14"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX14"
FT                   /protein_id="CBF78944.1"
FT                   /translation="MKLLLSTLFLAALARAQDNNNDNSLGDNIGDIVDNVTSGAEDVGT
FT                   AISTDFASATDSLTNLPTDVSSWAESVASDASSWATDASTDAESAWSSATSVGESLFST
FT                   ATSDVSSALDSISSSVSDALTSATDSVTTTVETTTTGSDGSATTTTTEITTSATDDASA
FT                   TQSGDESEPTDSDDVAAYATPFMGVAGIMGVMGVVAAL"
FT   gene            complement(806650..809191)
FT                   /locus_tag="ANIA_07165"
FT                   /old_locus_tag="AN7165.4"
FT                   /product="plasma membrane stress response protein (Ist2),
FT                   putative (AFU_orthologue; AFUA_4G03330)"
FT   mRNA            complement(join(806650..808703,808760..809191))
FT                   /locus_tag="ANIA_07165"
FT                   /old_locus_tag="AN7165.4"
FT                   /note="transcript_id=CADANIAT00000291"
FT   CDS             complement(join(806650..808703,808760..808853))
FT                   /locus_tag="ANIA_07165"
FT                   /old_locus_tag="AN7165.4"
FT                   /product="plasma membrane stress response protein (Ist2),
FT                   putative (AFU_orthologue; AFUA_4G03330)"
FT                   /note="transcript_id=CADANIAT00000291"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000291"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000291"
FT                   /db_xref="GOA:C8VD59"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD59"
FT                   /protein_id="CBF78946.1"
FT                   /translation="MSLTPNYRPPEQAQLDNFGVDWVVHYQFEDLDASTALAEFEALIR
FT                   DLEGAHLETQVRPGHGASLLVFIRVPRMHLGRMVHQSRVKDWLYGIIHELPAGDDETIA
FT                   DAETPAEALRSVYHAVTWKKTLGGAHITPKHGKWKHVASAFPLHDQVANAELLRKWSRT
FT                   VLLTAEDLDAIRSLFGEKVAFYFAFIQSYSSFLVFPAIWGAVTWWYMGPYSITFAVGNC
FT                   LWAMVFVEYWKIRETDLSLRWQVKGVGVLKVTRNKYVWDKEVRDPITGEMVQVFSPYKQ
FT                   FLRQLLLIPFASVASLALGGLIVVTFAMEVFISEVYTGSLKGYLEFLPTIVFSLCLPSI
FT                   TGLLTSIATRLTKYENYRTQDQYDLAQTAKQFVMHFITAFLPTILTAFVYVPFGATIVP
FT                   YLDFTRRTEKQDFHVDNARLQQEVIYLSMTGQVVDFGTEVVLPYVQRVIWQKWRDYQSR
FT                   KEAVQGRRRVSSATNQVLLDSPEEKEFLARVRNEAEADEYNVHEDTLEMCVQFGYLTLF
FT                   GASWPLVALGFLLNNWLELRGDFFKLSLECQRPPPIRADSIGPSLQGLEVLSWLGTLST
FT                   AAIVYLYRGDIAEVRVSSLLLTVLVAEWAYLGLRFAVRTGLRTILSTTLRRESAKRYAM
FT                   RKGYLQASTGGSSPRGKHRVRFRDRVSVYTSATDPPSPQSDDVLHEATMDSERRFWAGT
FT                   AVEDGVRIIKALARRKGEKEM"
FT   gene            complement(809714..812411)
FT                   /locus_tag="ANIA_07164"
FT                   /old_locus_tag="AN7164.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(809714..809775,809980..810127,
FT                   810199..810328,810703..810969,811118..811257,
FT                   811317..811431,811494..811773,811949..812411))
FT                   /locus_tag="ANIA_07164"
FT                   /old_locus_tag="AN7164.4"
FT                   /note="transcript_id=CADANIAT00000292"
FT   CDS             complement(join(809714..809775,809980..810127,
FT                   810199..810328,810703..810969,811118..811257,
FT                   811317..811431,811494..811773,811949..812411))
FT                   /locus_tag="ANIA_07164"
FT                   /old_locus_tag="AN7164.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000292"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000292"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000292"
FT                   /db_xref="GOA:Q5AX16"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX16"
FT                   /protein_id="CBF78948.1"
FT                   /translation="MSSNEPHLCFRSFVEALKADNDLVGINDPIDPNLEAAAITRLVCE
FT                   NDEKAPLFNNLIGAKDGFFRILGAPASQRKSQSERYGRLARHLALPPTASMREILDKML
FT                   EADKLPPIPPRVVPTGPCKENVLEGDQIDLTKLPVPMVHKSDGGAYIQTFAYLADPPDV
FT                   EEGKPRCPLGSSVRRPPAAIMASSMPILDGVTEAEYVGAMVGQPIELTKCDTNDIYVPA
FT                   NSEIVLEGTLSTTDTGPEGPFGEMHGYIFPEDMHICPKYKVNKITYRNNAILPMSSCGK
FT                   LTDETHTMIGSLAAAEIRKICQKANLPVLDAFAPFISQVTWVALRIDTSKLPTRCKPGV
FT                   DEVFYDDVRAFPLILYNGHGGKKSEGRSAVRGGKVVSNALMDIEYTQGRRNWEAADFNG
FT                   SYPEDVKSNVLGKWEKLGFGRLEKVTNEDRRNIVQSLDAHVDRSKSRQHRNRHAFTSSF
FT                   RRSGSTRLWIVEEEEHDDSKEDNQRRNEHECEQEQTQPKGEALAGEKPAGHMFGESGFE
FT                   FGPIEGIKMDACEDPHS"
FT   gene            812714..816061
FT                   /locus_tag="ANIA_07163"
FT                   /old_locus_tag="AN7163.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            join(812714..812737,812814..813508,813552..813808,
FT                   814281..814694,814785..814977,815040..815086,
FT                   815210..815304,815567..816061)
FT                   /locus_tag="ANIA_07163"
FT                   /old_locus_tag="AN7163.4"
FT                   /note="transcript_id=CADANIAT00000293"
FT   CDS             join(812714..812737,812814..813508,813552..813808,
FT                   814281..814694,814785..814977,815040..815086,
FT                   815210..815304,815567..816061)
FT                   /locus_tag="ANIA_07163"
FT                   /old_locus_tag="AN7163.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000293"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000293"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000293"
FT                   /db_xref="GOA:Q5AX17"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX17"
FT                   /protein_id="CBF78949.1"
FT                   /translation="MFPQCRQSTASTSLKDAGYSKQSTLTSCQLSGLCPGHNWVYDYCE
FT                   HELLNGLEMNRSPSTVERQEIDRVLRLKRKQRESKACYPCRQRKVKCDGSHPCRTCVKR
FT                   DHPEICAYNVEKDTPQRRTQSRQAEQTAKSRNEDARPTCSPASADADSQLLPTSPLSSP
FT                   RSSAQANEASSYVFSGDNSLVSMLRQQDPDGAMAREATSVLRPHNTYLSYPFIESKTPQ
FT                   DRWVALVDILPHRDEVLKFFHFYRICAYPFNPILVDIDKFESDICIYLGAYASGDLSDR
FT                   SKVSEQWSSGKAVGHISLLLATLAAGAHFSDLENPQRSELCQDFALDFIGMQESAAAEP
FT                   NHNLTLLAELDSTYARAQPHLLRRESCRNLQQHLEHLALRMHVSFCVSTLCRPAIKTSP
FT                   QSSEDSRYATLRTRARESLIIASKAFLDFQALSIVPLRTWSMVHTVLSSTLLLCTWQET
FT                   RDDPESRHIRALITLRQTLKQRSSVGSLDQGHIQRPAGDFSGPSAAGMPPEMMLGDFSS
FT                   YNDMYPGPGYGEMDFSPVTYLDSIMNVWPVVSELSERPSNRDDGPPRALGDTSVLTQQQ
FT                   RHTTLHASVSRGLRFRAEQPQHNNSHNHQAPGRRKRVVIGMSGATGALMGIKLLIALRR
FT                   LNIETHLIISKWAEATIKYETDYHPSNVKALADYTYNINDLAAPVSSGSFKTDGMIIVP
FT                   CSMKTLAAIHSGFCDDLISRTADVMLKERGDWSLWLERRHSARFT"
FT   gene            816506..817377
FT                   /locus_tag="ANIA_07162"
FT                   /old_locus_tag="AN7162.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(816506..816559,816706..817377)
FT                   /locus_tag="ANIA_07162"
FT                   /old_locus_tag="AN7162.4"
FT                   /note="transcript_id=CADANIAT00000294"
FT   CDS             join(816506..816559,816706..817377)
FT                   /locus_tag="ANIA_07162"
FT                   /old_locus_tag="AN7162.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000294"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000294"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000294"
FT                   /db_xref="GOA:Q5AX18"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX18"
FT                   /protein_id="CBF78951.1"
FT                   /translation="MFYKPGVTDHGLPHDPFKACVIPRPIGWISTKSAGPSGTANLAPY
FT                   SQFNNLTFDPPYVMFSSNQTPSNERKDTVRNVESTGQFVWNLATYPLREAVNITAEQVP
FT                   YGIDEFERAGLSKEDANLVDVPMVKESPVKFECVYHSTIRLPGNPPMGTVDIIIGRVVG
FT                   VHIADGVINERGLLDVSRTQPIARCGYYQYAVIRETFDMVIPGMSEDILKGLEGSVKGN
FT                   TEMGLRGRRGEGERNEKER"
FT   gene            818010..818581
FT                   /locus_tag="ANIA_11548"
FT                   /old_locus_tag="AN11548.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(818010..818026,818097..818181,818402..818581)
FT                   /locus_tag="ANIA_11548"
FT                   /old_locus_tag="AN11548.4"
FT                   /note="transcript_id=CADANIAT00000295"
FT   CDS             join(818010..818026,818097..818181,818402..818581)
FT                   /locus_tag="ANIA_11548"
FT                   /old_locus_tag="AN11548.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000295"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000295"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000295"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD63"
FT                   /protein_id="CBF78953.1"
FT                   /translation="MASFVRNIRAARLSPDVCTFDGSTLMRDEDNNPSQRESNMSGAEA
FT                   VQLLSILLQCGGTEPAPDPAGAGDTSPVEELDQHYIVEESTGMLPKFH"
FT   gene            820986..822217
FT                   /locus_tag="ANIA_07161"
FT                   /old_locus_tag="AN7161.4"
FT                   /product="extracellular dioxygenase, putative
FT                   (AFU_orthologue; AFUA_6G03070)"
FT   mRNA            join(820986..821370,821421..821516,821565..822217)
FT                   /locus_tag="ANIA_07161"
FT                   /old_locus_tag="AN7161.4"
FT                   /note="transcript_id=CADANIAT00000296"
FT   CDS             join(820986..821370,821421..821516,821565..822217)
FT                   /locus_tag="ANIA_07161"
FT                   /old_locus_tag="AN7161.4"
FT                   /product="extracellular dioxygenase, putative
FT                   (AFU_orthologue; AFUA_6G03070)"
FT                   /note="transcript_id=CADANIAT00000296"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000296"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000296"
FT                   /db_xref="GOA:Q5AX19"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX19"
FT                   /protein_id="CBF78955.1"
FT                   /translation="MVYLSTLLTGAVGLATVVFAHPGHDVKAEAAERAAALKSVRARGL
FT                   SQCATQLQARGVEAASVARRDASLQKIRKARGLSGPLLKARDTTPLTTSHESNLTVDLS
FT                   TDPSVLFASGGSCVLAEDVTQGPYYVSGELIRQNLVEDQPGVPLYLDIQLLDSETCEPV
FT                   PDVYLDFWHCNATGVYSGVVASGNGDSSDETNLDATFLRGIQQTDDSGVAEFETIFPGH
FT                   YTGRTTHIHVLSHPADTTANANDTLEGLYTTTSSHVGQIFFDQDLISLVEATDVYSSNT
FT                   QELTLNADDSILLQELNDDIDPFVEYVLLGEDVTDGIFAWINVVIDSSQSTSVTPAAYL
FT                   TEDGGVENENSGGFGGGSDGPGGSAPGGSAPTGAPPS"
FT   gene            complement(823788..825214)
FT                   /locus_tag="ANIA_07160"
FT                   /old_locus_tag="AN7160.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(823788..824011,824055..824250,
FT                   824753..824920,824995..825062,825154..825214))
FT                   /locus_tag="ANIA_07160"
FT                   /old_locus_tag="AN7160.4"
FT                   /note="transcript_id=CADANIAT00000297"
FT   CDS             complement(join(823788..824011,824055..824250,
FT                   824753..824920,824995..825062,825154..825214))
FT                   /locus_tag="ANIA_07160"
FT                   /old_locus_tag="AN7160.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000297"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000297"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000297"
FT                   /db_xref="GOA:Q5AX20"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX20"
FT                   /protein_id="CBF78957.1"
FT                   /translation="MRISEIDEVVDQVVRPCQKAIMKAITSLSLAALLRAYQLEMPKSI
FT                   QRENCGREQYEVQEYLCDCSPILRGHENENITQVPAVVQNHLHWSPANTRSSSWEASRS
FT                   MNIVPIVRGTGRKYPVTSSCCQSEATSYRELYTQVNSNSTLTYPFSEILAPFVSASRSY
FT                   YRRWLFDLNRKNDALGTFQCSKETVRVENDYSTSRKAVKWYKTGQKCEEFALWARMHPS
FT                   HTVFLFLEGIRLCFVY"
FT   gene            826896..828977
FT                   /locus_tag="ANIA_07159"
FT                   /old_locus_tag="AN7159.4"
FT                   /product="hypothetical tripeptidyl-peptidase (Eurofung)"
FT   mRNA            join(826896..826902,826941..827198,827266..828977)
FT                   /locus_tag="ANIA_07159"
FT                   /old_locus_tag="AN7159.4"
FT                   /note="transcript_id=CADANIAT00000298"
FT   CDS             join(826896..826902,826941..827198,827266..828977)
FT                   /locus_tag="ANIA_07159"
FT                   /old_locus_tag="AN7159.4"
FT                   /product="hypothetical tripeptidyl-peptidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000298"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000298"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000298"
FT                   /db_xref="GOA:Q5AX21"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX21"
FT                   /protein_id="CBF78959.1"
FT                   /translation="MAATGRFTAFWNVASVPALIGILPLAGSHLRAVLCPVCIWRHSKA
FT                   VCAPDTLQAMRAFTRVTAISLAGFSCFAAAAAAAFESLRAVPDGWIYESTPDPNQPLRL
FT                   RIALKQHNVAGFEQALLDMSTPGHSSYGQHFGSYHEMKQLLLPTEEASSSVRDWLSAAG
FT                   VEFEQDADWINFRTTVDQANALLDADFLWYTTTGSTGNPTRILRTLSYSVPSELAGYVN
FT                   MIQPTTRFGGTHANRATVRAKPIFLETNRQLINAISSGSLEHCEKAITPSCLADLYNTE
FT                   GYKASNRSGSKVAFASFLEEYARYDDLAEFEETYAPYAIGQNFSVISINGGLNDQDSTA
FT                   DSGEANLDLQYIIGVSSPLPVTEFTTGGRGKLIPDLSSPDPNDNTNEPFLDFLEAVLKL
FT                   DQKDLPQVISTSYGEDEQTIPEPYARSVCNLYAQLGSRGVSVLFSSGDSGVGAACQTND
FT                   GKNTTHFPPQFPASCPWVTAVGGTNGTAPESGVYFSSGGFSDYWARPAYQNAAVESYLR
FT                   KLGSTQAQYFNRSGRAFPDVAAQAQNFAVVDKGRVGLFDGTSCSSPVFAGIVALLNDVR
FT                   LKAGLPVLGFLNPWLYQDGLNGLNDIVDGGSTGCDGNNRFNGSPNGSPVIPYAGWNATE
FT                   GWDPVTGLGTPDFAKLKALVLDA"
FT   gene            complement(829023..830598)
FT                   /locus_tag="ANIA_07158"
FT                   /old_locus_tag="AN7158.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(829023..830002,830081..830598))
FT                   /locus_tag="ANIA_07158"
FT                   /old_locus_tag="AN7158.4"
FT                   /note="transcript_id=CADANIAT00000299"
FT   CDS             complement(join(829265..830002,830081..830443))
FT                   /locus_tag="ANIA_07158"
FT                   /old_locus_tag="AN7158.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000299"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000299"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000299"
FT                   /db_xref="GOA:C8VD67"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD67"
FT                   /protein_id="CBF78961.1"
FT                   /translation="MRAPITVSTTPGPAFLSRVSVGILLLLTFLTTASAASAIPALSTA
FT                   SLPEVTQQQHEDEYDLQPRSTKPFLLRVMPLGASITVGYMSSDENGYRKYLREQLRYAG
FT                   WGVDMVGSLANGTMKDNQNEGHFGDTIDHIAEAAVNSTRLQPNVILIKYSNLLSLTSSS
FT                   AYTCGSAGTNDCFQNIEINDADTRLDALITHLFASIPNTTIILSTLLPNEFASRAVRRV
FT                   SQEYRNLVARRRSRGDRLVLAEMSYFITNDQLVDGTHPSDTGYKMMAAVWWSAIQTAEK
FT                   EGKLSAPNIVTKSVLKDLVGINGTAQTEGKGLDDGPVEDPQLPEYNAPGQPGGSGGEGG
FT                   AVALGSGLRVKLGLGMVGLWIVCEFF"
FT   gene            complement(832283..832967)
FT                   /locus_tag="ANIA_07157"
FT                   /old_locus_tag="AN7157.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(832283..832523,832597..832967))
FT                   /locus_tag="ANIA_07157"
FT                   /old_locus_tag="AN7157.4"
FT                   /note="transcript_id=CADANIAT00000300"
FT   CDS             complement(join(832283..832523,832597..832967))
FT                   /locus_tag="ANIA_07157"
FT                   /old_locus_tag="AN7157.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000300"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000300"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000300"
FT                   /db_xref="GOA:Q5AX23"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX23"
FT                   /protein_id="CBF78963.1"
FT                   /translation="MTSKQSPSAEQIESADYITPAVETVPKPTATAEKAAQFLATTAVD
FT                   RSFTPEEEKAVRRRIDSRVLPLLLGAYFFQQLDKSSLSYVSIFGLVEDANLVGQQYSWL
FT                   GSILYLAQLVMFILVAIIAVIADLYLYWLNKRHARRRQELGKNARVVDESMLGKAKIQQ
FT                   SKAAAVEDGAGEEQKTEASVVDKGFQDTTDLKNEDFIYVY"
FT   gene            833524..834807
FT                   /locus_tag="ANIA_07156"
FT                   /old_locus_tag="AN7156.4"
FT                   /product="NAD binding Rossmann fold oxidoreductase,
FT                   putative (AFU_orthologue; AFUA_4G00560)"
FT   mRNA            833524..834807
FT                   /locus_tag="ANIA_07156"
FT                   /old_locus_tag="AN7156.4"
FT                   /note="transcript_id=CADANIAT00000301"
FT   CDS             833524..834807
FT                   /locus_tag="ANIA_07156"
FT                   /old_locus_tag="AN7156.4"
FT                   /product="NAD binding Rossmann fold oxidoreductase,
FT                   putative (AFU_orthologue; AFUA_4G00560)"
FT                   /note="transcript_id=CADANIAT00000301"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000301"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000301"
FT                   /db_xref="GOA:Q5AX24"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX24"
FT                   /protein_id="CBF78965.1"
FT                   /translation="MVKKYALVGTGGRAIFFYTAIVKDFSQTAQLVAFCDTNQTRLDYA
FT                   NSRLEALGHARIPTFLASDFDRMIAETQPDEVIVTTIDRTHNIYIVRALELGCNVITEK
FT                   PMTIDAPRCRQIFDAVERTGNRVRVTFNYRYAPHNTKIYELLSSGVIGQVNSVHFEWLL
FT                   NTQHGADYYRRWHRDKRNSGGLLVHKSTHHFDLVNFWLQSRPETVVAMGDLKFYGRENA
FT                   ERRGETKFYSRAYGSENAKDDHFALHLDRNPQLKSMYLDAEKEDAYFRDQSVFSDGISI
FT                   EDTMGVMVRYGSGAVLTYSLTSYAPWEGFRVMFNGSKGRLEVEVVEQSYVNSGGEQALE
FT                   GALESQSIVLRPMFGKPVQIEIPKGSGGHGGGDPQLLNDLFGEFIGDDPYRRAASHVDG
FT                   ALSILTGICANRSMSTGQTVRVDDVFKV"
FT   gene            836495..837037
FT                   /locus_tag="ANIA_07155"
FT                   /old_locus_tag="AN7155.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            836495..837037
FT                   /locus_tag="ANIA_07155"
FT                   /old_locus_tag="AN7155.4"
FT                   /note="transcript_id=CADANIAT00000302"
FT   CDS             836495..837037
FT                   /locus_tag="ANIA_07155"
FT                   /old_locus_tag="AN7155.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000302"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000302"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000302"
FT                   /db_xref="GOA:Q5AX25"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX25"
FT                   /protein_id="CBF78966.1"
FT                   /translation="MSFNNFDITANEFEHACETGDAAFIADILDSRTSPRIDQRKPLMA
FT                   AILNNHVEIVRLLLSRGEPDECLAVTADERALSLEASDITGSLQFAAMHGKIDVVEALL
FT                   RMGIAVNCVDRAGRTALGFAARAGKIDVVRLLVEAGASLTKVDKEGMTALDHAAAAVEI
FT                   EIIDFIRGEMRKGKAKV"
FT   gene            837909..839391
FT                   /locus_tag="ANIA_07154"
FT                   /old_locus_tag="AN7154.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(837909..838102,838150..838368,838619..838932,
FT                   839315..839391)
FT                   /locus_tag="ANIA_07154"
FT                   /old_locus_tag="AN7154.4"
FT                   /note="transcript_id=CADANIAT00000303"
FT   CDS             join(837909..838102,838150..838368,838619..838932,
FT                   839315..839391)
FT                   /locus_tag="ANIA_07154"
FT                   /old_locus_tag="AN7154.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000303"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000303"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000303"
FT                   /db_xref="GOA:Q5AX26"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX26"
FT                   /protein_id="CBF78968.1"
FT                   /translation="MPGRNPNLTDHQATGSLGDILLKSLLSEPAFKVAILTRESSRGRT
FT                   SIPPAARVITTVDSYPQKICFSVAEQLKFIDTAVAAGVKRYIPSEYGLDNNNFAARELS
FT                   PVFRDKGRVQDYVRLKEDTGLTWTAIACGMWIGCSTANQIVILSDFATTQVELVETIER
FT                   LTSETWRRESVDPSLAEGWSKGDTAAGHGLTNIGFTKGTYGGHFEPLYQLRNWELALPT
FT                   RDLEGVVREALREVGHRDLTEKGARQIKNGALILAQRSTVPELRE"
FT   gene            840819..842674
FT                   /locus_tag="ANIA_07153"
FT                   /old_locus_tag="AN7153.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(840819..841090,841216..842674)
FT                   /locus_tag="ANIA_07153"
FT                   /old_locus_tag="AN7153.4"
FT                   /note="transcript_id=CADANIAT00000304"
FT   CDS             join(840819..841090,841216..842674)
FT                   /locus_tag="ANIA_07153"
FT                   /old_locus_tag="AN7153.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000304"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000304"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000304"
FT                   /db_xref="GOA:Q5AX27"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX27"
FT                   /protein_id="CBF78970.1"
FT                   /translation="MSRHYLLTTCSLLAVLSGVAAAPGCPTINSSCRYLPNDPQWPSTE
FT                   QWQQLNDSVGGRLIRGISLASPCHGEEYNNITCGTLQERWASPPTYCSPFMSRDSPCSL
FT                   GNIAPYAINVSSAQDVVAGLAFAQRNNIRLSVKNTGHDFLGRSTGAGSLALWMHNLNGM
FT                   QVVNHTGPVYSGPALRLGAGVQGFEVYEFAARYGLRVTGPFNPTVGVVGGYVQGGGHGA
FT                   LQGAYGLAADNVLEYEVITTGGRHLVVSPSEYEDLFWALSGGGGGTYAVVLSATIKAYQ
FT                   DGVVAGASLSFSAGGNEADTDADAEMEAYWTAISAWHTQLLVHDKTPKLTTLFSFTNTS
FT                   FSLVAATLLDSPASALSAVLAPFVQTLDDLGLNYTYETNTQSSFYDHFALYTPALPYGI
FT                   TVTNSTVGGRLIPRQTVAEKLPELVSALRNITSHPNIRINGIAANITHTRVRNIRASNA
FT                   VLPAWRDALYTLNMDAYFEPGASTDIILRRQALTNANQDLLKQVTRDAGGGAYTNEATF
FT                   DNPDWKTDYFGTNYDTLLQVKEKYDPGHALYGAATVGSDYWSMQGDGRLCVAAGVFGTP
FT                   "
FT   gene            843443..845657
FT                   /locus_tag="ANIA_07152"
FT                   /old_locus_tag="AN7152.4"
FT                   /product="Alpha-galactosidase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFR9]"
FT   mRNA            join(843443..843549,843607..843905,844086..844875,
FT                   844931..845657)
FT                   /locus_tag="ANIA_07152"
FT                   /old_locus_tag="AN7152.4"
FT                   /note="transcript_id=CADANIAT00000305"
FT   CDS             join(843443..843549,843607..843905,844086..844875,
FT                   844931..845657)
FT                   /locus_tag="ANIA_07152"
FT                   /old_locus_tag="AN7152.4"
FT                   /product="Alpha-galactosidase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q1HFR9]"
FT                   /note="transcript_id=CADANIAT00000305"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000305"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000305"
FT                   /db_xref="GOA:Q5AX28"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AX28"
FT                   /protein_id="CBF78972.1"
FT                   /translation="MRALVPMVVAATALASPAPALKPRLDDGLARTPQMGWNTYNQYNC
FT                   FPNESIVHENAQALVDTGLADLGYRYVTIDCGWGVEDRLPNGTITWNPELFPQGFPAMG
FT                   QYLHDLGLLFGVYGDSGILLCGSPPNITGSLYDNCYSDAATNYPNVNYAPSTSPHPRFA
FT                   NMSRYIQAQDRDILFQVCEWGIDFPALWAPEIGHSWRIGNDIIPHWRSIFRTLNQAVPQ
FT                   TDFAGPGQWPDLDMLLVGLDGVLTVPEEQTHFSLWSILKSPLTIGAAIPGMRAESLEIL
FT                   SNADVIAFNQDALGVSAALRRRWSDEGYEVWSGPLEGGRTIAAVINWRDEDREITLDLP
FT                   DIGLQYAETLQNVWADETVNGVKTSYSSVVEAHGVMLVQLAETVEEGVYPADVFAATNR
FT                   DVTTFSDVYAITSSPNFVLNITLTEVTAAATNITIITDSSRRPISTSIPAGSSSISTSV
FT                   SLIAGSNNTITIRNAPPLSSITLSPPEPTYYTGAQDFTLTSPAGAYTCPDAYCLPAGSK
FT                   IVDLSTESAATAHINSSTSGSKYLEIDYINNEVAFDSSWGWGANSRNLTIKVNDNNPVR
FT                   LEVPLSGRHSELFGPGLGWWDSGRLGVLTDGWIKGTNELVLSNEGGEGGFTKYAPDVVG
FT                   IAVYD"
FT   gene            848291..851341
FT                   /locus_tag="ANIA_07151"
FT                   /old_locus_tag="AN7151.4"
FT                   /product="alpha-rhamnosidase (Eurofung)"
FT   mRNA            join(848291..849362,849422..850972,851247..851341)
FT                   /locus_tag="ANIA_07151"
FT                   /old_locus_tag="AN7151.4"
FT                   /note="transcript_id=CADANIAT00000306"
FT   CDS             join(848291..849362,849422..850972,851247..851341)
FT                   /locus_tag="ANIA_07151"
FT                   /old_locus_tag="AN7151.4"
FT                   /product="alpha-rhamnosidase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000306"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000306"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000306"
FT                   /db_xref="GOA:Q5AX29"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX29"
FT                   /protein_id="CBF78974.1"
FT                   /translation="MSLSISGVTFEHHRSALGIGEPSPRISWRFDGTVSNWTQSAYEIE
FT                   INRAGQANTFRVNSSDSVLVPWPSDPLQSGEEATVRVRSFGRANQPDAPWSDPVTVEPG
FT                   LLDEDDWQSAVAIVSDRETEVNATHRPIYFRKDFDVDEEILSARLYITALGVYEAEING
FT                   QPVGDHVLAPGWQAYSHRHEYNTYDVTDLLQTGDNTIGVTVGEGWYAGALTWSMTRNIY
FT                   GDTLGLLSLLSIATADGKTIYVPSDETWQSSTGPIIASEIYNGETYDSTQAIEGWSQPG
FT                   FDASGWLGTHEVTFDKSVLAAPDAPAVRRVEERRLESVFKSASGKTVLDFGQNLVGWLR
FT                   VRVKGPRGSTISFVHTEVMENGEVATRPLRNAKATDNLTLSGEEQEWEPSFTFHGFRYV
FT                   QVTGWPEETELNADSVTAIVINSDMEQTGFFSCSNPLLNKLHENIIWSMRGNFLSIPTD
FT                   CPQRDERLGWTGDIHAFARTANFIYDTSGFLRGWLRDAYSEQLENNCTAFLLPNPVISM
FT                   LTRADAPPYVIPNVLGPGSPTSIWGDAIVSVPWDLFQTYGDKAMLSEQYAGATAWLDKG
FT                   ILRNEAGLWNRSTFQYADWLDPLAPPDDPGAATTNKYLVSDAYLIHSTELVANISAYLD
FT                   RPDDAERYAADRADLTRAFQKAWISANGTVANETQTGLTLPLYFKLFERPEHYTDAVSR
FT                   LVDIIKENEYKVGTGFAGTHLLGHTLSAYNASSTFYNTLLQEDVPGWLFQVLMNGTTTW
FT                   ERWDSMLANGSVNPGEMTSFNHYAVGSVGAWMHENIGGLRPIEPGWRRFAVDVKVGGGL
FT                   SSAQERFLSPYGSAESSWEVRDGKFMLGVKVPPNSEAVVSLPGAPTRGKKEVIVGSGMH
FT                   RFEKLTAESRARLEEAKERPLLSSSNDCSLAIAL"
FT   gene            complement(851974..853793)
FT                   /locus_tag="ANIA_07150"
FT                   /old_locus_tag="AN7150.4"
FT                   /product="GABA transporter, putative (Eurofung)"
FT   mRNA            complement(851974..853793)
FT                   /locus_tag="ANIA_07150"
FT                   /old_locus_tag="AN7150.4"
FT                   /note="transcript_id=CADANIAT00000307"
FT   CDS             complement(851974..853572)
FT                   /locus_tag="ANIA_07150"
FT                   /old_locus_tag="AN7150.4"
FT                   /product="GABA transporter, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000307"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000307"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000307"
FT                   /db_xref="GOA:Q5AX30"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX30"
FT                   /protein_id="CBF78975.1"
FT                   /translation="MDKAHVKPPKGDTSVEEQDLAAMGHVQALSRKFNLWSMLALAFCV
FT                   LGTYSTFAQGLSSGLTNGASITILWGLVLVTVCNLCVAVSLGELTSSMPTALGQAYWVC
FT                   RLWDTPFGRFLSYMTAWINTFGWWTLTASQVAFMTEFLLGMKTMFDPDWDGADKGWLQF
FT                   VVYIAVVFVLTLTNVVSCRSEQVLPWLNNFVGVWFTALFVILSLALLISVGVRSDLSFQ
FT                   PASFVFGQWMNRTGWPDGVVWFTGLVQAAYGLTAFDAVIHMVEEMPSPRRNAPRVIWLA
FT                   VLLGAITGFIFMLICLFCIQEVNTVVDANLPFIELMQETVGLQGAAVLLALFIFNGLGQ
FT                   GISILTTASRLTWGFARDGGLPFSPYLAHIDTTWKAPVRALWMQGFLIALVGVLYLFAS
FT                   TVLDAILSVSTIALTVSYGIPIAALLYVGRDTLPPGPFRLGRWGALVNWISIVYCAVTT
FT                   VFFFFPGGPDPKPADMNYAIAVFGVMLVVAIGFWWVQGKKMYLRTEDAMAQMIFARRLE
FT                   GEGVGLSVGPADKNR"
FT   gene            855782..857329
FT                   /locus_tag="ANIA_07149"
FT                   /old_locus_tag="AN7149.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(855782..856017,856073..857128,857181..857329)
FT                   /locus_tag="ANIA_07149"
FT                   /old_locus_tag="AN7149.4"
FT                   /note="transcript_id=CADANIAT00000308"
FT   CDS             join(855906..856017,856073..857128,857181..857329)
FT                   /locus_tag="ANIA_07149"
FT                   /old_locus_tag="AN7149.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000308"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000308"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000308"
FT                   /db_xref="GOA:C8VD76"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD76"
FT                   /protein_id="CBF78977.1"
FT                   /translation="MADSEAGEKPSPKPAVGFWDPSLEPVRRQVFTKWARTVLLLCTFI
FT                   LCVLSLYWAVQFRSDDKLSNLKVWVVDFDNSQDGDALIGPAVTNLAAQLGTESQNLGYT
FT                   IKSAADFEDPVAVVQAVYDEHCWAAIIVNPDATNLLRGAVNGNTSYNPSDAAQFVIISA
FT                   RDETTVSSYITPSFNAFELQLRAQFGPEWVRNLTQQSTNLSSVAPQAINPAVAFSTLDL
FT                   RPFAPTAATPSVTIGLIYLIILSFFNFPFMMPVHALFMKGETTLKIPQWLIWRVCSSIC
FT                   TYFFLSLFYSFVSLAFQIPFSNDPAPDTVSANNPNAYGKGSFVVFWMLNWVGMGALGFP
FT                   LENMSMILGFPYSSLFLIFWVITNVSSGFYALDVAPGFFKWGYAWPLHRIVNALRTILF
FT                   GTHSKIGLDFGVLFAWIGVSLALFPVATFIMRWKMRRGL"
FT   gene            complement(857367..858451)
FT                   /locus_tag="ANIA_07148"
FT                   /old_locus_tag="AN7148.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(857367..858451)
FT                   /locus_tag="ANIA_07148"
FT                   /old_locus_tag="AN7148.4"
FT                   /note="transcript_id=CADANIAT00000309"
FT   CDS             complement(857842..858330)
FT                   /locus_tag="ANIA_07148"
FT                   /old_locus_tag="AN7148.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000309"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000309"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000309"
FT                   /db_xref="GOA:Q5AX32"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX32"
FT                   /protein_id="CBF78979.1"
FT                   /translation="MSATTSTSTSASTAATPTCTGNAWIIPVQDVACAVRSTSGNYSSI
FT                   MEKCCGVAEVEDYNDDCGFYCLAQGQSGQDLLDCIQSNGASYNDVFCGGNLTETATAAV
FT                   PSSTSGSDDDDDSDATATGDAAEPTNSDNAAPAQQVVNKAGLGILGMLFCSALLGVVA"
FT   gene            complement(859416..860941)
FT                   /locus_tag="ANIA_07147"
FT                   /old_locus_tag="AN7147.4"
FT                   /product="MFS tranporter, putative (AFU_orthologue;
FT                   AFUA_7G06830)"
FT   mRNA            complement(join(859416..860576,860630..860644,
FT                   860693..860941))
FT                   /locus_tag="ANIA_07147"
FT                   /old_locus_tag="AN7147.4"
FT                   /note="transcript_id=CADANIAT00000310"
FT   CDS             complement(join(859416..860576,860630..860644,
FT                   860693..860941))
FT                   /locus_tag="ANIA_07147"
FT                   /old_locus_tag="AN7147.4"
FT                   /product="MFS tranporter, putative (AFU_orthologue;
FT                   AFUA_7G06830)"
FT                   /note="transcript_id=CADANIAT00000310"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000310"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000310"
FT                   /db_xref="GOA:Q5AX33"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX33"
FT                   /protein_id="CBF78981.1"
FT                   /translation="MAASAEIQPQPQPQPLSQLHPPHDARDAEKAVPSQPDLRGSDSNI
FT                   FGHDRQVERWNYPRSNVVKTVATFWAFLVMGANDAAYGPLLPYLEEYYNLSYTTVSLVF
FT                   LSPIGGYTLAAVTNNTLHRHLGQRGIAWLSPGCHLLAYIVNCVHPPYPVLVVSFIFAGL
FT                   GNGLADSAWNAWLGNMADSNQILGLLHGLYGLGAVMAPLVATSLITEAGVGWFYFYYIM
FT                   VSNAIRMSIDERTDGYCQVACAAIELASCLWAFWDSDAAAFRAETERSQSVETSDEQGG
FT                   VRRALFVPKYARVTWLLSFFLLGYVGAEVAIGGWVVTFLMRVRDGAEFASGMGSTGYWL
FT                   GITVGRVVLGFVTPRIGEKFGIAIYLVISIAFALVFYLVPNFYASIIAVSFQGFWLGPM
FT                   FPGAVVVATRLLPRALHVSAIGFAAAFGASGAAVLPFAVGAVAQAKGVEVLPPFAIALS
FT                   GGILLLWCALPRMGKR"
FT   gene            complement(861225..862840)
FT                   /locus_tag="ANIA_07146"
FT                   /old_locus_tag="AN7146.4"
FT                   /product="sterol 24-c-methyltransferase, putative
FT                   (AFU_orthologue; AFUA_4G03630)"
FT   mRNA            complement(join(861225..862300,862355..862389,
FT                   862449..862840))
FT                   /locus_tag="ANIA_07146"
FT                   /old_locus_tag="AN7146.4"
FT                   /note="transcript_id=CADANIAT00000311"
FT   CDS             complement(join(861406..862300,862355..862389,
FT                   862449..862652))
FT                   /locus_tag="ANIA_07146"
FT                   /old_locus_tag="AN7146.4"
FT                   /product="sterol 24-c-methyltransferase, putative
FT                   (AFU_orthologue; AFUA_4G03630)"
FT                   /note="transcript_id=CADANIAT00000311"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000311"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000311"
FT                   /db_xref="GOA:Q5AX34"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013705"
FT                   /db_xref="InterPro:IPR025810"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX34"
FT                   /protein_id="CBF78983.1"
FT                   /translation="MAPTALEKENHQRDAEFNAAMHGNSAQAKGGFAAMRQKSAAAQKA
FT                   AVDEYFKHWDNKSAETETEEIREARRAEYATLTRHYYNLATDLYEYGWGTSFHFCRFAY
FT                   GEPFYQAIARHEHYLAHQMGIKPGMKVLDVGCGVGGPAREIVKFTDAHVTGLNNNDYQI
FT                   QRATRYAEREGLSHKLNFVKGDFMQMQFPDNSFDAVYAIEATVHAPELAGVYKEIMRVL
FT                   KPGGVFGVYEWLMTDAYDNDNPEHRKIRLGIEQGDGISNMVKVSEGLAAIKEAGLELLH
FT                   HEDLADRPDEIPWYYPLAGSFKHMTSPWDFFTIARMTWWGRGLVHRFVGAMETIKLIPQ
FT                   GTQKTADSLALAADCLVAGGEKKLFTPMYLMVARKPE"
FT   gene            863347..864581
FT                   /locus_tag="ANIA_07145"
FT                   /old_locus_tag="AN7145.4"
FT                   /product="Pre-mRNA-splicing factor slt11
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AX35]"
FT   mRNA            863347..864581
FT                   /locus_tag="ANIA_07145"
FT                   /old_locus_tag="AN7145.4"
FT                   /note="transcript_id=CADANIAT00000312"
FT   CDS             863378..864511
FT                   /locus_tag="ANIA_07145"
FT                   /old_locus_tag="AN7145.4"
FT                   /product="Pre-mRNA-splicing factor slt11
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AX35]"
FT                   /note="transcript_id=CADANIAT00000312"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000312"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000312"
FT                   /db_xref="GOA:Q5AX35"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AX35"
FT                   /protein_id="CBF78985.1"
FT                   /translation="MPPQIKQDLNRSGWETTDFPSVCENCLPENPYVQMLKEDYGAECK
FT                   ICTRPFTIFRWKADRTARTKRTNICLTCARLKNCCQCCMLDLSFGLPIVVRDAALKMVA
FT                   PGPQSSINREYYAQGHEKEIEEGRGAVEEYEKTDEKARELLRRLANSEPYYRKPRQLEA
FT                   PEEDGETQGPSDATVVRSRYGNGPGPVRTSESRRGTPLPGRGRGGVRGGRPFPGTAQLP
FT                   PSQADILPPADPNITSLFVTGVEDDLPEHALRSFFVQFGQLRSLVCSHRAHCAFINYAA
FT                   RESAEAAAKHCQGKAVVQGCPLRVRWGKPKALDNMDREERLKYAREGRQAVGSLGNADQ
FT                   GTKAITAGTEKEQIPRQVAVAPPPGSGEVQYSSMSGD"
FT   gene            complement(865069..865601)
FT                   /locus_tag="ANIA_07144"
FT                   /old_locus_tag="AN7144.4"
FT                   /product="mitochondrial complex I protein Fmp36, putative
FT                   (AFU_orthologue; AFUA_4G03645)"
FT   mRNA            complement(join(865069..865211,865291..865467,
FT                   865526..865601))
FT                   /locus_tag="ANIA_07144"
FT                   /old_locus_tag="AN7144.4"
FT                   /note="transcript_id=CADANIAT00000313"
FT   CDS             complement(join(865117..865211,865291..865467,
FT                   865526..865601))
FT                   /locus_tag="ANIA_07144"
FT                   /old_locus_tag="AN7144.4"
FT                   /product="mitochondrial complex I protein Fmp36, putative
FT                   (AFU_orthologue; AFUA_4G03645)"
FT                   /note="transcript_id=CADANIAT00000313"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000313"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000313"
FT                   /db_xref="GOA:Q5AX36"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AX36"
FT                   /protein_id="CBF78986.1"
FT                   /translation="MASQPAVSALSAYRQVLRATRIAFQNDTRVLLAARQEARQNFEKH
FT                   RRYGVDTPMQINHALEVASILRHNIVQGARDAEDENAKWELRIHDEIERGDNDSIKVAG
FT                   KKVKVDKPCSS"
FT   gene            865847..867375
FT                   /locus_tag="ANIA_07143"
FT                   /old_locus_tag="AN7143.4"
FT                   /product="ribosome associated DnaJ chaperone Zuotin,
FT                   putative (AFU_orthologue; AFUA_4G03650)"
FT   mRNA            join(865847..866050,866126..866266,866326..867375)
FT                   /locus_tag="ANIA_07143"
FT                   /old_locus_tag="AN7143.4"
FT                   /note="transcript_id=CADANIAT00000314"
FT   CDS             join(865898..866050,866126..866266,866326..867375)
FT                   /locus_tag="ANIA_07143"
FT                   /old_locus_tag="AN7143.4"
FT                   /product="ribosome associated DnaJ chaperone Zuotin,
FT                   putative (AFU_orthologue; AFUA_4G03650)"
FT                   /note="transcript_id=CADANIAT00000314"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000314"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000314"
FT                   /db_xref="GOA:Q5AX37"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX37"
FT                   /protein_id="CBF78988.1"
FT                   /translation="MSSAQVVELTLPALPAGWSADKEFKAVGKLSAATQRNLEPVGPHF
FT                   LAHARRKRHHRTFSEDERIQAQQNVKKTEEEEDDEISEDEDPMMLQRDAKDWKSQDHYA
FT                   VLGLSKYRWRATPDQIKRAHRKKVLRHHPDKKAALGDRDENDSFFKCIQKATEILSDPV
FT                   KRRQFDSVDEAADVEPPSKKETQKGNFYKLWRPVFESEARFSKIQPVPQLGDENSTFEE
FT                   VNEFYNFWYNFDSWRTFEYLDEDVPDDNENRDQKRHVEKKNANARRKRKTEDTARLRRL
FT                   VDDCAALDERIKKFRKAARADKDKKRLEKEAEAKRIAEEKEKARLEEEQRKKEAEEAAK
FT                   ADREKAKKAKEAAKNAAKKNKRVLKGSVKDVNYFAESGEPSAAQVDSVLTDVDLINSKI
FT                   DNEELASLAERLTAAGKDAAAVKNVYTEEIKRLVAAGKAKEGEVKFFV"
FT   gene            868079..869426
FT                   /locus_tag="ANIA_07142"
FT                   /old_locus_tag="AN7142.4"
FT                   /product="acid phosphatase, putative (AFU_orthologue;
FT                   AFUA_4G03660)"
FT   mRNA            join(868079..868267,868326..869426)
FT                   /locus_tag="ANIA_07142"
FT                   /old_locus_tag="AN7142.4"
FT                   /note="transcript_id=CADANIAT00000315"
FT   CDS             join(868079..868267,868326..869426)
FT                   /locus_tag="ANIA_07142"
FT                   /old_locus_tag="AN7142.4"
FT                   /product="acid phosphatase, putative (AFU_orthologue;
FT                   AFUA_4G03660)"
FT                   /note="transcript_id=CADANIAT00000315"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000315"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000315"
FT                   /db_xref="GOA:Q5AX38"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX38"
FT                   /protein_id="CBF78989.1"
FT                   /translation="MYTKTLTVLLGGLSLALAQTSSEQTPSAPEIAAARATVMPYSPVS
FT                   NVQGKSFQRFVNIWLENTDYDVAASEKHLARLAKKGLTLTNFWAVTHPSEPNYCASQGG
FT                   DTFGMDNDDFNQIPANISTIADMFDTKNISWGEYQEHMPYPGYQGFRYPTSGDNDYVRK
FT                   HNPAILYDSITEDPTRLRQIKNFTSFYEDLKTHRLPQYSFITPNMTNDGHDTDISFSGR
FT                   WTWEFLIDLLDNEYFTNDTLILLTFDENDTYELGNKIFSFLLGGAVPKDLIGKEDDTFY
FT                   THYSIISSLSANFGLPSLGRWDCGANLLSFLAEKVGYTNYEVDTSNLYLNVSYNGPMAA
FT                   GEYSQKTYEWPIPATEGQCSGGYGILDVVRKTYAGLTATHDYTSPVPFDVKTGNSVGIE
FT                   YSRTLKGGRHERYVTGFGKTNETSGARKSS"
FT   gene            complement(869512..871065)
FT                   /locus_tag="ANIA_07141"
FT                   /old_locus_tag="AN7141.4"
FT                   /product="aldehyde dehydrogenase (NAD) family protein
FT                   (Eurofung)"
FT   mRNA            complement(join(869512..869637,869689..870100,
FT                   870145..870617,870664..871065))
FT                   /locus_tag="ANIA_07141"
FT                   /old_locus_tag="AN7141.4"
FT                   /note="transcript_id=CADANIAT00000316"
FT   CDS             complement(join(869524..869637,869689..870100,
FT                   870145..870617,870664..871065))
FT                   /locus_tag="ANIA_07141"
FT                   /old_locus_tag="AN7141.4"
FT                   /product="aldehyde dehydrogenase (NAD) family protein
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000316"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000316"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000316"
FT                   /db_xref="GOA:C8VD84"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD84"
FT                   /protein_id="CBF78991.1"
FT                   /translation="MSNQVRTLSPSTGKVLFEHPGVTVEQVRQIAQASEDAFRTYRELS
FT                   LDQRKAIVVKALEIIDANKETLAHELTTQMGRPISYTAGEVDTMRKRANYLIDQAEDAL
FT                   KTIPGQEENGFKRFVKKAPVGPVLLATAWNYPYLITINALVPALLAGNTVILRPSPQTP
FT                   LVGDRLSEYFEKAGLPKNVLQVVHLGSWDVLDEVVKIPQIKLVSFVGSTQGGLRLRQAT
FT                   AGRILPLNLELGGNDPAYVRADADLAYTAAQVVDGAVFNSGQSCCSIERIYVHADVHDA
FT                   FVAEVRKELATYKLGDPLDKATTTGPVISHQAVKNIQAHIDDALSRGAVDSTPENPTFA
FT                   KIPSEGSFIAPRVLTNVSHDMRVMREETFGPVVPIMKVQSDDEAVALMNDSDYGLTASV
FT                   WTKDIKAGEDLIERIEAGTVFINRCDYPSPDLAWIGWKSSGLGCSLGPQAFDAFYKLKS
FT                   FHIRTTHG"
FT   gene            871932..873274
FT                   /locus_tag="ANIA_07140"
FT                   /old_locus_tag="AN7140.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(871932..872090,872139..872255,872306..873274)
FT                   /locus_tag="ANIA_07140"
FT                   /old_locus_tag="AN7140.4"
FT                   /note="transcript_id=CADANIAT00000317"
FT   CDS             join(871932..872090,872139..872255,872306..873274)
FT                   /locus_tag="ANIA_07140"
FT                   /old_locus_tag="AN7140.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000317"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000317"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000317"
FT                   /db_xref="GOA:Q5AX40"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX40"
FT                   /protein_id="CBF78993.1"
FT                   /translation="MDAYDSYIGKPVTELPTPALVLSKPTIERNIKQLLQDVERLGIAF
FT                   RPHVKTLKSLEVTRMMLGNGQHRRIVASTLPEIEGAIPLAKEGVLDECLYSMPIYPTVL
FT                   PRLLKFSKSLKILLMIDNEQHIDVLEKFSGSTAPWPVFIKIDVGTRRAGILNSSSALPN
FT                   LVKRVEESSAVELYGFYCHAGHSYACRTEESAVAVLKDEVEGVVSASKLLGTGRKVVVS
FT                   VGSTPTAHVVRELREVLPEGLELELHAGMSAPAQFLRLETSTESSKGNYPCNDLQQVST
FT                   GLVPHTAQSVRVLAEVCSVYPERNEALINAGTIALTKETSEFPGYGRVTERPQWAVLRT
FT                   SQEHGILGLSPAPALSLLGVNEVKDEKAVDSFKVGDKVLLYCQHACITAAAYPTYYVVD
FT                   EQDVVREAWVPWKGW"
FT   gene            complement(873277..875069)
FT                   /locus_tag="ANIA_07139"
FT                   /old_locus_tag="AN7139.4"
FT                   /product="dienelactone hydrolase (AFU_orthologue;
FT                   AFUA_4G03730)"
FT   mRNA            complement(join(873277..874254,874309..874746,
FT                   874794..875069))
FT                   /locus_tag="ANIA_07139"
FT                   /old_locus_tag="AN7139.4"
FT                   /note="transcript_id=CADANIAT00000318"
FT   CDS             complement(join(873431..874254,874309..874746,
FT                   874794..875031))
FT                   /locus_tag="ANIA_07139"
FT                   /old_locus_tag="AN7139.4"
FT                   /product="dienelactone hydrolase (AFU_orthologue;
FT                   AFUA_4G03730)"
FT                   /note="transcript_id=CADANIAT00000318"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000318"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000318"
FT                   /db_xref="GOA:C8VD86"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD86"
FT                   /protein_id="CBF78995.1"
FT                   /translation="MASLTINAPGGGFLYSNSRNARLIITAETPDFDTEFVQAWSKEGF
FT                   NTIYIPYHEDEKEYIRRLMAVKEGLSVGDNYGVIAFGDAAAFCLDYYLKPNNVSRLCAL
FT                   ICYYPTSIPDIRSRYPPSVQILTHLAGDTIDVVTTPTLLGLQGKKKRSTRRINPGIGTG
FT                   ELLDIGHRAYTYSDAQPGFAEVDLDEYHRLDADLAFTRTLEVLRKAYGREGDLEQPWEE
FT                   HLQGKFFSMNLSDTMSHYTKNLTPTATYVPTLSGATGSRALRRFYDQYFLHKLPPSMHL
FT                   RLISRTVGADRVVDELYVSFEHTQEIPWMLPGVPPTNRKVEIVLVSIVSMRAKQLYSEH
FT                   IYWDQASVLVQVGLLDPKLVPKETQEKGVDRLPVIGREAARRILDEDPEVEEPEFHNRL
FT                   IRRSRQRRESGRVAESSVPQSPIVQSEAEGSGPKKGKRAGPQNGEQNGEKSGIQAGDDG
FT                   EGLKDGQEDGDAHNSHVEERDGAENKKDQEKDKNELNSESN"
FT   gene            875724..877637
FT                   /locus_tag="ANIA_07138"
FT                   /old_locus_tag="AN7138.4"
FT                   /product="hypothetical amino acid transporter (Eurofung)"
FT   mRNA            join(875724..875931,875989..876151,876206..877261,
FT                   877319..877637)
FT                   /locus_tag="ANIA_07138"
FT                   /old_locus_tag="AN7138.4"
FT                   /note="transcript_id=CADANIAT00000319"
FT   CDS             join(875724..875931,875989..876151,876206..877261,
FT                   877319..877625)
FT                   /locus_tag="ANIA_07138"
FT                   /old_locus_tag="AN7138.4"
FT                   /product="hypothetical amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000319"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000319"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000319"
FT                   /db_xref="GOA:Q5AX42"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX42"
FT                   /protein_id="CBF78997.1"
FT                   /translation="MSLVQHVSSLEGVDAVPGSQDERESTNGTYNTSRSIKRKISYDFF
FT                   PQSVSAIEDITTTAPYKVSTAKRLAQVFATILACWLGSGIIFGYAALKPVLIAQGVYRD
FT                   LCPADELEGEFDTCYDQELRLNLFFTVGSITTNVCSLPVGSMLDRYGSRVCGFASCFFL
FT                   AAGSLLMSFSFSSQFDGFIVANFLLALGGTFLFVPSFQIANAFPKHTGTIVALVTGAFD
FT                   ASAAVYLFYRLVFEASNGTFTPDKFFLAYTIVPALILITWIVLMPARDYQTTHQLEVRI
FT                   EKAEDATGDVHDSDDEIDSLTELHRVRSERAERRRLKIQELDQVLGDEEERKHREQQEE
FT                   ERQQTSAVWGVLHGLPAHKQMATPWFILITIMTVLQMLRMNYFIATIRNQYEYMLDEEK
FT                   GIEINNFFDVALPVGGVLSTPFIGLLLDHLSVPCTLALIVFLTTLIGALNSIPTLWTGY
FT                   FTVILFVLLRPLYYSAMSDYATKVFGFATFGRVYGTIVCLSGLINFSQTGLDALTNGPF
FT                   DGNPIPINIILAGAGFIVGSILVAFVATAGHRLRKQREEAEDGERQRLIPVREESPLSY
FT                   T"
FT   gene            878696..880481
FT                   /locus_tag="ANIA_07137"
FT                   /old_locus_tag="AN7137.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(878696..878928,878982..879002,879427..879440,
FT                   879484..879847,879896..880481)
FT                   /locus_tag="ANIA_07137"
FT                   /old_locus_tag="AN7137.4"
FT                   /note="transcript_id=CADANIAT00000320"
FT   CDS             join(878696..878928,878982..879002,879427..879440,
FT                   879484..879847,879896..880481)
FT                   /locus_tag="ANIA_07137"
FT                   /old_locus_tag="AN7137.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000320"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000320"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000320"
FT                   /db_xref="GOA:Q5AX43"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX43"
FT                   /protein_id="CBF78998.1"
FT                   /translation="MSVSNTLGRDEKYSPTVEKVEDAGHAALNNIDYDEEFSPEEQKRI
FT                   IRRIDLRLVTITGLAYCVSLMDRTNLSMAAVAGMVVDLELWYARYDVQKRFSIFYLIGC
FT                   VASALAGILAFGLMQLDGSQGLAGWRWIFILEGVITGAIGVLAIIFLVDFPDRAHKSWK
FT                   FLSERECAFVVRRINRDRSDGDAEPFSLKRFLKPALDLKIWGFAVIFFCVTTVSYAIAY
FT                   FLPIILSEGMGFDTGTSQCLVAPPYAAAGFVMYGTSWVGDKYRMRGPVLIFNALLCIIG
FT                   LPMMGFASSNAVQYVGVFFTVAGSNSNIPAVMAYQANNVRGQWTRALSSATLVGFGGIG
FT                   GIAGSLVFREQDKPHYRPGIWCAIACNLLLMLIVVVQSIWFRIANKRAERGEKLIEGVP
FT                   GFRYTI"
FT   gene            880823..884239
FT                   /locus_tag="ANIA_10901"
FT                   /old_locus_tag="AN10901.4"
FT                   /product="hypothetical glycine cleavage system P protein
FT                   (Eurofung)"
FT   mRNA            join(880823..884057,884110..884239)
FT                   /locus_tag="ANIA_10901"
FT                   /old_locus_tag="AN10901.4"
FT                   /note="transcript_id=CADANIAT00000321"
FT   CDS             join(880937..884057,884110..884165)
FT                   /locus_tag="ANIA_10901"
FT                   /old_locus_tag="AN10901.4"
FT                   /product="hypothetical glycine cleavage system P protein
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000321"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000321"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000321"
FT                   /db_xref="GOA:C8VD89"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD89"
FT                   /protein_id="CBF79000.1"
FT                   /translation="MAASLCLRGSRQLALRSQLRSIHPSITRSRLLPTYRAVHSSSQQS
FT                   HSARRPIYTSSVADHGVPHPRDVFQPVDTFPRRHIGPSPEAAEEMLAVLDPPVKSLDEF
FT                   VKQVLPADILSKKDLAVTAPSADNGLPRSSVHGGLGETDMLKLLDKYREQIDVSGKTYI
FT                   GAGYYPTIVPPVILRNILENPAWYTSYTPYQPEISQGRLESLLNFQTLTADLTGLPFAN
FT                   ASVLDEATAAAEAMTMSLATQPLAKQKKAGKTYVVSHLCHPQTVAVMRSRAEGFGINLV
FT                   IGDILADDFKIVKDQGDNLIGVLAQYPDTEGGIYDFQGLSDAIHTAGGTFSVATDLLAL
FT                   TVLKAPGEFGADIAFGNAQRFGVPMGYGGPHAAFFACADKYKRKVPGRVVGVSKDRLGN
FT                   RALRLALQTREQHIRREKATSNICTAQALLANMSAMYAVYHGPSGLKTIAQRIMSMTAA
FT                   LRERLAALGYNVPAKSNVSDGAAVFDTITIEFSNSEEADAIIAAARQNSIFLRRVSATK
FT                   VGISLDETAGREELKAILQVFSAHAKAEAALDQELGLASIPASLERTSAYLTHPVFNTH
FT                   HSETEMLRYIRHLESKDLSLAHSMIPLGSCTMKLNATTEMIPVSWPEFSQMHPFLPADV
FT                   AKGYTQMIDDLEQQLADITGMAEVTVQPNSGAQGEFAGLRVIKKYQEATGSSKRNICLI
FT                   PVSAHGTNPASAAMAGMKVVTIKCDTKTGNLDLDDLKAKCEKHKDELAAIMITYPSTFG
FT                   VYEPGVKKACDLVHQYGGQVYMDGANMNAQIGLCSPGEIGADVCHLNLHKTFCIPHGGG
FT                   GPGVGPIGVAEHLRPYLPSHPNSEYLQSKRTEKSSPPISAAPWGSASILPITFNYINMM
FT                   GSKGLTHATKITLLNANYILSRLKDHYPILYTNDNGRCAHEFILDVRKFKDTCGIEAID
FT                   IAKRLQDYGFHAPTMSWPVANTLMIEPTESENKAELDRFCDALISIRKEIAAVESGEQP
FT                   RDGNVLRMAPHTQRDLLATEWDRPYTREQAAYPLPYLLEKKFWPSVTRVDDAHGDQNLF
FT                   CTCPPVEDSE"
FT   gene            884685..886538
FT                   /locus_tag="ANIA_10903"
FT                   /old_locus_tag="AN10903.4"
FT                   /product="chlorohydrolase family protein (AFU_orthologue;
FT                   AFUA_4G03770)"
FT   mRNA            join(884685..884940,884999..886538)
FT                   /locus_tag="ANIA_10903"
FT                   /old_locus_tag="AN10903.4"
FT                   /note="transcript_id=CADANIAT00000322"
FT   CDS             join(884685..884940,884999..886359)
FT                   /locus_tag="ANIA_10903"
FT                   /old_locus_tag="AN10903.4"
FT                   /product="chlorohydrolase family protein (AFU_orthologue;
FT                   AFUA_4G03770)"
FT                   /note="transcript_id=CADANIAT00000322"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000322"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000322"
FT                   /db_xref="GOA:C8VD90"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD90"
FT                   /protein_id="CBF79002.1"
FT                   /translation="MESKITLFYGTFVDLPRTRSGEKHELAIRHGAIWVSSATGRIQGF
FT                   DWSIANEAELQSLLRKKGWTGVPIIRALEQENEFFFPGFIDTHIHAPQYPNSGLFGSST
FT                   LLDWLETYTFPLESSMSNLDKARTAYNAVISRTLANGTTCASYYATIHVPATNLLASLC
FT                   HTRGQRALIGRVCMDNPAFCPDYYRDESAEASIELTKETIAHIHSLPDSDKESERLVKP
FT                   IITPRFAPTCSTSALTSLGQLAASHTPPLHIQTHISENPNEVSLVQSLFPEHPSYAAVY
FT                   DACSLLTHRTILAHAVHLTQPEKELIASRNAKISHCPASNSALGSGLAPVRDLIDNGIT
FT                   VGLGTDVSGGYSPSILEAVRQACLVSRLLRHSTASTSSSGNSTQNETEGREVLSVEEAL
FT                   YLATRGGAAVIDMPNELGGFEVGMFWDVQLIRLGATVQETPQTGSHSDSRSVVDIFGWE
FT                   SWAEKVHKWVWTGNDRNVRRVWVGGAVVHDLDDGSCVGEETMLGSWFGKSLQRDWTRWA
FT                   VASVGVAILGFAIGRRSLGSR"
FT   gene            complement(886773..888910)
FT                   /locus_tag="ANIA_07135"
FT                   /old_locus_tag="AN7135.4"
FT                   /product="RHGB_ASPAC Rhamnogalacturonase B
FT                   (Rhamnogalacturonan lyase) (RGase B) (RHG B)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5AX45]"
FT   mRNA            complement(join(886773..886802,886876..886932,
FT                   886993..887133,887207..887450,887519..887740,
FT                   887795..888006,888054..888105,888150..888225,
FT                   888271..888462,888506..888607,888655..888910))
FT                   /locus_tag="ANIA_07135"
FT                   /old_locus_tag="AN7135.4"
FT                   /note="transcript_id=CADANIAT00000323"
FT   CDS             complement(join(886773..886802,886876..886932,
FT                   886993..887133,887207..887450,887519..887740,
FT                   887795..888006,888054..888105,888150..888225,
FT                   888271..888462,888506..888607,888655..888910))
FT                   /locus_tag="ANIA_07135"
FT                   /old_locus_tag="AN7135.4"
FT                   /product="RHGB_ASPAC Rhamnogalacturonase B
FT                   (Rhamnogalacturonan lyase) (RGase B) (RHG B)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5AX45]"
FT                   /note="transcript_id=CADANIAT00000323"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000323"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000323"
FT                   /db_xref="GOA:Q5AX45"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR015364"
FT                   /db_xref="InterPro:IPR016590"
FT                   /db_xref="InterPro:IPR029411"
FT                   /db_xref="InterPro:IPR029413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AX45"
FT                   /protein_id="CBF79004.1"
FT                   /translation="MLSKTFLLSSAVLWARVANAAFGITDNGSSYTIDANSPNPLKFTV
FT                   NKSSCDITSIVYYGSEFQYSGKGSHIGSGLGSATVSATQSGDYIKVTCDTSSLTHYFVV
FT                   HNGDPIIHMATYITAEPDIGELRFIARLNSNLLPNEEPFGDVSTTSGGSAIEGSDVFLV
FT                   NGETRSKFYSSERFIDDHRHCISGSAHRVCMILNQYESSSGGPFFRDINSNNGGDYNAL
FT                   YWYMNSGHVQTESFRTGLHGPYSMYFSRSGTPSTNIDTSFFASLGIKGYVAANGRGTVT
FT                   GKASGADSSMDWVVHWYNNDAQYWTYTASDGSFTSPAMKPGTYTMKYYQGEFPVAETTV
FT                   TVSAGSSTTKNISGSVKTGTTIFKIGEWDGQPTGFRNADKQLRMHPSDSRMDSWSSTYT
FT                   VGSSSLSDFPMAVFKSVNNPVTIKFTATSAQTGAATLRIGTTLSFAGGRPQATINSYTG
FT                   PAPSAPTNLNSRGVTRGAYRGLGEVYDVSVPAGTIVTGENTITISVISGSSGDAFLSPN
FT                   VVFDCIELFQ"
FT   gene            890892..892717
FT                   /locus_tag="ANIA_10900"
FT                   /old_locus_tag="AN10900.4"
FT                   /product="serine peptidase, family S28, putative
FT                   (AFU_orthologue; AFUA_4G03790)"
FT   mRNA            join(890892..892519,892672..892717)
FT                   /locus_tag="ANIA_10900"
FT                   /old_locus_tag="AN10900.4"
FT                   /note="transcript_id=CADANIAT00000324"
FT   CDS             join(890892..892519,892672..892717)
FT                   /locus_tag="ANIA_10900"
FT                   /old_locus_tag="AN10900.4"
FT                   /product="serine peptidase, family S28, putative
FT                   (AFU_orthologue; AFUA_4G03790)"
FT                   /note="transcript_id=CADANIAT00000324"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000324"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000324"
FT                   /db_xref="GOA:C8VD92"
FT                   /db_xref="InterPro:IPR008758"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD92"
FT                   /protein_id="CBF79006.1"
FT                   /translation="MRFNPLISTAFVASLASFASGLGLRSDLAKSLQLAAELGLDSDLL
FT                   LKDSQSFRTAVTQTNPPAEYVLVDSRFLMTMCTGSNALQLPIDHHNPAIGTFRNRYWVN
FT                   DAYYVPGGPVVLYDVGEADGEPSVAHLRSNSSFLPPILQEFGAIGIVWEHRSVVSTKVE
FT                   TRIEIDRNRYYGDSLPYPVNNNTLPEHLIYLTTRQALADIPAFAENFTRPGLQEYDLTP
FT                   ASTPWVMIGGSYPGARAAFARNEYPDTIFASFAASAPVQAQINMSIYYEQVYRSMVANG
FT                   FRSCASNIHAALEYIDNQLSQNDTAASIKQLFFGPGAEKNSNEDFTHALAVIYGSFQAY
FT                   GMDGPAGSLGEFCRYLESDPVTGQPAETEGLALRHGYKHLAERWAEWPIFTQLINVNYE
FT                   TNCKGLDKSVAPSCELNKPTTNPTAIAWTWQYCTEWGFYQSNNEGVHSLLSRYQTLEFQ
FT                   QVMCNRQFPEAVKNGLLPPQPRVDALNAEFGGWNIRPSNVYFSAGEFDPWRTLTLLSGE
FT                   QFSLQLNVTSDVPRCGVRTGPDTVFGWAPCGRMSSQHSIL"
FT   gene            893241..896735
FT                   /locus_tag="ANIA_10904"
FT                   /old_locus_tag="AN10904.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(893241..893288,893443..893481,893566..893801,
FT                   893861..893954,894659..894751,894818..894998,
FT                   895059..895235,895426..895503,895552..895601,
FT                   895651..895754,895809..895930,895979..896162,
FT                   896209..896558,896707..896735)
FT                   /locus_tag="ANIA_10904"
FT                   /old_locus_tag="AN10904.4"
FT                   /note="transcript_id=CADANIAT00000325"
FT   CDS             join(893241..893288,893443..893481,893566..893801,
FT                   893861..893954,894659..894751,894818..894998,
FT                   895059..895235,895426..895503,895552..895601,
FT                   895651..895754,895809..895930,895979..896162,
FT                   896209..896558,896707..896735)
FT                   /locus_tag="ANIA_10904"
FT                   /old_locus_tag="AN10904.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000325"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000325"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000325"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD93"
FT                   /protein_id="CBF79007.1"
FT                   /translation="MSTTPQIPGAIDVPEQNGYTYIVPLDPNRTQYHARQLERYDAQSP
FT                   YIRGRVTRIQYQCSGVRICSYLHPNLRNMHHYKVTEDDWNYIRQERQLIEETEMDPKKQ
FT                   KAISHFFGVLRVFKRHQACRPQQVGCAPKMVLGEAALIYREKLAFYPDGQDLNALQLEC
FT                   DRNEYLKHYVREIYHEGDITIIICILQDQAKLFQSLRSFEVDMSFKRVREGRFNEVIFA
FT                   VFLEDHGKVITLLRAFMNQQTGRAYYFLFKKVFEMIHDLSGHPVQFFHLHGTGIETIVV
FT                   DMDEGQRDVLFKAMISLLHAPTRAQYMDILEQLLEDPTPGVATWAEHKLHPHFNQTRMH
FT                   TNAGEQTHQKSYAFSGKHLPILKAVTSAYFLDVRDMHQYSVRIHYNITHSYRPDDEISR
FT                   ITENLIRDQRKRRRNQEIEEEENIEGVLPRRARPSRSFSSSGSPRPRRSRSSTRGRSYT
FT                   RGVSRSSTPQRSPSLAQIASQNYRDQQASHEQHILDLRERQARLDRYEVETRLMQQRLL
FT                   QPTSPQLVGVNPVQYPPLPGYLPSSSQLVNPGPVYVPQMTGALPYVPSQAPFVPSTETS
FT                   HQLVYQDSQARSFSTVSC"
FT   gene            complement(897099..898764)
FT                   /locus_tag="ANIA_07133"
FT                   /old_locus_tag="AN7133.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(897099..897151,897205..897264,
FT                   897318..897398,897449..897487,897642..897708,
FT                   897772..897859,898001..898012,898063..898107,
FT                   898164..898205,898252..898343,898543..898614,
FT                   898663..898764))
FT                   /locus_tag="ANIA_07133"
FT                   /old_locus_tag="AN7133.4"
FT                   /note="transcript_id=CADANIAT00000326"
FT   CDS             complement(join(897099..897151,897205..897264,
FT                   897318..897398,897449..897487,897642..897708,
FT                   897772..897859,898001..898012,898063..898107,
FT                   898164..898205,898252..898343,898543..898614,
FT                   898663..898764))
FT                   /locus_tag="ANIA_07133"
FT                   /old_locus_tag="AN7133.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000326"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000326"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000326"
FT                   /db_xref="GOA:Q5AX47"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX47"
FT                   /protein_id="CBF79009.1"
FT                   /translation="MPSIRDNDLRKSPEYCHYLEAVKDGELTLPDFKIDDNGVPDIHPY
FT                   EVYCRVKGCLKRTSLTSQVAWYEGLFEGTVLPTPTPTKKRKRAATKSKDHNTKGVENSN
FT                   EGEAGNDQDNGEGPSSGPSAVRVARQLNQLVRKEPYPARPVATQRAKPYCEFWRFFSSI
FT                   DEAKGASMQPHMDNAKETSNEESVLNKENEHENEEEKAAEPEEVQGDGRHVSEHLAITP
FT                   FAQLNSGEDNSIATNLDLRDFGLNLESI"
FT   gap             899140..899463
FT                   /estimated_length=324
FT   misc_feature    899464..913185
FT                   /note="contig 1.121 1..13722(-1)"
FT   gene            complement(899521..902287)
FT                   /locus_tag="ANIA_07132"
FT                   /old_locus_tag="AN7132.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(899521..899549,899598..899719,
FT                   899774..899877,899926..899975,900024..900101,
FT                   900292..900468,900529..900709,900776..900868,
FT                   901574..901667,901727..901962,902047..902085,
FT                   902240..902287))
FT                   /locus_tag="ANIA_07132"
FT                   /old_locus_tag="AN7132.4"
FT                   /note="transcript_id=CADANIAT00000327"
FT   CDS             complement(join(899521..899549,899598..899719,
FT                   899774..899877,899926..899975,900024..900101,
FT                   900292..900468,900529..900709,900776..900868,
FT                   901574..901667,901727..901962,902047..902085,
FT                   902240..902287))
FT                   /locus_tag="ANIA_07132"
FT                   /old_locus_tag="AN7132.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000327"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000327"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX48"
FT                   /protein_id="CBF79011.1"
FT                   /translation="MSTTPQIPGAIDVPEQNGYTYIVPLDPNRTQYHARQLERYDAQSP
FT                   YIRGRVTRIQYQCSGVRICSYLHPNLRNMHHYKVTEDDWNYIRQERQLIEETEMDPKKQ
FT                   KAISHFFGVLRVFKRHQACRPQQVGCAPKMVLGEAALIYREKLAFYPDGQDLNALQLEC
FT                   DRNEYLKHYVREIYHEGDITIIICILQDQAKLFQSLRSFEVDMSFKRVREGRFNEVIFA
FT                   VFLEDHGKVITLLRAFMNQQTGRAYYFLFKKVFEMIHDLSGHPVQFFHLHGTGIETIVV
FT                   DMDEGQRDVLFKAMISLLHAPTRAQYMDILEQLLEDPTPGVATWAEHKLHPHFNQTRMH
FT                   TNAGEQTHQKSYAFSGKHLPILKAVTSAYFLDVRDMHQYSVRIHYNITHSYRPDDEISR
FT                   ITENLIRDQRRTTPVIR"
FT   gene            902499..904359
FT                   /locus_tag="ANIA_07131"
FT                   /old_locus_tag="AN7131.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(902499..902801,902853..903504,903688..903954,
FT                   904012..904159,904201..904225,904330..904359)
FT                   /locus_tag="ANIA_07131"
FT                   /old_locus_tag="AN7131.4"
FT                   /note="transcript_id=CADANIAT00000328"
FT   CDS             join(902499..902801,902853..903504,903688..903954,
FT                   904012..904159,904201..904225,904330..904359)
FT                   /locus_tag="ANIA_07131"
FT                   /old_locus_tag="AN7131.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000328"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000328"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000328"
FT                   /db_xref="GOA:Q5AX49"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX49"
FT                   /protein_id="CBF79013.1"
FT                   /translation="MWSPFLEVAKALREGHVVEFITQKYNEYGWTFEQNVLGRSGISTI
FT                   EPENLKALLATQFNDFCLGTREREFGPLLGQGIFTLDGAGWSHSRALLRPQFTRDQVAD
FT                   LDLMESHISRLIELVPKDGSAFDIQRLFFLMTLDSSTHFLFGESVHCMDEGNVLARSTV
FT                   NNAQGFANAFNTALDYLNWRSVAGNFYWMITSKEFRDANKRVHEVVDYYVHQAIEAKRH
FT                   PEKKEPGRYIFAEALAADNDNPKVLRDNMLNILLAGRDTTASLLSSAFFYLSRHPAVWE
FT                   KLRRVIIEEFGDVQNPKGEITHAKLKDLPYLRYVLNEVLRLQPPVPLNLRVAVKDTSLP
FT                   VGGGPDGKSPVFVEKDQPVLYSVYAMHRRKDLWGPDADSFRPERWEENAKHGWEYLPFN
FT                   GGPRICLGQQYALTEASYTMVRLMQRFSKVENGEPGLDEPLIRATLTMSHENGVKVRFK
FT                   LQHVRRKPSPLQTCTR"
FT   gene            complement(905668..906464)
FT                   /locus_tag="ANIA_07130"
FT                   /old_locus_tag="AN7130.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(905668..905997,906057..906464))
FT                   /locus_tag="ANIA_07130"
FT                   /old_locus_tag="AN7130.4"
FT                   /note="transcript_id=CADANIAT00000329"
FT   CDS             complement(join(905668..905997,906057..906464))
FT                   /locus_tag="ANIA_07130"
FT                   /old_locus_tag="AN7130.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000329"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000329"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000329"
FT                   /db_xref="GOA:Q5AX50"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX50"
FT                   /protein_id="CBF79014.1"
FT                   /translation="MTFSKPTLIFCPGAWYPPTAFEPLAAHFPEHTTHTIAFPSIHQAT
FT                   STKDLQPDIEALRTLVEQEASAGKDIVIISHSWSGLPVNSALDGLSKTERQAAGDAGGV
FT                   AKLIFISAFIPDVGESLIGAFGGVPPDWYDRDEANGTVSAVNPYTLFFHDVPDGEQWAE
FT                   ALRPHAWATKVSPATSAAYTRIPGAYLMCENDRAIPLCVQQLMIEKARERGAQITTESI
FT                   ATGHSPWLVDPAPVAAFLQRSMA"
FT   gene            complement(907301..910354)
FT                   /locus_tag="ANIA_07129"
FT                   /old_locus_tag="AN7129.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(907301..907416,907477..910354))
FT                   /locus_tag="ANIA_07129"
FT                   /old_locus_tag="AN7129.4"
FT                   /note="transcript_id=CADANIAT00000330"
FT   CDS             complement(join(907301..907416,907477..910354))
FT                   /locus_tag="ANIA_07129"
FT                   /old_locus_tag="AN7129.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000330"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000330"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000330"
FT                   /db_xref="GOA:Q5AX51"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX51"
FT                   /protein_id="CBF79016.1"
FT                   /translation="MADLEASIEHLREAVEQTAEGHPDRVEYLNDLGSQLEDRYSRTWA
FT                   LADLDEAIQVWREAVRAAPVNYPEHATYLDKLAGQLGVRYSKTGALADLEESIQLEREA
FT                   VNKTPEDHPDHAMFLDNLGIQLRVRYSRTGTLKDLEESIQLGQKVVNTTSKDHPDRAMF
FT                   LNNLGVRLRNKYLRTGSMTDLEASVQVWQEAVNTATEDDPDRALILSNLAGQLGVRYSR
FT                   TGTLADLEESIQLGREAVNTTTEDHPDRAMFLNNLGIRLSDRYSRIGAMADLEEAIRVW
FT                   REAVNAATEDDPDRTLLLGNLACQLKDRYTRTGALADLEESIQLGRDVVDTLPGGHPSR
FT                   AMHLNNLEVRLSDRYSKFGAIADLEEAIQLGREAVQTTPESHPNYTMYLNNLGTLLGDR
FT                   FARIGAMADIEESIKIGRQVIKAAPEDHPRKASWLKSLADQLRHRYSITGATADLYEAI
FT                   SYQETALHQENAFLSTRISAGKNALQNLAILSNWQQAYKSADTAVHLIPRLAMRSLENS
FT                   DKQYLLGAMVGFASDAAAVALNAQKGAVVALDLLELGRGVLAASLDEIRVDTEDLQHKH
FT                   PVMAERFVQLQAQARQNVEAERELDNLIMNIQSQPGFNNFLKAPSEEEILHAAQKGPII
FT                   TINISQYRCDAIIVEHHRISSLPLPKLIIADITEKARWDDLGSPQVLEWLWDTTMEPIL
FT                   EVLGFIQSPSNREWPHVWWIPTGPLAKFPLHAAGYHSQGNSKTVLDRVMSSYSSSIKAI
FT                   IRGRQRLATESLPFALLLSMQDTPGNGYLPFAAEEVQILCDMCKLMALHTIQPRRREHD
FT                   IIGHMRVCQIFHFAGHGYTSHTDPSQSRLILWDGDDDSLTVGSLLKMNLHKNPPFLAYL
FT                   SACGTGQIKDDKLIDESIHLTSAFQLAGFRHVIGTLWNVNDDICVDMARITYTEIANGN
FT                   MDDESVCRGLHYAAREMRDRWLEALSEIEHPTATNRVRDIIPNDIDLAGNRSERRQALW
FT                   VPYIHFGV"
FT   gap             913186..913285
FT                   /estimated_length=unknown
FT   misc_feature    913286..917209
FT                   /note="contig 1.120 1..3924(-1)"
FT   gap             917210..917309
FT                   /estimated_length=unknown
FT   misc_feature    917310..1054286
FT                   /note="contig 1.119 1011..137987(-1)"
FT   gene            917920..918103
FT                   /locus_tag="ANIA_11547"
FT                   /old_locus_tag="AN11547.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(917920..917927,918052..918103)
FT                   /locus_tag="ANIA_11547"
FT                   /old_locus_tag="AN11547.4"
FT                   /note="transcript_id=CADANIAT00000331"
FT   CDS             join(917920..917927,918052..918103)
FT                   /locus_tag="ANIA_11547"
FT                   /old_locus_tag="AN11547.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000331"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000331"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000331"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD99"
FT                   /protein_id="CBF79018.1"
FT                   /translation="MALLFMPFQRLQKECSQYQ"
FT   gene            918688..919515
FT                   /locus_tag="ANIA_07128"
FT                   /old_locus_tag="AN7128.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            918688..919515
FT                   /locus_tag="ANIA_07128"
FT                   /old_locus_tag="AN7128.4"
FT                   /note="transcript_id=CADANIAT00000332"
FT   CDS             918688..919515
FT                   /locus_tag="ANIA_07128"
FT                   /old_locus_tag="AN7128.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000332"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000332"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000332"
FT                   /db_xref="GOA:Q5AX52"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX52"
FT                   /protein_id="CBF79020.1"
FT                   /translation="MPSTPPAIYPSLYDKTVIVTGGASGIGAATVLLFALQGSRVVFLD
FT                   IADDAAQKTIDHVTTRANTNAKTSPFKISVKPPVFYHCDITDLHELKATASKILDEHGP
FT                   VHVLINNAAATGSIARQASLDVTPETWDFNVNANLRHIFFLTQCFIPSMKSSGGGSIVN
FT                   LGSISWRIPEATTPIYGTCKAAINGLTRIHSREFGTHNIRVNCVMPGAIATDRQRAEVL
FT                   TEEYRTHVFAQQSLKRDLEPEDVAKVIVFLGSEEASGVTGSCYVVDGGWMGNP"
FT   gene            920734..921878
FT                   /locus_tag="ANIA_10894"
FT                   /old_locus_tag="AN10894.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(920734..920972,921061..921181,921306..921878)
FT                   /locus_tag="ANIA_10894"
FT                   /old_locus_tag="AN10894.4"
FT                   /note="transcript_id=CADANIAT00000333"
FT   CDS             join(920734..920972,921061..921181,921306..921878)
FT                   /locus_tag="ANIA_10894"
FT                   /old_locus_tag="AN10894.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000333"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000333"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000333"
FT                   /db_xref="GOA:C8VDA1"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDA1"
FT                   /protein_id="CBF79022.1"
FT                   /translation="MRLGYCLCLCGLLASSAVLAQDIDYGAAAESISAVLADPTFVPYA
FT                   KPTQKVSEWIAVGDSYSAGTGCNGNNKRMGRDAVPFHAYTSNKVQDLVVHQLKQGDYRE
FT                   GNDLPRNQPFSKPQLASSSPGQLPGNAQQPPTGTRQQQLPGQGQLQAVPGRTCRTRGRR
FT                   RQPARKLPGLCPGICDLLRDRRRMQRLLVVLLWVEHPETQPGGDWGQQIAIASYINPLG
FT                   DPASWERLLAYDTNKVSVLVANVLNSPDYVVDDSWKSVIDQAASQGKKILGYVRTGYLG
FT                   VSQQQFTTRLGSRDLADWASQIEQDIDKW"
FT   gene            921984..922864
FT                   /locus_tag="ANIA_10899"
FT                   /old_locus_tag="AN10899.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(921984..922692,922824..922864)
FT                   /locus_tag="ANIA_10899"
FT                   /old_locus_tag="AN10899.4"
FT                   /note="transcript_id=CADANIAT00000334"
FT   CDS             join(921984..922692,922824..922864)
FT                   /locus_tag="ANIA_10899"
FT                   /old_locus_tag="AN10899.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000334"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000334"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000334"
FT                   /db_xref="GOA:C8VDA2"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDA2"
FT                   /protein_id="CBF79024.1"
FT                   /translation="MKQKHLGAYTVLNPGLPIAQCYEDTMDTLLTFENTYKTYQNLFVP
FT                   NNWTPQDPRKIWHIIYNVPQGQIASVAALASDRNIGLIEITGDVAPNPYDNLPSDAYIQ
FT                   AVIGAVSGGTPLIKGPADVTSFYVAGLPGDVTVAASDYSSVTLDWSSVANALGYAVYRQ
FT                   MEQNQDAFLPPRQQPQQPADLTGGTQLQYSGTRLQVTSELAPGAATNATASGSCRLIPR
FT                   QIHRPAMNSAWNWLLILLGTEACGNSL"
FT   gene            complement(924061..926816)
FT                   /locus_tag="ANIA_07126"
FT                   /old_locus_tag="AN7126.4"
FT                   /product="HET domain protein (AFU_orthologue;
FT                   AFUA_3G03140)"
FT   mRNA            complement(join(924061..926627,926753..926816))
FT                   /locus_tag="ANIA_07126"
FT                   /old_locus_tag="AN7126.4"
FT                   /note="transcript_id=CADANIAT00000335"
FT   CDS             complement(join(924061..926627,926753..926816))
FT                   /locus_tag="ANIA_07126"
FT                   /old_locus_tag="AN7126.4"
FT                   /product="HET domain protein (AFU_orthologue;
FT                   AFUA_3G03140)"
FT                   /note="transcript_id=CADANIAT00000335"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000335"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000335"
FT                   /db_xref="GOA:Q5AX54"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX54"
FT                   /protein_id="CBF79026.1"
FT                   /translation="MIPPPTEKGEGPEVAPLLTLKAITFWGADIELDMTETPSQTPWAL
FT                   TKAHIFAILDEDVYRPDKNLGLAPGLIPAEVRRADFTERGPANDREKLSTLQTRAWIEQ
FT                   WCRDAFVLVEAKKENENLNTHFEQLDALFSTLMICNFQLERHKKDRATVVDSAYTVLQR
FT                   LPRHPPELTFEYSRRSRSNKTESVGNQWPPEYFCGSSAVGIEEVDAPQGYRWTDLRVLS
FT                   RPCTNVVRTALWLCMNRTNAIAIHEYADTIVKLLDTVTDLQKASTTESDARAWFVLTAL
FT                   FWSAWQQTVMLQLCFDATIRLDYGYASDENYHIIARETPSVMPPREIVERLRPKYMCQW
FT                   AFELLRADLSSVTQDFRALFEVYERQFGGRESRCNVIDSGRVCDGKAPANCERFLSNRV
FT                   EDQSAHDFQCPGSSCSLLTWDEQSYMSINGARAVCLETTDDKHIRYRPVSGENMAVSHV
FT                   WSHGQGGRPETGFNICLHRRYTELARSLGCTSYWMDSPCIPTDDELRDEAIGQINDNFI
FT                   NSKLVLLVDRDLMDIDIEPLTLAAEEAILATLVVCDWNVRAWTLLEGIRGRANLHILCK
FT                   DNRVIPLKTVLTDILSKSCLSLVSPCLAVQHYTPTRDKVDLVKTEQATCLLNHRHPTKD
FT                   RDIIIIWSLVCGSNKVVKTAEAFWRSMVGGRLATGFLVSSSPRIKGIRGLSWAPERPNL
FT                   VPPASASSPKGAASTHAKGSLQQQQYPAFNGENSVAGKITPDGFRAEWLVCKIQRRRAL
FT                   PGAGLFWLHGASDDDDGYFYVYNKGANDKMDVKSLFYLRSVVAPLFKRYRWVSLLLPPW
FT                   SQRGGEHIDPPVRPFKYQGECEGLVMAIVASNDEAGSEWEWQGVHEWDVKFKMPEFPIA
FT                   NILIV"
FT   gene            complement(928961..929863)
FT                   /locus_tag="ANIA_07125"
FT                   /old_locus_tag="AN7125.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(928961..928986,929113..929371,
FT                   929780..929863))
FT                   /locus_tag="ANIA_07125"
FT                   /old_locus_tag="AN7125.4"
FT                   /note="transcript_id=CADANIAT00000336"
FT   CDS             complement(join(928961..928986,929113..929371,
FT                   929780..929863))
FT                   /locus_tag="ANIA_07125"
FT                   /old_locus_tag="AN7125.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000336"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000336"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX55"
FT                   /protein_id="CBF79028.1"
FT                   /translation="MSNQPGAVKHADIQVLCVRYLEAGRLRGLYLPVEAFLDPASPERV
FT                   LPGGVPKDLGGIYRRLLQQVEDKEQLASILQWAVLAARPMTVNELAVAADIKASDTLTP
FT                   AEILNGRLASYINIDYNT"
FT   gene            930181..930337
FT                   /locus_tag="ANIA_11546"
FT                   /old_locus_tag="AN11546.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(930181..930186,930299..930337)
FT                   /locus_tag="ANIA_11546"
FT                   /old_locus_tag="AN11546.4"
FT                   /note="transcript_id=CADANIAT00000337"
FT   CDS             join(930181..930186,930299..930337)
FT                   /locus_tag="ANIA_11546"
FT                   /old_locus_tag="AN11546.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000337"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDA5"
FT                   /protein_id="CBF79030.1"
FT                   /translation="MLHYQHAGILLAPA"
FT   gene            complement(930894..931139)
FT                   /locus_tag="ANIA_11545"
FT                   /old_locus_tag="AN11545.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(930894..930899,930951..931139))
FT                   /locus_tag="ANIA_11545"
FT                   /old_locus_tag="AN11545.4"
FT                   /note="transcript_id=CADANIAT00000338"
FT   CDS             complement(join(930894..930899,930951..931139))
FT                   /locus_tag="ANIA_11545"
FT                   /old_locus_tag="AN11545.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000338"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000338"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000338"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDA6"
FT                   /protein_id="CBF79031.1"
FT                   /translation="MAIAYDKESAMKVQAILSSRDDWRAWFQVIKDHANKQEVWEYFDP
FT                   DADNKTRPKPLTKPTIPSE"
FT   gene            931594..932688
FT                   /locus_tag="ANIA_07124"
FT                   /old_locus_tag="AN7124.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(931594..932034,932369..932375,932465..932509,
FT                   932666..932688)
FT                   /locus_tag="ANIA_07124"
FT                   /old_locus_tag="AN7124.4"
FT                   /note="transcript_id=CADANIAT00000339"
FT   CDS             join(931594..932034,932369..932375,932465..932509,
FT                   932666..932688)
FT                   /locus_tag="ANIA_07124"
FT                   /old_locus_tag="AN7124.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000339"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000339"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000339"
FT                   /db_xref="GOA:Q5AX56"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX56"
FT                   /protein_id="CBF79033.1"
FT                   /translation="MHSILVAITSYFPSTLGQQTTGCADPSSLCPIPHQQTAMDNPRGV
FT                   SCHTNPPESITDRTRFGIRGCIVYGYPSTGGVLIKGPIDLVDITFLSLPRFHVAQRSPS
FT                   AEEEDRFCNLLRRLGATWWPSKEEYIMVNMGSREKTEEEEKVLVQDHDKTRDRSKIRTR
FT                   TRLYSMFV"
FT   gene            933228..936184
FT                   /locus_tag="ANIA_07123"
FT                   /old_locus_tag="AN7123.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            933228..936184
FT                   /locus_tag="ANIA_07123"
FT                   /old_locus_tag="AN7123.4"
FT                   /note="transcript_id=CADANIAT00000340"
FT   CDS             933841..936057
FT                   /locus_tag="ANIA_07123"
FT                   /old_locus_tag="AN7123.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000340"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000340"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000340"
FT                   /db_xref="GOA:C8VDA8"
FT                   /db_xref="InterPro:IPR010440"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDA8"
FT                   /protein_id="CBF79035.1"
FT                   /translation="MSGSSSPDYKALFLKAEDERKQAEERQRQAEERQRQAEERQRQAE
FT                   ERERQERERNRPTTFEEFIRHCHNLLWRPLQAEAPSRSTTGKIPPPTGKYCPIRLLPWT
FT                   DCEARQQEIYESVCRHLQSTEEDAKQLFTPLVALEDHGRRFARRPISSEQDLETYERLA
FT                   VEDHVHDIIAELCKIPNAREEFQLGSGVWFDNHANALDEDVGIDASQTSTARPSRHDQF
FT                   CIHRVDSNTSTLLTTVEYKPPHKLSVESLREGLRPMDFWQEVVEPDTIPTEEPKKSMYN
FT                   VARLVGSAIVQEFHVMIQEGLEYSYLTNGLMDVQLWVPYDDPCTLYYDLGDPSMYGTMS
FT                   VGRLGTPRTRIERTLCLCLMSFRSSCRNQAWRNDARGQLPTWHTSFDSERSQISAAGLP
FT                   QYPSVEHTSSDHTSPEQTTSEYLPSSSPAGSPVTKGRQVTTQAASRCASSSDQHYLEDS
FT                   SDSEVEPAASDGRKRTFSQVTSSSPTQQSRPRTDPQVNQSGQSRQHVAQYCTQKCLLGL
FT                   LQGSTLDPDCPNMELHTLGRSDNRHLISAEDLVEKLKAQLDQDLDHNCTPIGPCGSYGA
FT                   PFKITCATFGYTIVGKGTTSRLWKEVSSEVDVYRVLQPAQGSAVPVFLGAIDLAQIYFL
FT                   HGAGEICHMLLMGWGGEGMGNIKLDKTIQRAISRSVKEIRSLGIFHQDLRSENILWNAE
FT                   LKRALIIDFHRCTLDPQLMHKRPGSLKRTRLGHEERESRRLRVV"
FT   gene            complement(938513..941190)
FT                   /locus_tag="ANIA_07122"
FT                   /old_locus_tag="AN7122.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(938513..938853,939106..939222,
FT                   939604..939616,939734..939844,939989..940113,
FT                   940280..940318,940591..940599,940634..940672,
FT                   940848..940871,941166..941190))
FT                   /locus_tag="ANIA_07122"
FT                   /old_locus_tag="AN7122.4"
FT                   /note="transcript_id=CADANIAT00000341"
FT   CDS             complement(join(938513..938853,939106..939222,
FT                   939604..939616,939734..939844,939989..940113,
FT                   940280..940318,940591..940599,940634..940672,
FT                   940848..940871,941166..941190))
FT                   /locus_tag="ANIA_07122"
FT                   /old_locus_tag="AN7122.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000341"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000341"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX58"
FT                   /protein_id="CBF79037.1"
FT                   /translation="MLDMSLTPYTTEPVPHFFVSDHIHIKKIQACIWKLSEQYFPVQPG
FT                   NSRIEEMPTTGTIEEFRRDFETALAREQNFQAPGNISVTIKELWCRDFKEYHGKLPKQS
FT                   RVQLTALILLYCLSSARTGEFMANCKALGADAFGKEFAVLGSQCGFEQNITVHACRRWA
FT                   LMETAKAEFEFQDCEDILALDKELAELSTQLENTDSAESMREIQLQQQRIQGQKDKLYL
FT                   GEPKRQYQLQPDNQSRSIHEHMLFYYYQQVMPERDLLADILPARQRYRAWLNWMLSKH"
FT   gene            complement(941863..943546)
FT                   /locus_tag="ANIA_07121"
FT                   /old_locus_tag="AN7121.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(941863..943262,943321..943546))
FT                   /locus_tag="ANIA_07121"
FT                   /old_locus_tag="AN7121.4"
FT                   /note="transcript_id=CADANIAT00000342"
FT   CDS             complement(join(941863..943262,943321..943546))
FT                   /locus_tag="ANIA_07121"
FT                   /old_locus_tag="AN7121.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000342"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000342"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000342"
FT                   /db_xref="GOA:Q5AX59"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX59"
FT                   /protein_id="CBF79039.1"
FT                   /translation="MGATTTGLILGLASLASAVTYGYNHVPVTKDSETVAGAFANVDDI
FT                   QLRSPAFLTPDARLPGFTNGTQGPSSQDDLEEFLEQLVGRNDYMTYGTANFTSQEHRSF
FT                   PYVHLSASHSSSVRRGNSSSKVRVWIQGAVHGNEPAGDETTQALLGKFDDDPEWAASIL
FT                   DKLELVILPRYNPDGVFYFQRTLATNIDPNRDHIKLASQQTRDIKQFMNTFNPHVIVDM
FT                   HEYSASRPYGGGRYVHGSDGLFSAAKNLNINEEIRKLSEELFAKNIADDMKAAGLRAEP
FT                   YVTGTSVSNSSIVADFAEAGTDSKIGRNAMGLTQAVVFLLETRGIGIADQEFQRRTAAG
FT                   LTMLGSIVQTAADNAEEVFTTVEDGIERFIKSADDIVVTDYSEIKIRPFTMVDKENGSV
FT                   VHPSVRFASTTPSFANLTRARPEAYLIPPAWAHLAERLRVAGCEVETLDKPFDGVVEAL
FT                   TITSAEIDSSYYEGVIRVTATTESSERELSLPEGSFRVSTRQKNAALAMVALEPENIDS
FT                   YVSFNIVPVEEGDEYPVFRIMSSK"
FT   gene            complement(946180..946443)
FT                   /locus_tag="ANIA_11544"
FT                   /old_locus_tag="AN11544.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(946180..946263,946303..946443))
FT                   /locus_tag="ANIA_11544"
FT                   /old_locus_tag="AN11544.4"
FT                   /note="transcript_id=CADANIAT00000343"
FT   CDS             complement(join(946180..946263,946303..946443))
FT                   /locus_tag="ANIA_11544"
FT                   /old_locus_tag="AN11544.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000343"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000343"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000343"
FT                   /db_xref="GOA:C8VDB1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDB1"
FT                   /protein_id="CBF79040.1"
FT                   /translation="MADYPPALAIDDQFRPAVQTQGSMKALFLDDSGMITNKRLQTPLA
FT                   FLGVVPPRNIEVLTIMDDLALQNEDHMEK"
FT   gene            complement(948382..951115)
FT                   /locus_tag="ANIA_07120"
FT                   /old_locus_tag="AN7120.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(948382..948415,948455..948525,
FT                   949121..951115))
FT                   /locus_tag="ANIA_07120"
FT                   /old_locus_tag="AN7120.4"
FT                   /note="transcript_id=CADANIAT00000344"
FT   CDS             complement(join(948382..948415,948455..948525,
FT                   949121..951115))
FT                   /locus_tag="ANIA_07120"
FT                   /old_locus_tag="AN7120.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000344"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000344"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000344"
FT                   /db_xref="GOA:Q5AX60"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX60"
FT                   /protein_id="CBF79042.1"
FT                   /translation="MIQGLDDKLVYTFDAETLWIEPWGPNAIRVRSTRSRQIPDQNWAL
FT                   LNQPSTSAIINVQSNGTGVIQNGKIQASLSETGKIQVQNSKGKLLLQEYVRNRKDVKDP
FT                   KCSAIEVEAREFRPILNSESFHLTARFESVSTEEMLFGMGQYQQPFLDLKGHQLELAHR
FT                   NSQASIPFLVSSLGYGLLWNNPSVGRCFLGRNIMSFESESTTTLDYWVVVGDTPADIVE
FT                   TYAANVGKVPMMPEYGLGFWQCKLRYQTQEELLQVAREYKRRELPIDLIVIDFFHWPLQ
FT                   GDWRFDPTYWPNPAAMVKELRGMGIELMVSIWPTVDKRSENYRKMLEKGFLIRTDRGVR
FT                   TAMDFQGDTIHFDATHPGARAYVWEKCKTNYYDYGVRAFWLDEAEPEYKAYDFDNYRYY
FT                   QGPNTAIGNIYPLEYARAFYEGMEQAGQKNIVNLVRCAWVGSQKYGALVWSGDIASSWE
FT                   SFQHQLVAGLHMGLCGIPWWTTDIGGFHGGNPSDSKFRELFVRWFQWATFCPVMRLHGD
FT                   REPRQPVQGTTGGASCASGADNEVWSYGLEVYEICKKYMLLREALRDYTRGLMRSAHLK
FT                   GSPVMRTLFYEFPEDPECWRIGTQYMYGDRYLCCPVLQDGQRQLKSYLPALRSGKWVPF
FT                   QNDDAVKEAYPGGQWIEICAPLHWMPVFERSQVKDAVVVKMGEIKKPGADGLSLPKKSG
FT                   REYTR"
FT   gene            951647..954024
FT                   /locus_tag="ANIA_07119"
FT                   /old_locus_tag="AN7119.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(951647..952978,953015..953262,953321..953387,
FT                   953456..953497,953804..953898,953949..954024)
FT                   /locus_tag="ANIA_07119"
FT                   /old_locus_tag="AN7119.4"
FT                   /note="transcript_id=CADANIAT00000345"
FT   CDS             join(951647..952978,953015..953262,953321..953387,
FT                   953456..953497,953804..953898,953949..954024)
FT                   /locus_tag="ANIA_07119"
FT                   /old_locus_tag="AN7119.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000345"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000345"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000345"
FT                   /db_xref="GOA:Q5AX61"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX61"
FT                   /protein_id="CBF79044.1"
FT                   /translation="MVSEHNDGIVHPTSIEKEHAPLEAPSKDDTSLARLAAQQEHHLGF
FT                   WEAVRCYPNAVLWSVLLSTSIIMEGYDIVLIQSFFAQPSFREKYGQYDAGTSSHQITAP
FT                   WQNGLSNAVSVGTIIGAFANGYFVHKFGYRKVLLASLVTICGFILISFFSPNLPVLLVG
FT                   QFLCGIPWGVFATMAPAYASEVCPLALRGYLTVYVNLCWAFGQLISAGVQSGFSEKTGQ
FT                   WSYRIPFAIQWAWPCLLFPILWFAPESPWYYVRVGNHDLAEASINRLGSASQRAHSKET
FT                   LAMMIHTDEIERSIDEGTSYLDCFRGVDLRRTEIACMAFAAQPFCGSAMGGTPTYFFVQ
FT                   AGLPESISFRMSVGGLGIASVGTIFAWFLMRGCGRRTLYLWGLGLLTLVLLAVGFCSVG
FT                   SNSNASNYAQAGLMLCWLGVYYSTVGPICYAVITEVSSTRLRNKSIVCNSINPEMLNPT
FT                   AGNWRGKTGFFWGGCSAVFFIWTFFRLPETRRRTFEEIDLLFAKKVDARRFAQYDVDAY
FT                   GEGQEDIRKQYTGNEGQRFRRHNRISVPFDNSSLHFVYSLPSIDDSMVDLTKSVARDSA
FT                   SVKMTYLLKTQLHSAMRRLRVFGNDSSQPPSVRGTFLGFDLNK"
FT   gene            complement(956254..959330)
FT                   /locus_tag="ANIA_07118"
FT                   /old_locus_tag="AN7118.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT   mRNA            complement(join(956254..957519,957579..958672,
FT                   958715..959330))
FT                   /locus_tag="ANIA_07118"
FT                   /old_locus_tag="AN7118.4"
FT                   /note="transcript_id=CADANIAT00000346"
FT   CDS             complement(join(956254..957519,957579..958672,
FT                   958715..959330))
FT                   /locus_tag="ANIA_07118"
FT                   /old_locus_tag="AN7118.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000346"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000346"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000346"
FT                   /db_xref="GOA:Q5AX62"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX62"
FT                   /protein_id="CBF79046.1"
FT                   /translation="MDPVPYSPSRGGCSIQCHLCQTTFTRQEHLSRHLRSHNAEKPFHC
FT                   VKCGKSFSRLDVLHRHSQLHRYKRNASEGRGGSSSRACKECALSRVRCSRGSPCDRCSV
FT                   KEIQCEYPVPRKRKSQSGLGQTGSLPQTAESGFYLSDVSSFQLHSSQQTLNNSIIDGLP
FT                   STSHLLGEESESQAPNAGITQDWLPLQQSGTLASASPGLVSEGHWIGSLTSVNWLSPES
FT                   NHFPEAQFEDLLLPKGKDGTTARVESMDRLGEHASQTNRNNAVPVGQGNTNATQPSTPL
FT                   WTPSGTGQALTAGQSTCTDTTDTPTVRHSEGVYYVEGSAGRAPFQGRSSWRARMTSRWS
FT                   IGNASAEQGVPDSESSIRSRGHYVSETIYQSCRERLEAESNHFGLGIDMDSIPQLGEMQ
FT                   DLVNLYFDGFHPSYPFLRKSQSIFVKSSCWILLLAVAATGSRYSTEARHHKLGESLVDM
FT                   VDQLVSMRLQNPVLAGSDPTWKPCAGSDEGSLDTVTLQAALLNSISLLHCGKEHGVRRA
FT                   LRRRFYFFEAYHALKQATSIKRRSSQLREGTEEDTFQHWVDTESLIRTSWMIWFLDCIA
FT                   LYQFRHAPLIQLGDSKAPLPCHEDLWDVSSLTEGFSNADHQSGSFYSLGPFEQTYNLSK
FT                   ADFDIALLIVTLLEALELLHMEKTLPPKLGNFSTTIIIFGICRRNQEATVQHQTNLTLW
FT                   LPSAQKQSRPPLHPIEEAWPPTVSSLSRWRSSACDCLDILHWNANSIAASVGGWEHPTI
FT                   LHLHLARLLLLAPVQHIETLGSESTISHTPQTSSSTAYTIARYHTLRWAIRDQYKARLC
FT                   LVHAGALFWHVRRYSSNSFLEPFSVYTATLVIWAYSMAMHTMRGQGREKAILSETHLSP
FT                   RDPVQQEAPCLEEIGLDDKSSDSDAEVMVIQLDRPCDDEIVQNFVRFGHTMSARMHRVG
FT                   DIQEQSAPRRILKQGLRLLTGALSDSDRAVPSWGVEKSFIDSLNTFIELPMVTSKNDRL
FT                   PG"
FT   gene            complement(959829..961388)
FT                   /locus_tag="ANIA_07117"
FT                   /old_locus_tag="AN7117.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(959829..959903,960016..960712,
FT                   960784..961388))
FT                   /locus_tag="ANIA_07117"
FT                   /old_locus_tag="AN7117.4"
FT                   /note="transcript_id=CADANIAT00000347"
FT   CDS             complement(join(959829..959903,960016..960712,
FT                   960784..961388))
FT                   /locus_tag="ANIA_07117"
FT                   /old_locus_tag="AN7117.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000347"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000347"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000347"
FT                   /db_xref="GOA:Q5AX63"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX63"
FT                   /protein_id="CBF79048.1"
FT                   /translation="MKFTHSLLIAVGADYVSASAQTVNSQNTSGNAIVDVAARTGQAQF
FT                   LGSNFIYGFPDNGVEAQVSIPDHFLTGIKFNACRAGGAQIAAGGWGSGGYAEYIGRFNS
FT                   TLSNYRSTRKYNGEFILLLHDLWGADGGSSPDDLVPGDNGDYTEFQKFLAQVKKDIEAN
FT                   DMLDGLIIDIWNEPELEIFWKRSWEQYLDYYVHATGLVRTVITGPSFAHAPTIDSTYWN
FT                   SWASVVAGSRTLPDIYSWHQIGVWEREPDRSVADFKALLNLYGLPDKPIDLNEYAWTTE
FT                   QNPANSAFYLAQLERHNVRGLRANWGSGGGLHDYLANLVYKSESDGEYQPNGEWHLYNY
FT                   YANMTGDRVATTAAADRQFDVFATASCGEVKILAGTRSAQAAYDVIVRGLPKLGFPRRG
FT                   EIGVRILRFDWNGQFADVGGPVDQGCSHYPVQDGQLTFTVDPPTNSTAFAFEISPHGKC
FT                   "
FT   gene            963770..964252
FT                   /locus_tag="ANIA_07116"
FT                   /old_locus_tag="AN7116.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(963770..963935,964044..964252)
FT                   /locus_tag="ANIA_07116"
FT                   /old_locus_tag="AN7116.4"
FT                   /note="transcript_id=CADANIAT00000348"
FT   CDS             join(963770..963935,964044..964252)
FT                   /locus_tag="ANIA_07116"
FT                   /old_locus_tag="AN7116.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000348"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000348"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000348"
FT                   /db_xref="GOA:Q5AX64"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX64"
FT                   /protein_id="CBF79050.1"
FT                   /translation="MNSCILDMKIPESKVTVVTQTSYQQQDSTIRPPTNDDGGSVTPYN
FT                   TPIPSAYISPATNAEYPESSSHVFTLQGQQDNGALSMAPAESSLLSPEYGLEQTVPDYT
FT                   NQISLWESDYGIISAADSPA"
FT   gene            complement(969895..971265)
FT                   /locus_tag="ANIA_07115"
FT                   /old_locus_tag="AN7115.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(969895..971265)
FT                   /locus_tag="ANIA_07115"
FT                   /old_locus_tag="AN7115.4"
FT                   /note="transcript_id=CADANIAT00000349"
FT   CDS             complement(969895..971265)
FT                   /locus_tag="ANIA_07115"
FT                   /old_locus_tag="AN7115.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000349"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000349"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000349"
FT                   /db_xref="GOA:Q5AX65"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX65"
FT                   /protein_id="CBF79052.1"
FT                   /translation="MSSVGNTSSSIQDQETVIEQFQAWYEGHRSGYVSIAQESAGRLAQ
FT                   VLGDAGVPHKVEYRAKDIARLRIKVNGRKNDKRYGNVDDVATDIVDLAGVRVLLYFPSD
FT                   KDRVEKLITENFEVHSSHRITGTKTIEIRRASHGYTPKYPTYCADHYRATLRLKEGREA
FT                   EPWQSFRLEIQVTTILRHTWAEVGHDWSYKKLKPGGEDEFCCQLLDALSGAVDMGEFFL
FT                   EQMQKRLMTQKEQADQPFRSHYELGEFLRRWAARNGRAQDLVDVQTLWQVLHYYDYDRP
FT                   TELLQILAGLDLSSELAQKYEPLPFNLETSIIHSILVSDERYKRERETDAARPTKFQRY
FT                   KLKVVRDCFIWFGRLFRFNHKWYSLLCSGSVPRRVLENMEWLVNQSMKEGETLSSGDER
FT                   ILDDLFDTFAKHGKLAVQYVFFLARLRVKAFPADGYAMRMVVQPLLKLRAHQRARLY"
FT   gene            complement(973659..975118)
FT                   /locus_tag="ANIA_10895"
FT                   /old_locus_tag="AN10895.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_6G02590)"
FT   mRNA            complement(join(973659..973837,973897..974062,
FT                   974120..974451,974485..975118))
FT                   /locus_tag="ANIA_10895"
FT                   /old_locus_tag="AN10895.4"
FT                   /note="transcript_id=CADANIAT00000350"
FT   CDS             complement(join(973659..973837,973897..974062,
FT                   974120..974451,974485..975118))
FT                   /locus_tag="ANIA_10895"
FT                   /old_locus_tag="AN10895.4"
FT                   /product="protein kinase, putative (AFU_orthologue;
FT                   AFUA_6G02590)"
FT                   /note="transcript_id=CADANIAT00000350"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000350"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000350"
FT                   /db_xref="GOA:C8VDB8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDB8"
FT                   /protein_id="CBF79053.1"
FT                   /translation="MASILRTLRSNLQRTRLSFRDRSTVAHIARESPIEEETLPHYKAS
FT                   HFYPVKIGDVYHTRYEVVGKLGYGAYSTSWLCRDLQCATPVQSILRRALTSRELRAQKY
FT                   AAMKVSASLPDYPTATDREFKVYKHLATVDSSHLGQSLIRELYDSFDLQGPGGSTHRCL
FT                   VLQPMTMTLLEMMRMNPRPFDLPLLKMTVKRLLLALDFLHAKAGVIHTGLIPQDLKTDN
FT                   LMLSLDDTSMLADFATAESENPSPRKVIDKSRIIYCSRRFRRPTGRRNYGLPVLCDFGE
FT                   ARIGKTQESGPFVQPHIYRAPEVIFEMPWGSAIDIWNLAGLIWDLFEGQHLFGDIFDSR
FT                   GGHDPFRHLALMVALIGPPSTEFVRRSETTVQCFDLNGDWIAHQGAPVPSVSLESLETR
FT                   LTGEEKGQFLAFIKSMLKWMPEERKTAKQLLEHPFLL"
FT   gene            complement(975431..978052)
FT                   /locus_tag="ANIA_10893"
FT                   /old_locus_tag="AN10893.4"
FT                   /product="ferric-chelate reductase, putative
FT                   (AFU_orthologue; AFUA_4G03940)"
FT   mRNA            complement(join(975431..975732,975816..976883,
FT                   976931..977029,977092..977343,977400..977520,
FT                   977577..977827,977886..978052))
FT                   /locus_tag="ANIA_10893"
FT                   /old_locus_tag="AN10893.4"
FT                   /note="transcript_id=CADANIAT00000351"
FT   CDS             complement(join(975726..975732,975816..976883,
FT                   976931..977029,977092..977343,977400..977520,
FT                   977577..977827,977886..978052))
FT                   /locus_tag="ANIA_10893"
FT                   /old_locus_tag="AN10893.4"
FT                   /product="ferric-chelate reductase, putative
FT                   (AFU_orthologue; AFUA_4G03940)"
FT                   /note="transcript_id=CADANIAT00000351"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000351"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000351"
FT                   /db_xref="GOA:C8VDB9"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDB9"
FT                   /protein_id="CBF79055.1"
FT                   /translation="MNHMKIARHGSIDMDMEAHSGLPWLDSPVMLHSSRADMCKLTPEQ
FT                   CAYRRGHWRYWYEADHVYALNTVYFLCATVFVFAVAHLASRYAPARVRRSSLWQKGTAA
FT                   GRFLSYRGFRIPGVGYWAGSAGVAALIAVGAVFFFAMTLGPRPYYWPNTDTVNFGGSPP
FT                   IATRTGWMAVALLPFVLVLGTKANLVSALTGVPHERLQIFHHWTSYAMFVLALVHTFPF
FT                   IVYNISKGQMVSEWKGSVVYWTGVVALVAQAYLTFMSLPTIRNRYYEFFKATHFLIALL
FT                   FILFFFFHCDFRLTSWDYFIAAGSLYIFSLLTSLVRTHLINGRHTATLSVLPCGLLQLR
FT                   IPTILSWKPGQHVFIRFTGIQSVGLHSLTSHPFTICSTAHDIQSLKRANEMVFYVKPKK
FT                   GITGRLAKLASRKPGFTQTVLLEGPYGGIGMGALERSESVLIISGGSGGGFSLGILEAA
FT                   LKIFTESGCGCGAEKGERRRIQVVFACQRPDVAAWYRGEIELLLDLYGVKGSKYDLDID
FT                   VSIHVTSSMPSLRQDIETDIEKTLEPLPPSGPAEEPTQTETKTSTADDAINPVRSASTS
FT                   SSHKTPVSCVPRTFSQGRPKLPSIVASTTDTGKHVAIYVCGPASMLHDVRNAAAAAQEG
FT                   ILTGKAGGQVYLHSESFSW"
FT   gene            complement(978772..980460)
FT                   /locus_tag="ANIA_07113"
FT                   /old_locus_tag="AN7113.4"
FT                   /product="cysteine synthase B, putative (AFU_orthologue;
FT                   AFUA_4G03930)"
FT   mRNA            complement(join(978772..979317,979379..980208,
FT                   980268..980460))
FT                   /locus_tag="ANIA_07113"
FT                   /old_locus_tag="AN7113.4"
FT                   /note="transcript_id=CADANIAT00000352"
FT   CDS             complement(join(978772..979317,979379..980208,
FT                   980268..980460))
FT                   /locus_tag="ANIA_07113"
FT                   /old_locus_tag="AN7113.4"
FT                   /product="cysteine synthase B, putative (AFU_orthologue;
FT                   AFUA_4G03930)"
FT                   /note="transcript_id=CADANIAT00000352"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000352"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000352"
FT                   /db_xref="GOA:Q5AX67"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX67"
FT                   /protein_id="CBF79057.1"
FT                   /translation="MANLNGLNVYFGQDSLKKYFNPDEQPPLPLVELPEYLNPYYQDGV
FT                   RIYAKMMTMHPANNVKAMPAMNMLESNVVPGKTKTIIEYSSGSTVISMSMIARVMHGIG
FT                   DTRAYLSNKTSDAKLKLMQFFGLNISLFGGPSQPEPYDERGGIQSARRMATESDEILNP
FT                   NQYENDKNWQSHIRWTGPQIFKQLPEITVLCAGMGTSGTMTGLGTYFKQVKPTVLRLGV
FT                   CTAPGDRVPGPRSFALMKPVEFPWKEAVDVIEEVNSYDSFSLSLDLCREGIVCGPSSGF
FT                   NLQGLFQMLEKRKKEGTLSELAGPDGVTHCVFLCCDLPYQYIGEYFSRLGEDKFHPIKN
FT                   ENLARVDLYRYDESWERSPIVLFTHFYSSPTSHNLMDNLTLRPNTCVLDIRTAPDFAQW
FT                   HLPGSVNYPLKSLTSHTPKPFSNPAVLEAQWLELESLLNKESVLSKLGNQHVLVICYHG
FT                   DTARVATSVLRAQGIQADSLRGGYQALRDQGLWGDGGVEEIANRNGTGEKLPPAVSVAP
FT                   IELTH"
FT   gene            981112..983213
FT                   /locus_tag="ANIA_07112"
FT                   /old_locus_tag="AN7112.4"
FT                   /product="MFS drug transporter, putative (AFU_orthologue;
FT                   AFUA_4G03920)"
FT   mRNA            join(981112..981240,981298..981431,981528..982321,
FT                   982390..982579,982638..982703,982787..983213)
FT                   /locus_tag="ANIA_07112"
FT                   /old_locus_tag="AN7112.4"
FT                   /note="transcript_id=CADANIAT00000353"
FT   CDS             join(981112..981240,981298..981431,981528..982321,
FT                   982390..982579,982638..982703,982787..983213)
FT                   /locus_tag="ANIA_07112"
FT                   /old_locus_tag="AN7112.4"
FT                   /product="MFS drug transporter, putative (AFU_orthologue;
FT                   AFUA_4G03920)"
FT                   /note="transcript_id=CADANIAT00000353"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000353"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000353"
FT                   /db_xref="GOA:Q5AX68"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX68"
FT                   /protein_id="CBF79059.1"
FT                   /translation="MTTPAHQEPNDPSTVSVTASSPAPSHHVFNEQTNYVPKRTIITIF
FT                   LACSTVDLIALMDQTTLAASLSIIGNALHASDKAAWISGGYFVTSTCFQLLYGRLSDIW
FT                   SRKSVLFVGLAIFFIGSLASSLAQSGTQLIVFRAFTGVGGGGLMTVAQMIVSDVVPLRE
FT                   RGKYQGILGAVVAIANGIGPVIGGALSSVSADGWRWIFRLNLPLTAITTLSVFFFMPLR
FT                   KVQGDWRVKLKAIDFVGGGLALAGTAVLLLGLTWGGGEYPWQSSHVIATIVVGFAVCVL
FT                   FMLWQWKGAAYPLVPVHIFKSGIVNGACLTMFINGWNFLVQVYYIPSFYQLVFGYSAVR
FT                   AGAMLLPITLMQTASSTLSGLVVHWIGRYRECILFGWMIWAVGLGLFSTLDEHSGVGKQ
FT                   IGYGILTGVGVGNTLQPALIAIQAGVERRDMAVVTSFRNFVRNLGGTLGLAIAQTIINN
FT                   LILSSLSPVHLSPSEQKSFLASPTAYISTLPETEATHIRSLLIPAYKRGFRIIFIIGAA
FT                   LAALAFGIAFALMRQVGLEKGDDEKLKEEGRRRVELEKGMKGDAEKEGGDVHVDSNDEG
FT                   RRE"
FT   gene            complement(983388..986529)
FT                   /locus_tag="ANIA_07111"
FT                   /old_locus_tag="AN7111.4"
FT                   /product="peroxisomal multifunctional beta-oxidation
FT                   protein (MFP), putative (AFU_orthologue; AFUA_4G03900)"
FT   mRNA            complement(join(983388..984800,984850..985258,
FT                   985304..985691,985737..985826,985871..985979,
FT                   986029..986256,986324..986529))
FT                   /locus_tag="ANIA_07111"
FT                   /old_locus_tag="AN7111.4"
FT                   /note="transcript_id=CADANIAT00000354"
FT   CDS             complement(join(983469..984800,984850..985258,
FT                   985304..985691,985737..985826,985871..985979,
FT                   986029..986256,986324..986479))
FT                   /locus_tag="ANIA_07111"
FT                   /old_locus_tag="AN7111.4"
FT                   /product="peroxisomal multifunctional beta-oxidation
FT                   protein (MFP), putative (AFU_orthologue; AFUA_4G03900)"
FT                   /note="transcript_id=CADANIAT00000354"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000354"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000354"
FT                   /db_xref="GOA:C8VDC2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDC2"
FT                   /protein_id="CBF79061.1"
FT                   /translation="MSELRFDNQTVVVTGAGGGLGKAYALFFASRGANVVVNDLGGSHQ
FT                   GEGKSSKAADVVVDEIRAAGGKAVANYDSVENGDAIIDTAIKNFGRVDVLINNAGILRD
FT                   VSFKNMKDQDWDLINKVHTYGAYKCARAAWPHFRKQKYGRIINTASAAGLFGNFGQANY
FT                   AAAKLGQVGFTETLAKEGAKYNIIANVIAPIAASRMTATVMPPEVLELLKPEWVVPVVA
FT                   VLVHSSNTTESGSIFEIGGGHVAKLRWERSKGALLKTDASLTPGAIARKWNEVNDFSKP
FT                   DYPTGPADFMGLLEDGLKLPPAPSGPEPEFKGKVALVTGGGNGLGRAYCLLFGRLGAKV
FT                   VVNDLVDPEPVVQEIKKAGGEAVGNKASCEDGAAVVKTAIDTYGRIDILVNNAGILRDK
FT                   AFTNMNDDLWNPVVNIHLRGTYKVTQAAWPHMLKQKYGRIVNTASTSGIYGNFGQANYA
FT                   AAKLGILGFSRALAIEGAKYNIKVNTIAPNAGTNMTRTIMPEEMVQAFKPDYVAPLVVL
FT                   LCSDMTPEPYSTKGLFECGSGWFGSTRWQRSGGHGFPVDVKLTPEAVAKELAKIVNFDD
FT                   GRADHPEDIQAANEKVMSNFSNRSGGESGGSGNEILSAIEAAKKASTDGTSFDYTDRDV
FT                   ILYNLSLGAKRTDLPLVYENNEHFQALPTFAVIPWFNTATPWDMNDIVKNFSPMMLLHG
FT                   EQYMEIRKFPIPTEAKTKTYPKLIDVIDKGAAALVVAGYTTKDVATGEDLFYNESTVFI
FT                   RGSGGFGGSPKPTAPRPKAAVAAYKPPKRKADVVVEEKTSEDQAALYRLNGDRNPLHID
FT                   PEFSKVGGFKIPILHGLCSLGVSGKHVFQKFGPIKNLKVRFAGVVLPGQTLRTEMWKEG
FT                   NTVLFQTTVVETGKPAISGAGAELLEGAKAKL"
FT   gene            complement(987652..988281)
FT                   /locus_tag="ANIA_07110"
FT                   /old_locus_tag="AN7110.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(987652..988104,988162..988281))
FT                   /locus_tag="ANIA_07110"
FT                   /old_locus_tag="AN7110.4"
FT                   /note="transcript_id=CADANIAT00000355"
FT   CDS             complement(join(987652..988104,988162..988281))
FT                   /locus_tag="ANIA_07110"
FT                   /old_locus_tag="AN7110.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000355"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000355"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000355"
FT                   /db_xref="GOA:Q5AX70"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX70"
FT                   /protein_id="CBF79063.1"
FT                   /translation="MPAPNNTHSGHFHLLDSDGAIILMLGAVVFLTFALGMMCQLCEVP
FT                   ILFFIRRKQYWYEEDDDLDLEQGLGQTTLNHRMSDFEADTGTGRPTQPRVLDRGLQRAQ
FT                   QPESGHSSRPMTRYGSIQQHMIDVNGVRKLVLVVDIDKYGRESSEASPDEYAEWFERWR
FT                   QQQQRVAEVAVSEEPLDESAPLLGPWP"
FT   gene            989358..989996
FT                   /locus_tag="ANIA_07109"
FT                   /old_locus_tag="AN7109.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            989358..989996
FT                   /locus_tag="ANIA_07109"
FT                   /old_locus_tag="AN7109.4"
FT                   /note="transcript_id=CADANIAT00000356"
FT   CDS             989358..989996
FT                   /locus_tag="ANIA_07109"
FT                   /old_locus_tag="AN7109.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000356"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000356"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000356"
FT                   /db_xref="GOA:C8VDC4"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDC4"
FT                   /protein_id="CBF79065.1"
FT                   /translation="MPPSQKKEILPSHSLALLQSAVFHRFCFYHHRHIMDNLTFLLAAA
FT                   TGNTTAIEQGYLSNKSILTATNPDGRTALHLAALHGHIAVIQQLITYGATLSAKDSNGQ
FT                   TALHLAAQGSAPAPDIVGLLLQNDSGSACSIRDKNGKTAVFYAYHNPNDRVLAEFQKYA
FT                   PTCGSGCALTPSIILDTGVSDYFGTDAQVQVSASSGQRRTPTERTAIKS"
FT   gene            992042..993383
FT                   /locus_tag="ANIA_07108"
FT                   /old_locus_tag="AN7108.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(992042..992248,992310..992815,992886..992909,
FT                   992977..993092,993144..993383)
FT                   /locus_tag="ANIA_07108"
FT                   /old_locus_tag="AN7108.4"
FT                   /note="transcript_id=CADANIAT00000357"
FT   CDS             join(992093..992248,992310..992815,992886..992909,
FT                   992977..993092,993144..993307)
FT                   /locus_tag="ANIA_07108"
FT                   /old_locus_tag="AN7108.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000357"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000357"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000357"
FT                   /db_xref="GOA:C8VDC5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDC5"
FT                   /protein_id="CBF79067.1"
FT                   /translation="MPEIFDDKSQHCIPFLLQRLKAHQARHSNDPANTPPFFLGLNGVQ
FT                   GAGKTVLVSTLNSILRSPPYSLAVVTLSLDDLYLTHEDQVSLAKSNPTNPLLQHRGQPG
FT                   THDLPLAQSVFSALRAGRPTAIPQYDKSAFSGQGDRVPMEQWETVNVEGQEQIKVLIFE
FT                   GWSVGFRAWDDDILKQKWEDAVKRKEQDKEYRGRLGHVKFEDVRKVNEALRGYDVLTDQ
FT                   LDALIHIDAQDNHFVYEWRQEQERTLRATKGIGMTEEQVNRFVDGYYPSYELYSEALRA
FT                   GAFRPIPYSTTASASPEGWEGRQLRLVVDKGRKVQEVIKI"
FT   gene            complement(993720..995475)
FT                   /locus_tag="ANIA_07107"
FT                   /old_locus_tag="AN7107.4"
FT                   /product="60S ribosomal protein L7 (AFU_orthologue;
FT                   AFUA_4G03880)"
FT   mRNA            complement(join(993720..994329,994380..994546,
FT                   994731..994842,995411..995475))
FT                   /locus_tag="ANIA_07107"
FT                   /old_locus_tag="AN7107.4"
FT                   /note="transcript_id=CADANIAT00000358"
FT   CDS             complement(join(993870..994329,994380..994546,
FT                   994731..994842,995411..995427))
FT                   /locus_tag="ANIA_07107"
FT                   /old_locus_tag="AN7107.4"
FT                   /product="60S ribosomal protein L7 (AFU_orthologue;
FT                   AFUA_4G03880)"
FT                   /note="transcript_id=CADANIAT00000358"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000358"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000358"
FT                   /db_xref="GOA:C8VDC6"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDC6"
FT                   /protein_id="CBF79069.1"
FT                   /translation="MASTATTVPTQDQVLVPETLLKKRKSQEQARAAAREEAAKKKAAN
FT                   KEKRAVIFKRAESYVQEYRNAEREKIRLARVARQEGNFYVPEEPKLIFVVRIKGINKIA
FT                   PQPRKILQLLRLLQINNGTFVKLTKATQEMLTIINPYVAYGYPNLKSVRELIYKRGYGK
FT                   IDKQRVALTDNQIIEEHLGKYGIVCMEDLIHEIYTVGPNFKQANNFLWPFKLSNPTGGF
FT                   RTRKFKHYIQGGDTGNREENINALIRQMN"
FT   gene            995736..996592
FT                   /locus_tag="ANIA_07106"
FT                   /old_locus_tag="AN7106.4"
FT                   /product="ELL complex subunit Eap30, putative
FT                   (AFU_orthologue; AFUA_4G03870)"
FT   mRNA            join(995736..996211,996274..996592)
FT                   /locus_tag="ANIA_07106"
FT                   /old_locus_tag="AN7106.4"
FT                   /note="transcript_id=CADANIAT00000359"
FT   CDS             join(995736..996211,996274..996592)
FT                   /locus_tag="ANIA_07106"
FT                   /old_locus_tag="AN7106.4"
FT                   /product="ELL complex subunit Eap30, putative
FT                   (AFU_orthologue; AFUA_4G03870)"
FT                   /note="transcript_id=CADANIAT00000359"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000359"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000359"
FT                   /db_xref="GOA:Q5AX74"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016689"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX74"
FT                   /protein_id="CBF79070.1"
FT                   /translation="MASRRGVGLGAFANRTQATQSYANHGANLRSTHTSSLQTQLSVFQ
FT                   TLLHNFALEHSSTIKSNPTFRAEFARMCNAIGVDPLAASNVKGKNGRKALGDGSSFWTQ
FT                   IMGGDMNDFYFEVAVRVVELCRETRRENGGLIGVEECRKRVGKGRAIGSGLEVTDDDIL
FT                   RAVKALEPLGSGFSTILVGSKQYIRSIPKELNTDQATVLEVIQVLGYVSVSMLQINLNW
FT                   EKARAKTVMDDLLADGLVWVDLQSAEEEYWSPQNLVSDGDAG"
FT   gene            complement(996693..999857)
FT                   /locus_tag="ANIA_07105"
FT                   /old_locus_tag="AN7105.4"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit C (eIF3c)(Eukaryotic translation initiation factor
FT                   3 93 kDa subunit homolog)(eIF3 p93)(Translation initiation
FT                   factor eIF3, p93 subunit homolog)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AX75]"
FT   mRNA            complement(join(996693..999338,999438..999857))
FT                   /locus_tag="ANIA_07105"
FT                   /old_locus_tag="AN7105.4"
FT                   /note="transcript_id=CADANIAT00000360"
FT   CDS             complement(join(997090..999338,999438..999771))
FT                   /locus_tag="ANIA_07105"
FT                   /old_locus_tag="AN7105.4"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit C (eIF3c)(Eukaryotic translation initiation factor
FT                   3 93 kDa subunit homolog)(eIF3 p93)(Translation initiation
FT                   factor eIF3, p93 subunit homolog)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AX75]"
FT                   /note="transcript_id=CADANIAT00000360"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000360"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000360"
FT                   /db_xref="GOA:Q5AX75"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AX75"
FT                   /protein_id="CBF79072.1"
FT                   /translation="MSRFFYGNDSDSDSSGSDEEELYSDEEVEQSEEESSEEDASSEEE
FT                   SSEDEDAGKAGASRFMKDVSDSEESEEEDVVKVVKSAKNKRLEELESTIKLIDNAQKIN
FT                   DWAVISSEFDKMNRQVVKVLQSGPVPKIYVKTVADLEDFVNETVAKQKSSNKKMNASNA
FT                   KGFNAIKQKIKKNNKEYAAQIEKYRADKDSYMESDEEEEKKPAIAAPRLSKLERVEAPV
FT                   AVAGDDDGFETVVRGKTLQYTPESILKHLRVIVESRGKKNTDRLEQIKTMEKLLEVAQT
FT                   PYQRIRVYLTLISTRFDLSTTSTAAYMSVEQWKAAEQELSTLLSVLEKERNYVVSEGAE
FT                   EWEDDEKQPQVAAGETFYIPGSIVSYVERLDDELTRSLQHIDPHTAEYIERLSDEKQLY
FT                   TNLVRTQIYVEGLTKLEKTELRQDSLNRVVMRRLEHIYFKPSQVITILEEGTDKALPSE
FT                   LETSITTRGNSDAQTLVQTLCNYLFRNSDGILRARAMLAQIYFLALHDQYYRARDLMLM
FT                   SHLSENIANFDVSSQILFNRTLVQIGLCAFRAGLIYEAQNTLSEICGSGRQKELLAQGI
FT                   ILQRYSTVSPEQERLERQRQLPFHMHINLELLECIYLTSSMFLEVPLMAQTSSSPEMKR
FT                   RVISKTFRRMLDYNERQVFTGPAENTRDGVIMSAKFLAAGDWKKAAEMLNSIKIWDLMP
FT                   QPEKIKEMLSQQIQEEGLRTYLFTYAPFYDSLSISTLSTMFELSEKKIAAIISRMISHE
FT                   ELGAALDQVNDAIVFRKGVELSRLQSQIVTLADKSMNLLEANEKTLEQRTQGMANAFQR
FT                   DQGAGARGGRGPRGGGQARGGPRLPGGQQRRPGGQQFGGGALGGAIKA"
FT   gene            complement(1001185..1004457)
FT                   /locus_tag="ANIA_07104"
FT                   /old_locus_tag="AN7104.4"
FT                   /product="protein kinase Yak1, putative (AFU_orthologue;
FT                   AFUA_4G03850)"
FT   mRNA            complement(join(1001185..1002168,1002216..1002574,
FT                   1002629..1002748,1002803..1003062,1003116..1003275,
FT                   1003334..1003533,1003585..1003847,1003908..1004457))
FT                   /locus_tag="ANIA_07104"
FT                   /old_locus_tag="AN7104.4"
FT                   /note="transcript_id=CADANIAT00000361"
FT   CDS             complement(join(1001423..1002168,1002216..1002574,
FT                   1002629..1002748,1002803..1003062,1003116..1003275,
FT                   1003334..1003533,1003585..1003847,1003908..1004457))
FT                   /locus_tag="ANIA_07104"
FT                   /old_locus_tag="AN7104.4"
FT                   /product="protein kinase Yak1, putative (AFU_orthologue;
FT                   AFUA_4G03850)"
FT                   /note="transcript_id=CADANIAT00000361"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000361"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000361"
FT                   /db_xref="GOA:C8VDC9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDC9"
FT                   /protein_id="CBF79074.1"
FT                   /translation="MNSQWQPYKDPLVGRPAQFNNNGLTSNPNTQQLPSNYGGQSQSSQ
FT                   APAGYTYEPFQSPGIIAKPPSTKSASMASSPAATPHTRDYVTEQDAIMEDADPYNRAKY
FT                   PTRSNHQSRPSSQYFPSEGSTAARRYSPMNVLSPTLPYNSSPGKSGNTYAFPPATHPSR
FT                   QSPTRTPNYSSPPQPFQSPPSGSRPPRLPPLQPTDMSPDQFFGPSSGPQLSSPFAQDGW
FT                   SRTGSGAPQQPGRGPLPKFQKIKSIQDLKPRINAQPAYRRANPEGGFISPLQALTNHLP
FT                   ATYRICNPNFHYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNR
FT                   YLILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSRYDKN
FT                   DDHHLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSL
FT                   LNKAHLIHCDLKPENILLKNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGL
FT                   PYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQSGEFF
FT                   EKTQDEFGRKSYRLKSLEQYSREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMKQAEI
FT                   EREVNNRVAFIDFVRGLLSINPLERWSPQQAKLHPFITQQKFTGPFVPPMNLKYSSLNK
FT                   TLPPGIQQQQQAEAASKQRAAHAQSAAQSAYTMQMNQYHPSAHAQPPPPMYTGMYGGHQ
FT                   QPPPPYPTQPPAYGHQMNLMPGQMPQTQYGASQSLYAQATTRAGRQRASTMDPQGVPPT
FT                   IQRVASHLDPNAPIRLQPSPAYYPPPADGYADPNSANQRRRGSRVGGTRNRDFIRTLED
FT                   GVLGDGYMGQNQWH"
FT   gene            1006285..1010316
FT                   /locus_tag="ANIA_07103"
FT                   /old_locus_tag="AN7103.4"
FT                   /product="DNA repair protein Rhp26/Rad26, putative
FT                   (AFU_orthologue; AFUA_4G03840)"
FT   mRNA            join(1006285..1006446,1006495..1006568,1006622..1009911,
FT                   1010120..1010151,1010293..1010316)
FT                   /locus_tag="ANIA_07103"
FT                   /old_locus_tag="AN7103.4"
FT                   /note="transcript_id=CADANIAT00000362"
FT   CDS             join(1006285..1006446,1006495..1006568,1006622..1009911,
FT                   1010120..1010151,1010293..1010316)
FT                   /locus_tag="ANIA_07103"
FT                   /old_locus_tag="AN7103.4"
FT                   /product="DNA repair protein Rhp26/Rad26, putative
FT                   (AFU_orthologue; AFUA_4G03840)"
FT                   /note="transcript_id=CADANIAT00000362"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000362"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000362"
FT                   /db_xref="GOA:Q5AX77"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX77"
FT                   /protein_id="CBF79076.1"
FT                   /translation="MQGVGLEASKTSPPADESTSVQSSSGPADEATRLKELHADIRDQD
FT                   ALERDITRQADRLLMEQADERDNKRLDKTNQEKEKLESQILRLHQRLAQPIGTSARVRL
FT                   QNDLAKLEERNTALANDLKEIQQRIDERHQEQEMNMEPSGTGRMPNESRRDYLIRTGKI
FT                   TPFSRMGTGSSAGPLASLQDALIDAEDERDELEALEQVKARSAVSHRNLVRPSFGFDET
FT                   SESTAAEEQAHERPGKRRKLEKSTQSSKVSVKTEDTDLGMETLSDGPASEDQDDSASYI
FT                   EDPEQEFSEDDEDFVTEEKPVRAKKAKSSDEVEDFSGLDDGNEKLYQSRLQNWVSRRSA
FT                   ARKRARQPRELDTNQVPDIGEADFRDSEDEEWFKPHPTQPDLHLDNGYRIPGDIHPLLF
FT                   DYQKTGVQWMWELHQQQVGGIIGDEMGLGKTIQAIAFLAGLHYSKRLTKPIIVVCPATV
FT                   MKQWVNEFHRWWPPFRVSILHTSGSGMVNIKSESSREDALMYGTYWSGGSSSGLKAARK
FT                   VVKRVVEEGHVLVTTYSGLQSYASLLIPVEWGGTILDEGHKIRNPNTSITMHAKELRTP
FT                   HRIILSGTPMQNNLTELWSLFDFVFPMRLGTLVNFRNQFEFPIRQGGYANASNLQVQTA
FT                   AKCAETLKDAISPYLLQRFKIDVAADLPKKSEQVLFCRLTKPQRQAYEAFLGSEEMQSI
FT                   LRGRRQVLYGVDILRKICNHPDLQNHKLLYAKPNYGNPTKSGKMQVVRSLLELWKETGH
FT                   KTLLFAQHRIMLDILEKFVKSLSGFNYRRMDGTTPIQHRQTMVDEFNKDPDLHVFLLTT
FT                   KVGGLGVNLTGADRVIIYDPDWNPSTDVQARERAWRLGQKRDVTIYRLMTAGTIEEKIY
FT                   HRQIFKQFLTNKILKDPKQRQTFQLSDLYDLFALGEEGQGPTETSKLFKEAEVTYEENR
FT                   DKDAPKERDASYQRDVEAEKQDISKVTGVAAIEQFQGEPEQQAKQESGESGTNSESRLM
FT                   EGIFARSGVHSALEHDQIVNGKRVVRADPKIIEAEAKRVAAEAAEQLRRAGEAAKSVPI
FT                   GTPTWTGQFGVAGKPEESPMPMRGPFGGRSSTARRALAGPSSASIIANLSSRTPSSRSA
FT                   TNSPAPGNEPSGKDFITMIRDFITTHGGSVYTQNLIDHFNRYCTTPQKSAEFKEMLKQI
FT                   AVLDKGGRNAFDLYSTPADFWTRDNSF"
FT   gene            1011167..1012160
FT                   /locus_tag="ANIA_07102"
FT                   /old_locus_tag="AN7102.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1011167..1011534,1011591..1011695,1011763..1012160)
FT                   /locus_tag="ANIA_07102"
FT                   /old_locus_tag="AN7102.4"
FT                   /note="transcript_id=CADANIAT00000363"
FT   CDS             join(1011234..1011534,1011591..1011695,1011763..1011875)
FT                   /locus_tag="ANIA_07102"
FT                   /old_locus_tag="AN7102.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000363"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000363"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000363"
FT                   /db_xref="GOA:Q5AX78"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX78"
FT                   /protein_id="CBF79078.1"
FT                   /translation="MKLFNTLSLLLGAAATTVFAGRQDGKNPDTFYLKTSGAENSAHND
FT                   LYVYGYHAGAGINDAVLTPDIETASRAYLNGTKVLFDYNTTFPWGLSPWGVTNYAAWQF
FT                   VQINAGTGQDGFSVNSTGLQWSQQKGFGGWLVCDWWHNAPQLFYLYRYYDAEYPASCSE
FT                   VKLVTEPTA"
FT   gene            1012651..1013986
FT                   /locus_tag="ANIA_07101"
FT                   /old_locus_tag="AN7101.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1012651..1013126,1013182..1013799,1013850..1013986)
FT                   /locus_tag="ANIA_07101"
FT                   /old_locus_tag="AN7101.4"
FT                   /note="transcript_id=CADANIAT00000364"
FT   CDS             join(1013012..1013126,1013182..1013799,1013850..1013986)
FT                   /locus_tag="ANIA_07101"
FT                   /old_locus_tag="AN7101.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000364"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000364"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000364"
FT                   /db_xref="GOA:Q5AX79"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX79"
FT                   /protein_id="CBF79080.1"
FT                   /translation="MRFTALFPIACLLLLAMLSTAWQFDGLLGHGQLLPRQDDSDSNSD
FT                   TTTAADSATTGATPTDDQAEETATSTSSSDSDSDTTESATTTAKATKTGSSSSNSTTTH
FT                   ASNSTTTSVDPRLPPGGISMLTPSSASTTYYKIGDIITFVWNYTSLSITPTAVNVVASC
FT                   SLNSATYTISSNMSVEETQTVTWDTGKFQANATAPLLTATYTMIVYDESKDIDDTASAG
FT                   ELSSQNRYYFGMYTPQPYTDLPNFVCATCNGALSATGLLGLKMALGMGLITIASFTWFA
FT                   GSFGVFST"
FT   gene            complement(1015966..1017260)
FT                   /locus_tag="ANIA_10892"
FT                   /old_locus_tag="AN10892.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1015966..1016130,1016178..1016831,
FT                   1016891..1017260))
FT                   /locus_tag="ANIA_10892"
FT                   /old_locus_tag="AN10892.4"
FT                   /note="transcript_id=CADANIAT00000365"
FT   CDS             complement(join(1015966..1016130,1016178..1016831,
FT                   1016891..1017124))
FT                   /locus_tag="ANIA_10892"
FT                   /old_locus_tag="AN10892.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000365"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000365"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000365"
FT                   /db_xref="GOA:C8VDD3"
FT                   /db_xref="InterPro:IPR021627"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDD3"
FT                   /protein_id="CBF79081.1"
FT                   /translation="MAASSRLPIVVPKMEHSPSVKVNELEIDKDTTMAEPNPTAAPSAA
FT                   PEDDVDPVIDPELLETELQLVSSLAKLQKLEEMIHQLRTLLPERLLEPLAPIVHPKAAA
FT                   AIGIPNSPQALHQRLSQSACDGVREVEDFKALWRSEEMKAVWERIDTLINENAGRLLQS
FT                   NGMWQCDYNQILQDIAQHDNHRKEQQRKAKEEQERAQLQSAEGGWKAIVDNYAQAGIPG
FT                   MRVIPTKSDSSFGVLLPKVGLAFKVNAVSSGQEGVPEFNVSSKSPSGEPSSRVETAVLA
FT                   CLNARPRKWDLKFLFGMISSYSNIFQTTCTRCGKMQDQAANLPTLRRPKTKEPQTDQPP
FT                   TFEAYHATCI"
FT   gene            complement(1017501..1018263)
FT                   /locus_tag="ANIA_10896"
FT                   /old_locus_tag="AN10896.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1017501..1018058,1018111..1018263))
FT                   /locus_tag="ANIA_10896"
FT                   /old_locus_tag="AN10896.4"
FT                   /note="transcript_id=CADANIAT00000366"
FT   CDS             complement(join(1017501..1018058,1018111..1018263))
FT                   /locus_tag="ANIA_10896"
FT                   /old_locus_tag="AN10896.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000366"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000366"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000366"
FT                   /db_xref="GOA:C8VDD4"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDD4"
FT                   /protein_id="CBF79083.1"
FT                   /translation="MAGSKFLVLGGTGPAGICLLRELVYRQHETIVYARNPSKIDGDIQ
FT                   SNEFLEIIKGEFVEDDLPTLSAAMARTKVVISLLGPNIIRMSNPTLFADIYKTFVFPLM
FT                   REHGVRRIFAMGTPSISRPQDSWTLFTAVVIPIIRIFAHSAYANVRAIGDAFEQHADGL
FT                   DWTVFRIAAIPGNHDEESWRTDREDADVFVGWVGEKGWTPSQKRGALARWLVDAAEGGA
FT                   DKWVGKMPAVSKKG"
FT   gene            complement(1019804..1022540)
FT                   /locus_tag="ANIA_07099"
FT                   /old_locus_tag="AN7099.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1019804..1022103,1022165..1022540))
FT                   /locus_tag="ANIA_07099"
FT                   /old_locus_tag="AN7099.4"
FT                   /note="transcript_id=CADANIAT00000367"
FT   CDS             complement(join(1019804..1022103,1022165..1022540))
FT                   /locus_tag="ANIA_07099"
FT                   /old_locus_tag="AN7099.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000367"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000367"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000367"
FT                   /db_xref="GOA:Q5AX81"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX81"
FT                   /protein_id="CBF79085.1"
FT                   /translation="MNSIKARFKRMSIGRTGKDPNTSGKTDAAASAERTPDEGRKNAPA
FT                   NSNAANVDSGLAAARMFLKDEREGSLVFTVQVATAYRPCIAVDVHRFGEKQGDGPYGKP
FT                   AGLTKMSRAEHGFVEAEHPSFELYRIQRKYLRRHSESPNELDEEDCILFDPEASPLYDH
FT                   AHANGTVTVEGFGLDLWNAELAHGRMPQQAHPNILLEVPELTFNPATLLCRIEEIRSRT
FT                   VPADDPQEEIAALVETVGKVAWESITGSWEMQGMGHSERVLEFLFAFHHEQEDLSGRSV
FT                   IADTMTRFQDGSYEGAWADWMRMVMARELALRLASGAGMGMQWAGGTKGIYVRFTRAIL
FT                   ASLIISERWFANTRIHVGGHVALAREVQDAKSAGVSEQDRQEAWELVRLAEEATEAKQF
FT                   QRAAVLFYEALAVNPANYDSVQARGEWLLRFQNYRDAARDAVVLQRLDPNRPAGYVLLG
FT                   RACLGYKNYLRAREAFREAVALAHTFDEKLPILQDLDKAQDALSAELKAIEQAASEKEK
FT                   AALMRARRIADLDPMGRTIAPRPAKHEQQLEGLFLFAERMQWPYLEAVRRCAKKACEDW
FT                   LALHEPVYPVQMDWLFAVMLPGKHFAHVLMAMLILSTPAFQSVGMAPDSECGLALPECS
FT                   YWRSRSVLGRVLGCLPGVTSLNGWVGPCPTATLHTQVDEEAPAAHCLITTVAFNPASAM
FT                   LPPPSAESTRDIVIAGNPDLAPLWRVTNQPEILNLPPPQRDTAAWEIRSLDLRRAYRSH
FT                   QFERGGTWLWSASLAFRQPGTGKEVNFALEHTPVFITLPPCSLSGQARGHKIHRRQFDY
FT                   YRFRNVSMDEIAEVTPESVEEEIIVINASAPGAEVVARAWCAHVARAAVVRRAGGPCFC
FT                   CTVKGAGRLGLRVGVVIWVS"
FT   gene            1023277..1024857
FT                   /locus_tag="ANIA_07098"
FT                   /old_locus_tag="AN7098.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1023277..1023381,1023427..1023474,1023743..1023915,
FT                   1024014..1024258,1024355..1024857)
FT                   /locus_tag="ANIA_07098"
FT                   /old_locus_tag="AN7098.4"
FT                   /note="transcript_id=CADANIAT00000368"
FT   CDS             join(1023277..1023381,1023427..1023474,1023743..1023915,
FT                   1024014..1024258,1024355..1024857)
FT                   /locus_tag="ANIA_07098"
FT                   /old_locus_tag="AN7098.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000368"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000368"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000368"
FT                   /db_xref="GOA:Q5AX82"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX82"
FT                   /protein_id="CBF79086.1"
FT                   /translation="MTEPGPLWSWRCRWSGRLLGRRRKGYWQAVGANTQMSLWATSSWT
FT                   LSSLGEALYARHVHIPRTSGSDVRAASKYRFPAARSWATHPIAATTGAKHVWHEGAKRP
FT                   DKMVKTSAMESSYRGGHCRKSSSRCTGMIPDPERPGADWISSAWATRLPQTEPSQGHAV
FT                   LSTLTGGARTRRTAGPRRASRIQPGDSAHLVGRGRRHDLNDTWPPSMHGTGSEDFFSQG
FT                   WGMQKNAYPFCGAIHEEDVPNTQVSYRWHLADPVRFSKKIKVTLESGHANHLRGYWSTS
FT                   AYWYQTLPGPKLDILPVGDRLPPKPTMHLIPEPTEVKIASMSAEKMGKLAQHRERYAVF
FT                   VNDWNEWLERRARESER"
FT   gene            1025475..1027956
FT                   /locus_tag="ANIA_07097"
FT                   /old_locus_tag="AN7097.4"
FT                   /product="MFS alpha-glucoside transporter, putative
FT                   (AFU_orthologue; AFUA_5G00500)"
FT   mRNA            join(1025475..1025541,1025778..1026014,1026063..1026218,
FT                   1026337..1026898,1026933..1026939,1026998..1027135,
FT                   1027169..1027291,1027345..1027476,1027721..1027807,
FT                   1027945..1027956)
FT                   /locus_tag="ANIA_07097"
FT                   /old_locus_tag="AN7097.4"
FT                   /note="transcript_id=CADANIAT00000369"
FT   CDS             join(1025475..1025541,1025778..1026014,1026063..1026218,
FT                   1026337..1026898,1026933..1026939,1026998..1027135,
FT                   1027169..1027291,1027345..1027476,1027721..1027807,
FT                   1027945..1027956)
FT                   /locus_tag="ANIA_07097"
FT                   /old_locus_tag="AN7097.4"
FT                   /product="MFS alpha-glucoside transporter, putative
FT                   (AFU_orthologue; AFUA_5G00500)"
FT                   /note="transcript_id=CADANIAT00000369"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000369"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000369"
FT                   /db_xref="GOA:Q5AX83"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX83"
FT                   /protein_id="CBF79088.1"
FT                   /translation="MPNTVDTHMDGYGSLKSPWCPPKTVWTSATGQFVYCSGPLPVGVE
FT                   FNHRACEIVSTFIYAPLLWKHGRKSGILVASAISVAGLLQQLATHWRVHLTGRGGNGNA
FT                   IGMMFTISPLWTGETCRPELRGFFLCFFNTSIVLGQFAMFVFILAVPVNCNGGYQSSGC
FT                   ISFQVISHPAATAQQLTFPAIPRPAGSSSPSLRTGSFETERHRKPGGSLQRVYGSKNEA
FT                   FYGVEVRRIESENHQALAIQASLAQFSRHTFLGLDLWPKLSASTARAASAPNGHLRRQW
FT                   PANDRRDFVIGYTTYFLDLIGVKDYFDASIILYVLMLLDSMAAFPLTEIIGRRTMIVVP
FT                   QFWAIIYQLSIGSVGFILASESLRSTTHGLVTITNAAWGLIMQFTIPYMTPKSPGLQIQ
FT                   TQEISAPGWVHLPRNGSHRSRRWMYLYPETKGISFEAMDELYASGTMPRHFRAPSEQRR
FT                   GGSSETKTEPPVHVEELPSYLSMVIWPSYTERPPDVECKNQGRYIGTE"
FT   gene            complement(1028396..1030220)
FT                   /locus_tag="ANIA_10891"
FT                   /old_locus_tag="AN10891.4"
FT                   /product="Putative hexose transporter
FT                   [Source:UniProtKB/TrEMBL;Acc:Q2WBH1]"
FT   mRNA            complement(join(1028396..1028816,1028891..1029674,
FT                   1029736..1030040,1030123..1030220))
FT                   /locus_tag="ANIA_10891"
FT                   /old_locus_tag="AN10891.4"
FT                   /note="transcript_id=CADANIAT00000370"
FT   CDS             complement(join(1028396..1028816,1028891..1029674,
FT                   1029736..1030040,1030123..1030220))
FT                   /locus_tag="ANIA_10891"
FT                   /old_locus_tag="AN10891.4"
FT                   /product="Putative hexose transporter
FT                   [Source:UniProtKB/TrEMBL;Acc:Q2WBH1]"
FT                   /note="transcript_id=CADANIAT00000370"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000370"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000370"
FT                   /db_xref="GOA:C8VDD8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDD8"
FT                   /protein_id="CBF79090.1"
FT                   /translation="MGILFKKPEGTEGKAWPAILISGFVAFGGILFGGILAMPYWAQTF
FT                   STGYRDSTGQLNVTSSQSSAIVSILSAGTFFGALGAAPVGDIIGRRWGLIASNGVFVLG
FT                   VVLQTIATSIPPFLAGRFFAGLGVGLISALVPLYQSETAPKWIRGFIVGSYQFSITIGL
FT                   LLASVLNNATHHRNDSGSYRIPIAVQFAWSIILVGGMLILPETPRYLIKRDDTKAAALS
FT                   LSKLRRLPQDHESIRQELSEIQANHQFEVSLGKSGYAECFRGSLLKRLLTGCGLQALQQ
FT                   LTGINFIFYYGTQFFKNSGFKNEFVITLITNCVNVGSTIPGLYAIDKWGRRPVLLTGAI
FT                   GMAVSQLLVAVLGTTTTGQDAQGNIIVHNAAAQKAAIAFICLYIFFFAASWGPIAWVVT
FT                   GEIFPLKTRAKSLSMTTATNWLLNWALSFATPYLVNYGDGNANLQSKIFFIWFGCCFLC
FT                   IGFVYFMIYETKGLTLEEVDELYLEVKSARESVSWSPKGTFARVAEKGNGSAGILERTE
FT                   KGDVGGHREIGAPDGVSV"
FT   gene            complement(1030647..1032699)
FT                   /locus_tag="ANIA_10897"
FT                   /old_locus_tag="AN10897.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1030647..1030845,1030921..1032087,
FT                   1032168..1032470,1032524..1032699))
FT                   /locus_tag="ANIA_10897"
FT                   /old_locus_tag="AN10897.4"
FT                   /note="transcript_id=CADANIAT00010520"
FT   CDS             complement(join(1030647..1030845,1030921..1032087,
FT                   1032168..1032470,1032524..1032699))
FT                   /locus_tag="ANIA_10897"
FT                   /old_locus_tag="AN10897.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010520"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010520"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010520"
FT                   /db_xref="GOA:C8VDD9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDD9"
FT                   /protein_id="CBF79092.1"
FT                   /translation="MDPHSLPAHDTRRRRNALACNTCRRRRTKCDGKRPKCSFCVERGK
FT                   DCFYQEPQDLPPSPLKAELSRIWEQLDHIAAIVQGRNPRSSPSPNEQQSHAPLTAPGAP
FT                   QGFPFMTVQSEAFLILLGLDKYLPMHLEHVERGRQIISAKPSLESIVMVDLADASVLLH
FT                   AFTEQIYIWYPILHADFTNEFLEAVTSCFPFSLSSCLTLLVLAIGCVVKCESIVDALQA
FT                   RPEAAYIQAASAMLPCVLADSSPRSAQCLLLFSIYHLCYAQPCQAHDFVVMASRKMQNY
FT                   MLKCVERVPGRVSRTGDDVLTSASRSEPDIGNDTTIIGNCFWIALLIERYPDLRAKKSN
FT                   LDKLTICSELRVQLDFVDSGIWNMALFAPAPTASSIWTWRELTPSLDSPGSFTSNESVD
FT                   LSRSDDLSYFVAEIAMRKMLQRCTWATSTLAQGRHVYAPIVAVELERQLDEWLQLLPEP
FT                   LSFRGRGSTCIGSRPLRNSDSAQVEFLRAQYYAFKASIYWPAVYEALLSSETDGNLIRH
FT                   CAKFFSSYAEFVPSAAAAVAVCKPNLWTLCASVFTFSMATLLALTEPCLAEVVPQGVYL
FT                   GLEVAVNVFDGLAEVSPSLAEMGAILRDRVRLCNSSLP"
FT   gene            complement(1033515..1035396)
FT                   /locus_tag="ANIA_10898"
FT                   /old_locus_tag="AN10898.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1033515..1033524,1033617..1033636,
FT                   1033866..1033973,1034054..1034315,1034336..1034625,
FT                   1034686..1035396))
FT                   /locus_tag="ANIA_10898"
FT                   /old_locus_tag="AN10898.4"
FT                   /note="transcript_id=CADANIAT00000371"
FT   CDS             complement(join(1033515..1033524,1033617..1033636,
FT                   1033866..1033973,1034054..1034315,1034336..1034625,
FT                   1034686..1035396))
FT                   /locus_tag="ANIA_10898"
FT                   /old_locus_tag="AN10898.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000371"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000371"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000371"
FT                   /db_xref="GOA:C8VDE0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDE0"
FT                   /protein_id="CBF79093.1"
FT                   /translation="MYWDLGVLLVHCRCGLAGHAATGPLCLRASIGSELRFEAIGSDVV
FT                   SLDVSFRLLDKLQSEGARLAIAEQALHSASGFRSVCPAIPDFSSTLSTSGRKTFSLFQR
FT                   VCGTSPWGIAERVWPPSPCAPREKGSDLYIPSETRSKAHASPLVTLAAGSQYRHIICDN
FT                   STMTSSINSRPAAGAVAHSSLARRTVGRPDDDPAALVLEAWSQGLMTGSLVIMAAVTFA
FT                   NMRPGVLLHKLILLELILAMAHGTFIFAPEPVYGWYLASTAIGLIISWSLHNVIAWMKN
FT                   RPFMGRKLSLFYVGTIVLAQPYWVAEIYANFAYFNNINLTVYQKIRPWEALFRLISMTV
FT                   TASANHGWTSDPWWIYTTCNIFWVVKTHYNFGILELVRECPRFGLMLASMCLSIVFIVL
FT                   DVISVTGALDAAMPLGINPFWKLCFTFKCLCDTIILDDFKTALDKLSARWLARNGMNGA
FT                   TAPLSAIE"
FT   gene            1035744..1037779
FT                   /locus_tag="ANIA_07095"
FT                   /old_locus_tag="AN7095.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1035744..1037142,1037244..1037779)
FT                   /locus_tag="ANIA_07095"
FT                   /old_locus_tag="AN7095.4"
FT                   /note="transcript_id=CADANIAT00000372"
FT   CDS             join(1035744..1037142,1037244..1037779)
FT                   /locus_tag="ANIA_07095"
FT                   /old_locus_tag="AN7095.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000372"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000372"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000372"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX85"
FT                   /protein_id="CBF79095.1"
FT                   /translation="MEVDISPPGGTRPATPLLGENSDPPSGPTTPTPLPRNSLKRRALF
FT                   SPQKTPTAAPVPVSHTPQAPSICEQVGMVADDQLALLHDWKLAMTSLAKALDLTVSSLQ
FT                   GRPRDLARELAARFVTLAKQDSPQQISQMPVVAPPQPPRQMEQPNHPPTPEASKSPLNR
FT                   QTSQPTTWASLTAPRTGQGNWQTIAPEHHMQAKQTAQRRLKQSNKTDHRIFLRLPASSS
FT                   LRAIGPHGIRVTLAGKVPVGITQVQVISTGYAITTTEQGKAFLLSEKAASLAGDGYFEI
FT                   PTEYHQVIVSRIPKQLWSLDGWIDTTIADISMEAERITGIKPLMAKLSKHPVERDSITA
FT                   VIAFPKKLQHPLQLFGLSGLSRPTRPKQRPLQCTRCYRFHDTRACRSSDRCISCGSSKQ
FT                   DHNCHVQCINCCGPHAADFPKCPARPHVQRNIITRLSKDALAAIRKAGRLAFQQEQKKA
FT                   ESSKQQADRRGGAAHDLLLSFEADIILVQEPWTNTAKHLTKTHPRYQLFSPPTRWTARP
FT                   RTLTYVRRDLPAHSLPEPISPDITTIYTAGLTIINVYRPPNDPVAPAGAGSTPSTLSTL
FT                   LGYTPPENTILAGDFNTRHPFWQPDTESHAVTPGATGLLDWLDAHELELRLEPGTPTRG
FT                   PNIPRPSLL"
FT   gene            1039438..1040788
FT                   /locus_tag="ANIA_07094"
FT                   /old_locus_tag="AN7094.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1039438..1039668,1039873..1040073,1040216..1040788)
FT                   /locus_tag="ANIA_07094"
FT                   /old_locus_tag="AN7094.4"
FT                   /note="transcript_id=CADANIAT00000373"
FT   CDS             join(1039438..1039668,1039873..1040073,1040216..1040788)
FT                   /locus_tag="ANIA_07094"
FT                   /old_locus_tag="AN7094.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000373"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000373"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000373"
FT                   /db_xref="GOA:Q5AX86"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX86"
FT                   /protein_id="CBF79097.1"
FT                   /translation="MRAAVIQCVLPTALYGAEVFYTGKRQQWVVNSLLSLFRTAALAII
FT                   PAYKTTPTAALLREADLPDPEALFNSILRRAAISVYSDGSRTSQGAGYGYAIYFGPILV
FT                   SKGHGPAGPRTEVYDAEIMGAVEGLHAALGQPCVGYSTQLKPLQVCWIPGHSGIAGNKL
FT                   ADKLAKLGSSIYSPDIPPSPAYLQQEAKQWLCTETYTAYANKAPETYKALNIRPHTKES
FT                   RSREHKLPWWVLGRLVAACTGHRDFTAYHQYFDYTDYLESCTCGKAKTPVHFFFCPYTR
FT                   KCWKDRWRCIKDGPSKTIDWLLSTAAGAEEFSRIVQESSFFKDICLNWARRSA"
FT   gene            1041225..1042671
FT                   /locus_tag="ANIA_07093"
FT                   /old_locus_tag="AN7093.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1041225..1041537,1041831..1042173,1042290..1042671)
FT                   /locus_tag="ANIA_07093"
FT                   /old_locus_tag="AN7093.4"
FT                   /note="transcript_id=CADANIAT00000374"
FT   CDS             join(1041225..1041537,1041831..1042173,1042290..1042671)
FT                   /locus_tag="ANIA_07093"
FT                   /old_locus_tag="AN7093.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000374"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000374"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000374"
FT                   /db_xref="GOA:C8VDE3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDE3"
FT                   /protein_id="CBF79099.1"
FT                   /translation="MEDSSQPETERTALGAQIPPLRFQNMHALQTPMHRILPTPSHPLL
FT                   QKLRFHSEWRQRWTRGGSRTESEQLEGGAETAEETEHGQTEEKEEHEDNNGREEEEEEE
FT                   TLLVAGCSSNRMRAIYLLELSYQHDHREPGGEYRLSALNPSFYAMVSNLSSAGDLTIRV
FT                   GYFGLCAAANSSGTTNWACRSTARDLGAQISTISDPLNILAIADNFRDEIILSVIIIMA
FT                   IVLIFLSFSALSTFPGRYTDVDASGDEFEIKLLPATEVVYLVLSFDVLASLVLIVAVLW
FT                   QHVAVVAHAATAEAAFGGAIKGDVGAVAMGLGWGAIGAVLLVTFGIAIQKLSRGELRLI
FT                   TDEED"
FT   gene            complement(1046780..1049121)
FT                   /locus_tag="ANIA_07092"
FT                   /old_locus_tag="AN7092.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1046780..1046827,1046912..1047678,
FT                   1047724..1047780,1047843..1048246,1048325..1048446,
FT                   1048491..1048827,1048880..1049121))
FT                   /locus_tag="ANIA_07092"
FT                   /old_locus_tag="AN7092.4"
FT                   /note="transcript_id=CADANIAT00000375"
FT   CDS             complement(join(1046780..1046827,1046912..1047678,
FT                   1047724..1047780,1047843..1048246,1048325..1048446,
FT                   1048491..1048827,1048880..1049121))
FT                   /locus_tag="ANIA_07092"
FT                   /old_locus_tag="AN7092.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000375"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000375"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000375"
FT                   /db_xref="GOA:Q5AX88"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX88"
FT                   /protein_id="CBF79101.1"
FT                   /translation="MSQVTDRPARHGLGNLVDGYVRRKLRRDIHPALDALRDHGNAPAG
FT                   NSQVIASRSSVRGEDKESMEISQSTPSPDNKDDYDLDELYRDAMLEKDRFQEALEAYEQ
FT                   TTAGSNFKTCVTSTSLHTWEEVLDEVNRAAETYHSRAAVWGKIRAGLRRLGDNSKVFEA
FT                   WAALLPSGSDCATVISGGLKLILTVCGSHEAAARLSDLRKEISDVLVEIPSRLTCIHQA
FT                   LNIFKGSKDLHSMSNSQPNRMVKQLTADLGEKLGLSLLLQGSYEQNMDSLLQNLRAESE
FT                   RFDKAARLCSYGAIEETRLISIKNEQILSGYVDQSMTRWDNFETELRSNQASTLDGYHT
FT                   LQHQVSDLHAIMERFLGSHDAVDPGTLNVRGPMLPSDKAAINRRSQQMYLRSRDYAFSA
FT                   LNYDPSVLEKDLAANLHNVWHLPLPYQNRLLATMQTPKLHSWITTRCSSALFLNLNTPA
FT                   VSPLHASSSFLPAKLVQSINEQPSENIITLAFFCGAHTRRNDPHSGPHGTMRSLVAQLL
FT                   ESHPGFDLQTVRRIAQLRGGDVHGLCEIFHELVAQLPADVVVFCVVDGVTVFEERMGLR
FT                   ESGEEVVKALVRTVQECTQKKPVGEKSVFKLLLTSSRNSRRLWRLIPGEVGDVVWMPDA
FT                   VPSLGGFTVRQTIQRHNRAICVY"
FT   gene            1049735..1052675
FT                   /locus_tag="ANIA_07091"
FT                   /old_locus_tag="AN7091.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1049735..1050452,1050485..1050957,1051022..1051817,
FT                   1051873..1052675)
FT                   /locus_tag="ANIA_07091"
FT                   /old_locus_tag="AN7091.4"
FT                   /note="transcript_id=CADANIAT00000376"
FT   CDS             join(1050263..1050452,1050485..1050957,1051022..1051817,
FT                   1051873..1052675)
FT                   /locus_tag="ANIA_07091"
FT                   /old_locus_tag="AN7091.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000376"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000376"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000376"
FT                   /db_xref="GOA:C8VDE5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDE5"
FT                   /protein_id="CBF79103.1"
FT                   /translation="MIPSTKIEDIERTRAMAAQLRRERDELRCLVEFMDHDMRDIFEIK
FT                   RAIQANTLREIRLSTSGNFQDDDSRRQAFRVLHVTGGRVCFDTKKLSYFDPVNYRVWDS
FT                   ESEDERRCRDAVRRSSAQMTNFIIDCFYLESDGVRLAPRPKRFAITPYSGKRPIASLPL
FT                   RPLQFDPQKEVLEKQLVARGARFMEVAQGKHMEYHGNTIEESKNSQYRHRNHRIEAFEV
FT                   HGEVVVDQEAGVTHFQDTLPAFSLGTGGGIVLTHTEPDSREVSDFFPQKSDGDWVTDVF
FT                   NDAAFEEYRHSEYFTTTDLLTSRPVKDIQLSDDQLLLLPPRVYGYSLLDRRWVALNVSL
FT                   LQEISIHDKQARSKLEELVLPTEHKRVLQALITNQVRLPHGGSNHVQEQLSMDVVSAKG
FT                   KGLIILLHGAPGVGKTSTAECIAIELNRPLLSITCGHIGTVAEEAEKNLDSFCKLAHRW
FT                   RCVLLLDEADVFLAKRERGDIARNSLVSVFLRVLEYFSGVIILTTNRVGEFDEAFRSRI
FT                   HVCLYYPKLEERQTKEIWEKNIQRVKESNLNLDMEEKKIRRFADQHWQRNLDRPTRRWN
FT                   GRQIKNAFQTAIALANWEFYDEKNVAKLERPLLKAKHFQYVAKITAHFDDYISDIYGTF
FT                   DEDTYSFLAARDALRVDEASAMFASRSTTQENSRASKSGIVRRGTDFRSPPANPGKPQG
FT                   SNFGRYSSDDDESTDEEESEESEADNEEDDQADEVKKLELQLQLAKLKNKKASSRGSKR
FT                   "
FT   gene            complement(1052875..1053828)
FT                   /locus_tag="ANIA_07090"
FT                   /old_locus_tag="AN7090.4"
FT                   /product="nonribosomal peptide synthase GliP-like, putative
FT                   (AFU_orthologue; AFUA_3G12920)"
FT   mRNA            complement(join(1052875..1053371,1053552..1053828))
FT                   /locus_tag="ANIA_07090"
FT                   /old_locus_tag="AN7090.4"
FT                   /note="transcript_id=CADANIAT00000377"
FT   CDS             complement(join(1052875..1053371,1053552..1053828))
FT                   /locus_tag="ANIA_07090"
FT                   /old_locus_tag="AN7090.4"
FT                   /product="nonribosomal peptide synthase GliP-like, putative
FT                   (AFU_orthologue; AFUA_3G12920)"
FT                   /note="transcript_id=CADANIAT00000377"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000377"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000377"
FT                   /db_xref="GOA:Q5AX90"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX90"
FT                   /protein_id="CBF79105.1"
FT                   /translation="MIVGEKAQNAVQALESLKSRFEIKEAPEFKRYLGMNIKTTPTGIH
FT                   LSQEDQIDDIINSFGLHDAHPTKSPLDPGTVIDDAPDLKINIKEYQRANIEPPKAFSDS
FT                   DWGGPHTKARRSVGGYVFKLAGGPIAWQSKRQTCVATSSNEAEYIAASEASREAYWIRE
FT                   IMKDLRLFDDQHAPGIPLHMDNKGAIDLTMSDIQTKRSKHIDIRYHYTRDMVDQGIIHI
FT                   KQIPTAEMVADGCTKPLGSEAHSHFIRLLGLRNDD"
FT   misc_feature    1054287..1159455
FT                   /note="contig 1.118 712..105880(-1)"
FT   gene            1060153..1062475
FT                   /locus_tag="ANIA_07089"
FT                   /old_locus_tag="AN7089.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1060153..1061023,1061080..1061230,1061356..1062134,
FT                   1062177..1062475)
FT                   /locus_tag="ANIA_07089"
FT                   /old_locus_tag="AN7089.4"
FT                   /note="transcript_id=CADANIAT00000378"
FT   CDS             join(1060153..1061023,1061080..1061230,1061356..1062134,
FT                   1062177..1062475)
FT                   /locus_tag="ANIA_07089"
FT                   /old_locus_tag="AN7089.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000378"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000378"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000378"
FT                   /db_xref="GOA:Q5AX91"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX91"
FT                   /protein_id="CBF79106.1"
FT                   /translation="MPPLAGFSDNPLRSRADLIHAAIALVQPLHTHFSPRNAFIRLPVA
FT                   TGTHFDERAAQLEGYARPLWVISTLLRAVRAEPDHPDAEAIRSVCRPWIQGIQTGTDPA
FT                   HPEYWGEIGDGDQRMVEAEVIAVAVLFAPEDFYHSQPARVRENIVAWLRGINGKEMPVN
FT                   NWRWFHVFANLALIIVGGVPYAELKGAMDDDLAVLDSFYRGEGWSGDGPWLTGEQEAEL
FT                   EQEYKRTRRRDKIGPGRQVDYYSSSYAIQFSQLLYAKFAAELDPARSEGYRQQAREFGR
FT                   AFWRYFDRDGAAIPFGRSLTYHFACAGFFAALAVAEVPDMPAPLDSPGSVKGFLLRHLR
FT                   WNMYMAEDYNSPQSVYWSVKSFIPLALVDGHSFWTSSESAYPVLADSVKLIPQPTQILC
FT                   DHAHGAHHFLLSAGQFVAWPMKASQAKYCKFAYSSSFGFSVPTGSLIQQIVPDNALFFS
FT                   RDGIETWAGKWKSSEARFGTANAVGETVPVVHVKWRPWADGQLVVTMSLIPPTARWPDW
FT                   HTRVHRIQLKGEAPLESLHLVEGGFAIERVPAEKKALPVLSDGNIEGASIGRSEGIYVS
FT                   QSSALVLSQAGASGIVSAAVRRRPEYEAMKPDSNTNLLSQRTLVPVAKLGLLDVEAGEE
FT                   IELVTRVFAISAKSLRGQPGASVPDGRGGGGIQRPMRERWLDVPKVQLGDIPENGGEDV
FT                   IALEI"
FT   gene            1062621..1064345
FT                   /locus_tag="ANIA_07088"
FT                   /old_locus_tag="AN7088.4"
FT                   /product="hexose transporter protein (AFU_orthologue;
FT                   AFUA_8G04480)"
FT   mRNA            join(1062621..1063916,1064117..1064128,1064238..1064345)
FT                   /locus_tag="ANIA_07088"
FT                   /old_locus_tag="AN7088.4"
FT                   /note="transcript_id=CADANIAT00000379"
FT   CDS             join(1062621..1063916,1064117..1064128,1064238..1064345)
FT                   /locus_tag="ANIA_07088"
FT                   /old_locus_tag="AN7088.4"
FT                   /product="hexose transporter protein (AFU_orthologue;
FT                   AFUA_8G04480)"
FT                   /note="transcript_id=CADANIAT00000379"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000379"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000379"
FT                   /db_xref="GOA:Q5AX92"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX92"
FT                   /protein_id="CBF79108.1"
FT                   /translation="MTFGPTGGTLISVLISSQLRERFGRRYPICGGSIIIIVGGILQAA
FT                   AVNYGMFVLSRFVVGFGLGIVATAAPPLLTEVAYPTHRGKLVSFYLVTWPLGSLIAAWV
FT                   TYGTFKMEGSDWSWRIPSALQCFFSLVQAILALVAPESPRWLIYQGRSEEALAILTKYH
FT                   GHGDADSRLVCFEMAEITATLEMEKVQRLSRWTEWLSTRGNRHRLFLACYIPAMLQWSG
FT                   NALTSYYLAKVLVTIDITDPKTQLIINACLSVWGFLTAAVFATMVDRAGRRCLFLSGMG
FT                   SMGVVYIIWTICSALNEKHNFEDKGYAGGVLAMIFVFSAAYHMCSPVAPTYIMEVVPFS
FT                   LRSKAAMMYQLTGNLAGLYNSFANPVAMDAISWRYYIVWCVVIGVNFTLIFLFFPETKG
FT                   KGLEEVAEIFDGPDALAGKNAMREMGLDVNADKDKVIFGTSYRRLFVTEVNTLLVAVIA
FT                   EQWDCSRRLQGIL"
FT   gene            complement(1065742..1066563)
FT                   /locus_tag="ANIA_07087"
FT                   /old_locus_tag="AN7087.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(1065742..1066563)
FT                   /locus_tag="ANIA_07087"
FT                   /old_locus_tag="AN7087.4"
FT                   /note="transcript_id=CADANIAT00000380"
FT   CDS             complement(1065742..1066563)
FT                   /locus_tag="ANIA_07087"
FT                   /old_locus_tag="AN7087.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000380"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000380"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000380"
FT                   /db_xref="GOA:Q5AX93"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX93"
FT                   /protein_id="CBF79110.1"
FT                   /translation="MKFLPLILPVVFALCAQAVEWHAHYRMTSDEYQSTANSYIDQGFR
FT                   IKSVSGYERDGEDNYAAIFEKNNGVAWVSHHRMTSASYQDKFDKYIADGYRLLQVNGYT
FT                   VGDNVYFAAVWDKSPAPGAWVARHNIDAASLQKYTDTYIEQGYRVTHVSAYEVNGEARF
FT                   AALWEKINDGTAWWAWAKMTAAEYQKKFDTYLKDGYRLINVNGYSIGNTVYYAGIWDTS
FT                   ASGAWVARHGMDSPTFQNLFDEYKAAGYVLQVLSGYNTGTADRYAALWIKP"
FT   gene            1069852..1071307
FT                   /locus_tag="ANIA_07086"
FT                   /old_locus_tag="AN7086.4"
FT                   /product="F-box domain protein (AFU_orthologue;
FT                   AFUA_3G01810)"
FT   mRNA            join(1069852..1070095,1070136..1071307)
FT                   /locus_tag="ANIA_07086"
FT                   /old_locus_tag="AN7086.4"
FT                   /note="transcript_id=CADANIAT00000381"
FT   CDS             join(1069852..1070095,1070136..1071307)
FT                   /locus_tag="ANIA_07086"
FT                   /old_locus_tag="AN7086.4"
FT                   /product="F-box domain protein (AFU_orthologue;
FT                   AFUA_3G01810)"
FT                   /note="transcript_id=CADANIAT00000381"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000381"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000381"
FT                   /db_xref="GOA:Q5AX94"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX94"
FT                   /protein_id="CBF79112.1"
FT                   /translation="MACLEYLPNEIIETIVSLLELTDIRNLRLTSRGLALRSSGHHFKS
FT                   HFRRKHVDITESTLRDFVQATKPGRLGRLVQYLVLVGSHLPTEKQGLEAEDEAKTRQDL
FT                   EVLAQRRTDYRVMRSSGTDVRLLSEAFGNLMAQDGGNNTAGGPRLRTLSLKVVVYHTDA
FT                   EQRLPPKTGGWVPIWQVATETFHTALRALAISAMPVAKLDIYTQQSRSSLACSELSAVD
FT                   HESSGLVASLASVKSLSVSFSDRIINGRRENLGITGGSADEVDRDAPVIDDFRDNEDVE
FT                   AEACDESTFIGLVRLVQLCSGLKELELHHYKLGNHTVFVDLHREQFLQRIVAMTTLTTL
FT                   KRCALRGLTVREVDLLAFIKETAPAIVELTLQNVSLVSGTFRAIFDHCTSEASCLTRLF
FT                   FDDLFEQKLLYFVGEPGQSKLRSFNYQCSETLDRTGPEVRRPISYFIPLGRPKGSPALW
FT                   QWRMRRRREFGPP"
FT   gene            1072976..1075655
FT                   /locus_tag="ANIA_07085"
FT                   /old_locus_tag="AN7085.4"
FT                   /product="beta-lactamase (AFU_orthologue; AFUA_5G09790)"
FT   mRNA            join(1072976..1074027,1074222..1074329,1074602..1075655)
FT                   /locus_tag="ANIA_07085"
FT                   /old_locus_tag="AN7085.4"
FT                   /note="transcript_id=CADANIAT00000382"
FT   CDS             join(1072976..1074027,1074222..1074329,1074602..1075655)
FT                   /locus_tag="ANIA_07085"
FT                   /old_locus_tag="AN7085.4"
FT                   /product="beta-lactamase (AFU_orthologue; AFUA_5G09790)"
FT                   /note="transcript_id=CADANIAT00000382"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000382"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000382"
FT                   /db_xref="GOA:Q5AX95"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX95"
FT                   /protein_id="CBF79113.1"
FT                   /translation="MSPAHGHCDAAFQPLRDLFDQLLSNESELGASICVNIDGRNVVDL
FT                   WGGYSNEERTKAWEQDTITTIWSTTKVITALAANILIERGLLDPSKKVSTYWPEFAANG
FT                   KENVLVSHVLSHSSGLPSWESPNTIKDIYNAEKAAEKIAAQAPWWTPGEQLGYHLVTQG
FT                   CLVGELVRRTTGQSLAQFIADEITEPLGADYRLGVPEPEWPRTADIIPPPPPEPTPALD
FT                   PESVAAKAYAGVPIPADAVMTASFRNAELGASNAFTNARALARIASIVALGGTVDGKQY
FT                   LSPAAIDQMLQEQIRGQDQVLFVNLRWGLGVGLPVPETVPWLPSNSRLCFWGGWGGSVM
FT                   IMDLDRRMSIALKVNRMFESRTSDAGENAVGLLSGGFFVDTAGPGFSSTRSSYYDAIMQ
FT                   IIKSLWVQTFPSKPTLTAATLPPQTGKVIIITGATSGLGFELARILYKSGATVYIGARN
FT                   ESKAKATIETITASASSTALAASAGKLHFLPLDLADLRTIKPFVESFLSRESRLDILFN
FT                   NAGVASIPLSNRTAQNLEPHLGTNCAGPYLLTQLLSPILVSTAQKHSTAPNTVRVVWSS
FT                   SMLVDALAPRSGIRPSDLDPPSPNMNLNYALSKTGNWFLADRLAKQLGERGVVSITQNP
FT                   GNIYTPIFDNAPRLTVWLSKPIYYKPEQGVNTMLWAGFSDGVTVERGGGYVIPFGRWHP
FT                   YPRKDLLEAIMDKEEDGNEAENRGRGYAKAFEEWCDLVTREFR"
FT   gene            complement(1075894..1083970)
FT                   /locus_tag="ANIA_07084"
FT                   /old_locus_tag="AN7084.4"
FT                   /product="PKS-like enzyme, putative (JCVI)"
FT   mRNA            complement(join(1075894..1077217,1077272..1079867,
FT                   1079937..1081127,1081470..1082081,1082131..1082254,
FT                   1082323..1082857,1082907..1083024,1083088..1083543,
FT                   1083575..1083634,1083761..1083899,1083959..1083970))
FT                   /locus_tag="ANIA_07084"
FT                   /old_locus_tag="AN7084.4"
FT                   /note="transcript_id=CADANIAT00000383"
FT   CDS             complement(join(1075894..1077217,1077272..1079867,
FT                   1079937..1081127,1081470..1082081,1082131..1082254,
FT                   1082323..1082857,1082907..1083024,1083088..1083543,
FT                   1083575..1083634,1083761..1083899,1083959..1083970))
FT                   /locus_tag="ANIA_07084"
FT                   /old_locus_tag="AN7084.4"
FT                   /product="PKS-like enzyme, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00000383"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000383"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000383"
FT                   /db_xref="GOA:Q5AX96"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX96"
FT                   /protein_id="CBF79115.1"
FT                   /translation="MALTGCRTRRVRWTPNAHLVNWSATFGTLWSINTGAYQCGRYIVR
FT                   WIAALGRLLISLPSPQNDLVDICLVSIGAVYYLFKMNGITSTSLPSPRYHFEPIAVIGF
FT                   ACRLPGNNNSPTALWDFLERGGVASRAVPASRFNLAGHENGSKRPGTMRTPGGMFLESI
FT                   NPADIDAQFFGLSRAEATAMDPQQRQLLEVVYEGLENAGITLEQLRGQDVGCFVGSYAS
FT                   DYGDIQARNPDDRAPNSTVGIGRAMLSNRLSHFLDIKGPSMTIDTACSGSLVSLDVATR
FT                   YLQTGEIRAAIVAACNLYMSPEHCIDISSSIINAASLTGLCHTFDAKADGYVKAEAVNM
FT                   VIIKRLQDAIRDRDPIRSIIRGSASNSDGWTAGIASPSSEGQAAVTRQAYRIAGIADFN
FT                   ATSYVECHGTGTRAGDPIEVKGVASVFCPERPAERPLLIGSVKSNIGHSEPGAGISGLL
FT                   KTILALEKSVIPGNPTFETPNPEIDFDGLKTRAFQHATPWPSMPFKRASVNSFGYGGSN
FT                   AHVILDEAKTGVSASEMCFKSSYLPEDHDPFEECEENEKCFPQLLVFSANDEKSLQEYI
FT                   RALRAHLINPRVRISLQDLAYTLSERRSRHFNRAFLITQTSLNLDLHGLVFGKLRSSSP
FT                   RVGFIFTGQGSQWPQMGKSLLDMFPSGRGQLARLDRALQLLPDPPEWSLYGAGHHVLEE
FT                   LLQAHRDSIAVACINSPESVTLSGPLNVLKTANMVIQEKGYFARLLQVNMAYHNPMFMT
FT                   DITAQYKQMLHGLGLDSMSSPVSKATKEQRTVKMFSSVTGLETMGPCNVEYWCSNMQYP
FT                   VQFNQAVRMMLSDEKQPINFLIELGPSGALASPTKQIIQSMRDKKPDLAIEYHAAYKRD
FT                   VVTAAMGLFEVAGHLYLSGGAVDIEQVNSHHAHREKDQHQPSVIVDLPNYAWNHSIKYW
FT                   YESQSSRDWRFRHYPNHDLLGSKILGTSWFAPSFKKVLRLADLPWLRDHRVAGQPLFPA
FT                   AGYIAMAVEAAYQTGQRSGMIDTGLKVSQVPYRFRNIKFVRALVLDEAAPSTLMLSMSP
FT                   ERGWYKFSVYTADGESVPTIHCEGLVSLHVEVGKAPPSSAFKQLLYPTPARLWYKAMDK
FT                   VGYNFGSAFQTQLQIESVVGTRQNRALVSFLEPQSAYAQSLYSIHPAVLDGCLQSGAPA
FT                   LWNGVRSAVRECLVPAIIEDLVISARQTAARSGASVCSAEYSGVGSRDEPCSYKSNIIV
FT                   SDPATGDTLIRVRGLAYSALDREEAFSQFTPSMRLEWKPDISFLSRNQLYRILDTCDTR
FT                   FAPYSAHDDSRALSFISLLLHKKPALRVVEFNIAPSTDSSFFAILGHIPFTAKGAVEYH
FT                   FVSNNAAALVAFQGMADGCGLPNVQLSALDVSRLDIDSHLLGDKADLAVLNTDHQICGE
FT                   KLHNAIVNIAAILRKGGFILILAHQSSTNQVQARPWDGHSASINDALGRHGFKKSVAFD
FT                   MGTETHAIVGQLLLPVREPSAELQVSLVLLSSSTDSALASQMLAESGVTVAGIHYLPLG
FT                   EIRKDLIILITDEMFKPVLAEVTQEQWGAIQRILAFGCKIVWVTSGAQKDVVSPLQALV
FT                   SGLSRVVRAEDPTISFTLLDVESPYSKKSFRAIADVLERVDNGNTSSGLVDEEYEYVER
FT                   GGIVHVSRVYPDIASGGDGKAVIQNLHNHASCVRLTCQAPGFLESLQFTETGPSEAVVP
FT                   DGFVEVEMHAAGLNYKDVATVLGIVPENQYLLGLEGAGVIRRIRHHAGDSPFYIGQRVA
FT                   ICRRGSFANRVQCPIEGIHAIPDWMSFEEAATIPIVYQAALYSLVDLANVQWGQSVLIH
FT                   SAAGGLGIAAIQLCQYLGAEIYATVGSDEKREFLIREFNLSPDRLFSSRDTVFASCIIE
FT                   QTGGRGVDVILNTLTGSLLDESWRIIAAHGTMVELGKKDILDRNSLSMEPFNRNASYRA
FT                   FDLSHPSITRPLVARLLKRIFDLIHGGHIRPIAPRTVYAYSNIAAAIRYMRGGAHIGKI
FT                   IISRDAPQNCTDVPVMPVQKSLKLRGDVSYLIVGGLKGLCGSLATYLACHGAKHISVMS
FT                   RSDYTDDKSKAVLRDLTLLGVNCSLVRGDVSVKDDVQKAFCKGSRPPVAGVIHGAMVLK
FT                   DTIYTSMTAAQFHDALRCKVQGTYNLHDVALQLGLDLDFFTLLSSLSGLVGHKGQANYA
FT                   AASAFLDSFALYRRSKGLAACSVDLGIIDDIGYMAEHESITDRLDTETWIPLNEVQLHR
FT                   ILYTSILQERDQRSTGTSQLITGIAYPAPAVPSALYQDARFTALCQKSANSNSASISIK
FT                   GGARDMQVQALLTLVQAKADAAVQIAAMIDAANAHFMRSLALSEPMEAAKPLVLYGLDS
FT                   LAAVEFRNWARRELNVVVSTLDVLGAKTLNALCEMMVGRLAG"
FT   gene            1084582..1085391
FT                   /locus_tag="ANIA_07083"
FT                   /old_locus_tag="AN7083.4"
FT                   /product="DltD N-terminal domain protein (AFU_orthologue;
FT                   AFUA_8G00380)"
FT   mRNA            1084582..1085391
FT                   /locus_tag="ANIA_07083"
FT                   /old_locus_tag="AN7083.4"
FT                   /note="transcript_id=CADANIAT00000384"
FT   CDS             1084582..1085391
FT                   /locus_tag="ANIA_07083"
FT                   /old_locus_tag="AN7083.4"
FT                   /product="DltD N-terminal domain protein (AFU_orthologue;
FT                   AFUA_8G00380)"
FT                   /note="transcript_id=CADANIAT00000384"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000384"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000384"
FT                   /db_xref="GOA:Q5AX97"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX97"
FT                   /protein_id="CBF79117.1"
FT                   /translation="MLGLPDVALHFQTAGVTVLLYDPRSTGLSDGTPRNEIDPVKQAAD
FT                   YSDALTFLSTQASVYPSQLFFWGMSFSAVVALCAATTDKRIRGVLAIAPLTDLTYKPEH
FT                   RRAKVLQQCMQDRASQSAGNEPYYLPLLNEQGENPAGFGVGLEREEYARIVAAGRKLAK
FT                   GHVNRTTIQSYYHMAMWQPFGLWAGVAPTPVMFVVPEMDTVSPAERQREYFDTKLGNAP
FT                   RRLHLVEGAGHMDIVQGAHLEGLMEVKMRFVQDILEGRVEVSGDETR"
FT   gene            complement(1085470..1087133)
FT                   /locus_tag="ANIA_10887"
FT                   /old_locus_tag="AN10887.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            complement(join(1085470..1086228,1086288..1086839,
FT                   1086891..1087133))
FT                   /locus_tag="ANIA_10887"
FT                   /old_locus_tag="AN10887.4"
FT                   /note="transcript_id=CADANIAT00000385"
FT   CDS             complement(join(1085470..1086228,1086288..1086839,
FT                   1086891..1087133))
FT                   /locus_tag="ANIA_10887"
FT                   /old_locus_tag="AN10887.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000385"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000385"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000385"
FT                   /db_xref="GOA:C8VDF4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDF4"
FT                   /protein_id="CBF79119.1"
FT                   /translation="MTMIDLNPDLSFTAKSVALLLFIALGLLYTTIQVVYRLYLSPLSR
FT                   FPGPRLAAATGWYEAYFELVHKGGGQFLFEIRRMHEHLTGPIVRINPFELHIADPAYYS
FT                   TLYTSTLNLDKASHIQHRFNAPTAAFSTPEHALHRRRRAAISPFFAKRRIDEQAPMIQS
FT                   HVNVICHRLSEEYAGTGKVLCVNELYGSYVTGVIMTYAFNRCPRFLEEEDFVSAFGKSI
FT                   QGLKEFVHWAQQFPCLPRILQNVPPVLMGALFPAMQASLVFQEEMRMQAHAVLSGHGQK
FT                   GTIFHDLLASDLPRSELTLPRLKDEAMSIVGAGIETTKMASVVTTFHILQNPRILQKLQ
FT                   DELDSAIPDPTAPPSLSVLENLPFLAACIKEGIRLGYGATGRSPRISRTESLRYGAWSI
FT                   PVGVMVSMDSYHMHHDESVFPDSYAFVPERWLDGARGPDGTGSLNKYLASFSRGTRMCV
FT                   GINLAYAEITIVLARLFRGFVMELYQTTRKDVDCYRDLVGMEVVRGSRGVRVKVVGRRE
FT                   "
FT   gene            complement(1087526..1089111)
FT                   /locus_tag="ANIA_10886"
FT                   /old_locus_tag="AN10886.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1087526..1087585,1087777..1088176,
FT                   1088270..1088646,1088713..1088789,1088845..1088881,
FT                   1088947..1089111))
FT                   /locus_tag="ANIA_10886"
FT                   /old_locus_tag="AN10886.4"
FT                   /note="transcript_id=CADANIAT00000386"
FT   CDS             complement(join(1087526..1087585,1087777..1088176,
FT                   1088270..1088646,1088713..1088789,1088845..1088881,
FT                   1088947..1089111))
FT                   /locus_tag="ANIA_10886"
FT                   /old_locus_tag="AN10886.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000386"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000386"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000386"
FT                   /db_xref="GOA:C8VDF5"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDF5"
FT                   /protein_id="CBF79121.1"
FT                   /translation="MASSAGTAHSRAIAAVVVSVVFETLALIAMILRFYSHRLRKRRIA
FT                   AHDWASVVALIFSSGCVVLVITAVAKGGLGQHTWELSNPTIQLQHFAKIYVANSPVWAG
FT                   AISAVKVSIVLLYIGLFGSARTIRYCCYTLITLQILWGAAVILSSLLLCKPLRMNWDPT
FT                   ADGHCGSTEATYLALHIINLILDVTVGLLPVPVLWKLQMKRRKKIELTLMFALGIAICI
FT                   ITVFRVNMINDLVSTDPTYTTTPLMIFTILEPLLGIILACLPLLRPVFERVSAFRTLHS
FT                   SCDSRGSGTSTPQLFGQSGESKAKAERYVKLRPSTSTAGFTHDINGTATNRGHGYELDE
FT                   LRCLSERNKPSILVIGLAVMLSPKIYGVRPG"
FT   gene            complement(1089950..1091805)
FT                   /locus_tag="ANIA_07081"
FT                   /old_locus_tag="AN7081.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1089950..1091201,1091264..1091464,
FT                   1091534..1091805))
FT                   /locus_tag="ANIA_07081"
FT                   /old_locus_tag="AN7081.4"
FT                   /note="transcript_id=CADANIAT00000387"
FT   CDS             complement(join(1089950..1091201,1091264..1091464,
FT                   1091534..1091805))
FT                   /locus_tag="ANIA_07081"
FT                   /old_locus_tag="AN7081.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000387"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000387"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000387"
FT                   /db_xref="GOA:Q5AX99"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AX99"
FT                   /protein_id="CBF79122.1"
FT                   /translation="MFLDMFLYLCSVLLPLSLSQALPSPGSVDKPCRYLPGDTDWPTEA
FT                   EWSQLNTTVGGRLIKTIPLGSPCHGSSYRAAECEHLQAEWTNPEIHADSPSSFGAPLFQ
FT                   DQACDPFTNRSSPCELGNYYVYAINVTSAADVAAGLAFAQDKMIRLVVKNTGHDLLGRS
FT                   SGKGALGLWTHNLRSISILDYNSSLYTGKAMKVGSGIQVFDAYSAAHQAGLRVVGGTCL
FT                   TIGLAGGYTQGGGHSMLSTAYGLAADQVLEWEVVIANGTHLTSTPTENADLYWALSGGG
FT                   GGTYAVVLSMTVKAYAESPVAGAMLQIKQTSSEDDFWVAVEAFHAAMPTWVDMGASTAY
FT                   VLSNGVLSLQPALFTTRSAIEVKSILQPLIETLDSLSVAYVLNIIAFDDYYTAFNNYFG
FT                   AYPNSQVQGNRLIPRSVLASNTSNAALTLALREIISNPSFYILGVGINVSAGASVPNAV
FT                   FPGWRNAIASLEVIANWDYTASYAENTQHQKLVTKEYIPSLTAVTGPESGAYMNEADFQ
FT                   QPDFQSQFFGENYAALSAIKRKYDPQSLFYGNALVGSEEWVAGSDGRLCRAQSIYLG"
FT   gene            1093685..1094635
FT                   /locus_tag="ANIA_07080"
FT                   /old_locus_tag="AN7080.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1093685..1093771,1094336..1094395,1094444..1094635)
FT                   /locus_tag="ANIA_07080"
FT                   /old_locus_tag="AN7080.4"
FT                   /note="transcript_id=CADANIAT00000388"
FT   CDS             join(1093685..1093771,1094336..1094395,1094444..1094635)
FT                   /locus_tag="ANIA_07080"
FT                   /old_locus_tag="AN7080.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000388"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000388"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000388"
FT                   /db_xref="GOA:Q5AXA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA0"
FT                   /protein_id="CBF79124.1"
FT                   /translation="MARGSGNGSNGAAGAKGKGSKENDKTMEKDTLAKTNKGRKAGIKQ
FT                   SMSEDYLWPVSLYLHDKLDAESLTALRANHDKVSKSDTNGDLLVRVLYLLEQKSMADRA
FT                   TLLEGQRR"
FT   gene            complement(1094988..1096604)
FT                   /locus_tag="ANIA_10885"
FT                   /old_locus_tag="AN10885.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1094988..1095010,1095077..1096604))
FT                   /locus_tag="ANIA_10885"
FT                   /old_locus_tag="AN10885.4"
FT                   /note="transcript_id=CADANIAT00000389"
FT   CDS             complement(join(1094988..1095010,1095077..1096604))
FT                   /locus_tag="ANIA_10885"
FT                   /old_locus_tag="AN10885.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000389"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000389"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000389"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDF8"
FT                   /protein_id="CBF79126.1"
FT                   /translation="MHILGSDLPRPDNVVICTPPGESLISPVRVDNLPWNLFKRGIESQ
FT                   VISQLYPIAIQSQHSDPEGPNASELHAFNLSQLTTFGSPTTPSAAIYSFDQANLSSADQ
FT                   FNTDNWDWTLLNDFAYSSLSDTMFSSASPGTNQTRLVTSPSDAVTISIQPALSLLSEIS
FT                   QRHTIDLPSFFRRYTTDEQDLEFDASSFSISIPTDHVALFRFFCSFIFLITNNILTDHD
FT                   IHELFTWIVENNCVWIIAKILELPPTGTVDVLADRIFPAVIRAGEIGLVRKLIARRVDV
FT                   HCQKKWETPLSLAVQRRDMEMVNLLCECGVKPAIRRFSVLKSDQNNDTLWSDRNNQLLS
FT                   LLLELGADPDSFIYNEPSGYPLVSAAAEGEVGAVELLRASARTDLAIPKLGTALQAAAA
FT                   PGHKAVVRLLVEAGANVNAICSIIESDRIHLHFSAAFMTPIQLAAHGNSGDIMQILIQS
FT                   GGLVNHLPIIPHLGLRVIEEIFSNSSRSSYSNAIIVIVFVDKRGHFWPRLCVGWGGEE"
FT   gene            complement(1096654..1097146)
FT                   /locus_tag="ANIA_10890"
FT                   /old_locus_tag="AN10890.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1096654..1096966,1097022..1097146))
FT                   /locus_tag="ANIA_10890"
FT                   /old_locus_tag="AN10890.4"
FT                   /note="transcript_id=CADANIAT00000390"
FT   CDS             complement(join(1096654..1096966,1097022..1097146))
FT                   /locus_tag="ANIA_10890"
FT                   /old_locus_tag="AN10890.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000390"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000390"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000390"
FT                   /db_xref="InterPro:IPR025676"
FT                   /db_xref="UniProtKB/TrEMBL:C8VDF9"
FT                   /protein_id="CBF79128.1"
FT                   /translation="MSQSVRDNQWAEYKNEITSLYRKYALHDVMQQLSEKHGFHGSKND
FT                   YVKRLRLWGVKKNVKKNHAAGTWNYIDQQLKKRSLAGKKSNVSVNGKHYSNRRAQKEIL
FT                   RNVTQRDIFKRACESLPRSFLFFFFFFFLFFFSFFFFFFFF"
FT   gene            1099916..1102569
FT                   /locus_tag="ANIA_07078"
FT                   /old_locus_tag="AN7078.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1099916..1099936,1100656..1100697,1100871..1100895,
FT                   1101048..1101139,1101197..1101238,1101366..1101377,
FT                   1101591..1101608,1101903..1101992,1102059..1102102,
FT                   1102377..1102395,1102431..1102497,1102562..1102569)
FT                   /locus_tag="ANIA_07078"
FT                   /old_locus_tag="AN7078.4"
FT                   /note="transcript_id=CADANIAT00000391"
FT   CDS             join(1099916..1099936,1100656..1100697,1100871..1100895,
FT                   1101048..1101139,1101197..1101238,1101366..1101377,
FT                   1101591..1101608,1101903..1101992,1102059..1102102,
FT                   1102377..1102395,1102431..1102497,1102562..1102569)
FT                   /locus_tag="ANIA_07078"
FT                   /old_locus_tag="AN7078.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000391"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000391"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000391"
FT                   /db_xref="GOA:Q5AXA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA2"
FT                   /protein_id="CBF79130.1"
FT                   /translation="MEYLADSLLSNYQIKIILRGLIRDPNLTTAIIQKQHLISYLNRQD
FT                   INGLIFLQNTDQNLKDYIQEYYYDSQGTMTNAKTQNNIPLLTDIEYENANVQNWASQKK
FT                   GAVIKAGLNKSHQKLYISGKYLSLVKSKTPKLYPYHKEIQDQGLKTPQELVMMSQ"
FT   gene            1103504..1104632
FT                   /locus_tag="ANIA_07077"
FT                   /old_locus_tag="AN7077.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1103504..1103928,1104021..1104398,1104434..1104539,
FT                   1104582..1104632)
FT                   /locus_tag="ANIA_07077"
FT                   /old_locus_tag="AN7077.4"
FT                   /note="transcript_id=CADANIAT00000392"
FT   CDS             join(1103504..1103928,1104021..1104398,1104434..1104539,
FT                   1104582..1104632)
FT                   /locus_tag="ANIA_07077"
FT                   /old_locus_tag="AN7077.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000392"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000392"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000392"
FT                   /db_xref="GOA:Q5AXA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA3"
FT                   /protein_id="CBF79132.1"
FT                   /translation="MLYNEAHPGHRARDELCLGWASRYDGYGNTKSATSQRLRFNWKMP
FT                   ALMLICFIIGLFLAVVHHLYYQLLNNTVIHTKSQQTWANRIGTGLVFLIKTFLAAAVGI
FT                   VCTQVLWWSLRSRSIEVSTLDSLFDLRNNILSFLNPLVYDIRLIPIIAVFTPSALSVQS
FT                   SIASTVSPMSIPSILWNAKLFAGWNGRLVNGQPISAWASVKPNITRVVTATAVHGFVLS
FT                   LSAPAVNSSYTLNFHGPSLQCTNSTSLHHAVVEYYNEYGAEAGDPWSPPDMEQQYFSKL
FT                   DETSTDSAKIVFAIFASGGPYTFTFTNGIQDLETIPQC"
FT   gene            complement(1105434..1107179)
FT                   /locus_tag="ANIA_07076"
FT                   /old_locus_tag="AN7076.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1105434..1106313,1106362..1106505,
FT                   1106557..1106967,1107120..1107179))
FT                   /locus_tag="ANIA_07076"
FT                   /old_locus_tag="AN7076.4"
FT                   /note="transcript_id=CADANIAT00000393"
FT   CDS             complement(join(1105537..1106313,1106362..1106505,
FT                   1106557..1106967,1107120..1107179))
FT                   /locus_tag="ANIA_07076"
FT                   /old_locus_tag="AN7076.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000393"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000393"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000393"
FT                   /db_xref="GOA:Q5AXA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA4"
FT                   /protein_id="CBF79134.1"
FT                   /translation="MVGRPFTSSGCANCRKRKIKSTQTGEAKRPVRQLVGQIKPLALSS
FT                   TFSVSAEVRAQLFSNFMDTFFASSSSINGKNDSLYFLMARFPTLAGESEPLDRSVIALA
FT                   TTFLAKTKDDRWLGREGLEIYNTALNSMQYALQRGSSPSPNMLYATIIFHTYETMNGGD
FT                   ASSRNCFTHIQGAAAIMTQTNFKTQDVDSLTKAMLTRQKWATAHFMINTEYGSNADRGC
FT                   LLVQRESTPIDEMFGLVAEWSILRNDLNKIAALEATYREAAYETLLRRCYQLEKKLHED
FT                   WLNGPALQLDGDPSLSCREGGWSDSSLMSNSDRFSYEFKNLNAAKIYLLYWVTSLVTSR
FT                   VIYEAEVLLHGHCDPTKMVSYATKILRSVPYLMQRERQMSSVHVVIFGVSQASRCYIHC
FT                   GKKEEFERCQEIYRLIALRGFDMAFHMAKEHLAYWYLAQGQPVATKASSLRSEMDSTSE
FT                   LPSVS"
FT   gene            complement(1111810..1113404)
FT                   /locus_tag="ANIA_07075"
FT                   /old_locus_tag="AN7075.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1111810..1112275,1112340..1112838,
FT                   1112909..1113404))
FT                   /locus_tag="ANIA_07075"
FT                   /old_locus_tag="AN7075.4"
FT                   /note="transcript_id=CADANIAT00000394"
FT   CDS             complement(join(1111810..1112275,1112340..1112838,
FT                   1112909..1113404))
FT                   /locus_tag="ANIA_07075"
FT                   /old_locus_tag="AN7075.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000394"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000394"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000394"
FT                   /db_xref="GOA:Q5AXA5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA5"
FT                   /protein_id="CBF79136.1"
FT                   /translation="MYWFILHLLAVALPAAALVTHDPCRLVESKIPGRISYPSSTTYNA
FT                   SVSSYYDDQERSLRPGCIFRPTNTSEVSQFVKLMTADKRKPQFAVRGGGHTLWTGAANI
FT                   GPGITVDMRLMDQLELSEDKKIARIGGGAVWDHIYPQLVPHDLTVMGGRIPGIGVGGFA
FT                   MGGGITFSSREHGFSCDNIYGYEIVLGNGQVIYADQRSHPDLWLALKGGSNNFGIITRF
FT                   DAATIPLGKMWYNHLHYNYTDSALQAHAEAFSDFMKPENYDGAAMMGVFLDYLGGKFLL
FT                   HDALWYTREVENPAVYDAFTEIPNLGGVAELNTIDNVVDKFGDDIPSQVGRAFQLTFSF
FT                   HNPDPTVYMELFKIWETGLSKIANVEGLFVEFLTQPHPVTNGTNLFGLTPGRTDDVMVD
FT                   MTAAYTNQADDRLVQSVITDIVNEQRALLKRSGHLMDFIYLNYADISQEVLQSWGADNV
FT                   AKLRAASNKYDPKRVFQKQVPGGFKIPK"
FT   gene            1114331..1115391
FT                   /locus_tag="ANIA_07074"
FT                   /old_locus_tag="AN7074.4"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family, putative (AFU_orthologue;
FT                   AFUA_4G00940)"
FT   mRNA            join(1114331..1115131,1115180..1115391)
FT                   /locus_tag="ANIA_07074"
FT                   /old_locus_tag="AN7074.4"
FT                   /note="transcript_id=CADANIAT00000395"
FT   CDS             join(1114411..1115131,1115180..1115391)
FT                   /locus_tag="ANIA_07074"
FT                   /old_locus_tag="AN7074.4"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family, putative (AFU_orthologue;
FT                   AFUA_4G00940)"
FT                   /note="transcript_id=CADANIAT00000395"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000395"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000395"
FT                   /db_xref="GOA:Q5AXA6"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA6"
FT                   /protein_id="CBF79138.1"
FT                   /translation="MAAPPSYTKVTHSATYPAINPSQPALSTAGKVVLITGASGGIGRA
FT                   TASSFAASGPRALILLGRRADALAETAAIVRASYAEVTVQTHEAELCDASSVRNAMNKA
FT                   AAEFGGIDILVHCAGSLAPVVPLVEADPATFLDGYKTTVVGTLATAQAVVLANRTVSAD
FT                   EDKPVTFINLTTAGILFPPFPGMGAYVSSKMAAVKILEAFAAENPHVRLHNVHPGFLET
FT                   AMSAKLGEKIKLPYAYDDISLPADFLVWTASAEAEFLRNKIVFAAWDVDELKARTKEIV
FT                   GGPPGTGELRIGFQGFPRFMAGQPLPGTN"
FT   gene            complement(1115759..1116917)
FT                   /locus_tag="ANIA_07073"
FT                   /old_locus_tag="AN7073.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(1115759..1115814,1116008..1116917))
FT                   /locus_tag="ANIA_07073"
FT                   /old_locus_tag="AN7073.4"
FT                   /note="transcript_id=CADANIAT00000396"
FT   CDS             complement(join(1115759..1115814,1116008..1116917))
FT                   /locus_tag="ANIA_07073"
FT                   /old_locus_tag="AN7073.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000396"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000396"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000396"
FT                   /db_xref="GOA:Q5AXA7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA7"
FT                   /protein_id="CBF79139.1"
FT                   /translation="MEAYKTQPPVRKLKDSCDVCSASKLRCDKQKPTCARCANLNRPCT
FT                   YSPARRGGRPHRVRRDRSKSQSQSQSSRQFFGMPDANTSSSPFAEPTRVPSQTDRGMSC
FT                   SNDWFLRTQSRVHDHIQDSQPSAQSAKVSPSPCKNPMNTRLAAETAETDMDCTRVALSI
FT                   VEQLERSQEQRPRSTAPTYTHGGLTATEACQRLLTILMCPCSDQAEVALLVASGCISLM
FT                   DVIHSSAGFASESLGHDGSVSSCNSPPISSEQDPLIRSWSQPQSISRSCSLASDSRSQV
FT                   GDLSKIAKVIVQFTERYCQDAKVAAEPRAHWVTRYESLSR"
FT   gene            1118345..1119355
FT                   /locus_tag="ANIA_07072"
FT                   /old_locus_tag="AN7072.4"
FT                   /product="Miscellaneous Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            1118345..1119355
FT                   /locus_tag="ANIA_07072"
FT                   /old_locus_tag="AN7072.4"
FT                   /note="transcript_id=CADANIAT00000397"
FT   CDS             1118345..1119355
FT                   /locus_tag="ANIA_07072"
FT                   /old_locus_tag="AN7072.4"
FT                   /product="Miscellaneous Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000397"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000397"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000397"
FT                   /db_xref="GOA:Q5AXA8"
FT                   /db_xref="InterPro:IPR013700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA8"
FT                   /protein_id="CBF79141.1"
FT                   /translation="MELPAESELQYAGECLSLPGTFLEPPIEDPPSSVLNLLNLSQVDF
FT                   NSYDFSSLGSREFSSKWQTNTPLCTDSLSDESAPGLLTEDMGISPIPMPAAEATCPQES
FT                   EDRLCRNPQGRCISLATGILGSMHAGSNSCILQVATSDQGGASDRQPQQSRAADAILSM
FT                   NQSALRTVRSILNCSCYESPQVLLLVTVMCSRITAWYWRIADIYSYSHGNPTAGSPRAA
FT                   LPTSVGSRAETRRRDFFIGNHRLDREVETVVIRHVLLGMLQELQLVIRDFAGQAGQSPA
FT                   GTVDTDDPTSTSDLMLSGMRARVVAFLRKQLHSLTSALDHTDSGFGTMGPHVSHY"
FT   gene            complement(1119810..1125772)
FT                   /locus_tag="ANIA_07071"
FT                   /old_locus_tag="AN7071.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT   mRNA            complement(join(1119810..1121192,1121264..1123342,
FT                   1123403..1123732,1123784..1124188,1124283..1125324,
FT                   1125399..1125772))
FT                   /locus_tag="ANIA_07071"
FT                   /old_locus_tag="AN7071.4"
FT                   /note="transcript_id=CADANIAT00000398"
FT   CDS             complement(join(1119810..1121192,1121264..1123342,
FT                   1123403..1123732,1123784..1124188,1124283..1125324,
FT                   1125399..1125772))
FT                   /locus_tag="ANIA_07071"
FT                   /old_locus_tag="AN7071.4"
FT                   /product="polyketide synthase, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00000398"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000398"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000398"
FT                   /db_xref="GOA:Q5AXA9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXA9"
FT                   /protein_id="CBF79143.1"
FT                   /translation="MTPSASPSPSPNPGDANVKVDADSPNDFILFSHELPSGDIQDLIR
FT                   RLHRYGTLPGYPHLARFLQECALLLRTEIQKLPRALRDSVPPFHDVVTLASHWDRLKSG
FT                   PLSGAWDGPFLCLYEIAMLIGHHETHQLSYRRPACLVGISVGLFSAAAVAVSKSISDLV
FT                   SYGAESVRTAFAFCVHVQRVSQELEPTMTEQAASVSWATVVIGVPADTIQVELDRFNHL
FT                   KESESPGANARPLTGVSISHVDQTSVGVTGPPSRLKQLFRQSELLRSSRHSALPISGGL
FT                   CHVPNVYDDEDVRAILEMAEVWEKWGTRALQVPLISPFTGSPFLCPDAYHLIEAICTEA
FT                   LTKQLYFDKLAGGVVTQLNGLSCQVLHYGASLMSDTIIDDVTSQLSPCDTARQCLVDWA
FT                   LRDAFDQLPGGPTPPRDAKLAVVGMACRMPGGADTPDHFWELLMNGVDTHTTVPPDRFD
FT                   LDAHFDPSGEKENTTTKGSQSNRPLSRQAEQTDPMQRLALVTAYEALEMAGFVPNRTPS
FT                   SHLSRVGTYYGQASDDYREVNAGQKIGTYGIPGTERGFGNGRINYFFNFQGPSFNIDTA
FT                   CSSGLAAVQAACSALWAGEADTVVAGGLNVITSPDIYCMLSKGHFLSKTGQCKVWDIGA
FT                   DGYCRADGIGSVVIKRLDDALADNDVILACISAGATNHSAESISITQPHAAAQRENYRQ
FT                   VMDRAGVSPLDVSFVELHGTGTQVGDAVESESVLSFFAPLGRRSHPDKRLHLGAVKSNI
FT                   GHGEAAAGIASLIKVLLMYRNNTIPRHIGIRTAMNPVVAQHLANRNAGILSENHPWLAA
FT                   TASKKRYAIVNSFGAHGGNTTLLLEDAPSQHSQRYKNHSRRVVASSEVVCTSAKSKASL
FT                   RANIRALLAYLDTHQETDLRDLAYTTSARRMHHHIRIASSVTSTAQLRSFLQAAADDVD
FT                   AYAKHIATATKRTAVFAFSGQGCLYHGAAAHLFEQAPLFRNQVLQLDRIVRRLGFPSIL
FT                   VTVAGDAASVYDSARCPHRESTPSSDASHDSNTNRTSTAPAVDSPLIAQLALVVIQIAL
FT                   VQYWGLLGIKPSVVIGHSLGEYAALVAASVLSVADALFLVGKRAELMLAVCEPGSHAML
FT                   SVRGASVDRIEELCRESEKRYPFEVSCVNGLTDLVVTGLRGDMASLRDLLQGSGLKCVL
FT                   LDIPFAFHSKQMSPILEDFENAAQQITFQEPAVPVISPLLGKCISEANVINGKYLARAT
FT                   REPVDFVAALDSAWADGTVNDKSIWIDIGPHPVCTSFASNHYGKAATQSFASLRRGDET
FT                   LSTLTATLAALHCLGLPVDWNEYYDLRENPARLLHLDSYQWNYKNYWIPYEGSWTLDKA
FT                   HAGQNNKTKDDNSAVTPAFFTSSVQQIIFEEYDESMGRMEALSDLHHPDLQGAADGHKI
FT                   HGRSVVTGSIWADITLTVGEYLYKQMVPGGKMPHMNVKGMEVLEAQVLHPDMSQFIQIE
FT                   GVLDLPRQQTAVRLYAASANGTRNTDKPFASATVCYEEAQDWQDQWQMTSHLVAARANS
FT                   FWEMAAGGSDDNARPAGKGGPRVNNFFRSIAYQLFANVVDYGARYRGMQRVALSEDTLE
FT                   ATADIVLDKDRHGTWHTPPHWIDSAFQLAGFVMNSFGVQGDGKISGSSRDFFYITPGWR
FT                   HFRLLERLEPGPEATYRSFVRMFPVGSEPGAYSGDIYLHRGKRLVGVCAGIKFKAVPRA
FT                   LMPVLFPRIEPQAGKRRNQAQTAENRLVKGKGNCEYTHTVFQEPKSRTPAYDVTKSQPH
FT                   AEHCDISISQKTQPVAAVPVTQPALPAKERGEQNQGQSQSQNAQATACLSLISDETGLD
FT                   LDDLTGEAAFADLGVDSLMSLALSAKIRAELGIDVQSSIFLECPTVQDLVTWLSK"
FT   gene            complement(1126368..1127658)
FT                   /locus_tag="ANIA_07070"
FT                   /old_locus_tag="AN7070.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1126368..1126436,1126562..1127305,
FT                   1127449..1127658))
FT                   /locus_tag="ANIA_07070"
FT                   /old_locus_tag="AN7070.4"
FT                   /note="transcript_id=CADANIAT00000399"
FT   CDS             complement(join(1126368..1126436,1126562..1127305,
FT                   1127449..1127658))
FT                   /locus_tag="ANIA_07070"
FT                   /old_locus_tag="AN7070.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000399"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000399"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000399"
FT                   /db_xref="GOA:Q5AXB0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB0"
FT                   /protein_id="CBF79145.1"
FT                   /translation="MSGGFYSSPFWAGYLETQRSRLPVLPEIDDGLSHCVVRFLGYNPG
FT                   SMQLQGTNTYLVGTGSTRILIDTGEGAPQWAVSVTRYLEDHDISISHVLLTHWHKDHTG
FT                   GVADLLAHDPSIIVYKHAPDPGQQAIANGQTFKTQGATLRAVLTPGHAVDHMCFLLEEE
FT                   NALFTGDNVLGHGYSVAEDLETYTASLRLMAGLKCSVGYPGHGDAILNLPQTIARYISQ
FT                   RVAREKKIYAILALHACSCSSRNGGSTSSIGSVSESGDSDEEDNNMKTSRPAMQGLSTA
FT                   EIGGLVYGESVKNSPTFDSAVGPLLNQVLYMLLEQGKCCDHVSILVIFQKPGFFSIPVI
FT                   "
FT   gene            1128117..1130401
FT                   /locus_tag="ANIA_10884"
FT                   /old_locus_tag="AN10884.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1128117..1128244,1128318..1128414,1128477..1128519,
FT                   1128585..1129001,1129080..1129619,1129683..1130401)
FT                   /locus_tag="ANIA_10884"
FT                   /old_locus_tag="AN10884.4"
FT                   /note="transcript_id=CADANIAT00000400"
FT   CDS             join(1128117..1128244,1128318..1128414,1128477..1128519,
FT                   1128585..1129001,1129080..1129619,1129683..1130401)
FT                   /locus_tag="ANIA_10884"
FT                   /old_locus_tag="AN10884.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000400"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000400"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000400"
FT                   /db_xref="GOA:C8VB32"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB32"
FT                   /protein_id="CBF79147.1"
FT                   /translation="MMNVPEKCKVLVVGGGPAGSYAASALAREGIDVVLLEAEKFPRYH
FT                   IGESMLPSMRHFLKFIDAYDKWDAHGFNIKKGGAFRLNWSRPETYTDFIAAGGPGGYAW
FT                   NVIRSEADELLFKHAAECGVKTFDETKVASIEFSSPDLSSGGTHPFGRPVSATWTRKDG
FT                   TSGTISMDYIVDASGRNGLISTKYLKNRSYNKGLKNVASWGYWRGGGVHGVGTHKEGAP
FT                   YFEALKDASGWVWFIPLHNGTHSVGVVQNQEMATEKKRKMAEPSSKGFYLESLEFVPGI
FT                   KELLANAELISEVKSASDWSYSASSYAFPGVRIAGDAGSFIDPFFSSGVHLALSGGLSA
FT                   ATTIAAAIRGDCDENVAASWHDKKTSESYTRFLLVVSSALKQIRSQDEPVISDFDEGSF
FT                   ERAFDLFRPIIQGQADADAKGKLTQAEISKTVEFCFRAFAHVSFEQKEALVQKLKSLGH
FT                   DGDAYDENNRKALEEIEKQLTPEEQTILKTLKGRRMVRPEDSLNIDNFTLDSIDGLAPR
FT                   LEKGKLGLSAAKKAELKFTAHDPLSFLNGEAMAAQKTSPNGNLEINGHTQTNGNHLANG
FT                   HGEVNGHSNAGASSAKSCMADLIAAENDSSQPSFDEATRHRLISSLQQSAEELETPYDT
FT                   VLRYVNAVSQIN"
FT   gene            1130437..1131510
FT                   /locus_tag="ANIA_10889"
FT                   /old_locus_tag="AN10889.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1130437..1131136,1131197..1131510)
FT                   /locus_tag="ANIA_10889"
FT                   /old_locus_tag="AN10889.4"
FT                   /note="transcript_id=CADANIAT00000401"
FT   CDS             join(1130437..1131136,1131197..1131510)
FT                   /locus_tag="ANIA_10889"
FT                   /old_locus_tag="AN10889.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000401"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000401"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000401"
FT                   /db_xref="GOA:C8VB33"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB33"
FT                   /protein_id="CBF79149.1"
FT                   /translation="MLTALSKQGRQTALVCIGGDLGIFKSLAESKAPLSSKQLAEATMA
FT                   DPLLVSRIMRYLVASRLVGETAPDQYVATKKTYVFADPRFEEPIRFFHAVSNRAFQALP
FT                   EFLKETGYQNETQRSAFQKGLGTELQLYPWLKQHPDVLKNFQAAMRLTKDANGVGVMPL
FT                   DSSVSSGHEGVMFVDIGGNTGHQAAEVLSQHPELAGRVTVQDRGEVIKSAPEMKGIQWM
FT                   EHDFFDVQPVKGAKYYYLRAILHNWDDDHAVQILANIVPAMSADSLVAIDEVVVPDRDA
FT                   HLWPAGLDLQMYTIFGTRERTAAQWDAILDRAGLRAVAVKRYAPVMQSSVIFAAAK"
FT   gene            complement(1133295..1135298)
FT                   /locus_tag="ANIA_07068"
FT                   /old_locus_tag="AN7068.4"
FT                   /product="aryl-alcohol oxidase; vanillyl-alcohol oxidase
FT                   (AFU_orthologue; AFUA_3G09500)"
FT   mRNA            complement(join(1133295..1133345,1133449..1133869,
FT                   1133959..1134839,1134885..1135298))
FT                   /locus_tag="ANIA_07068"
FT                   /old_locus_tag="AN7068.4"
FT                   /note="transcript_id=CADANIAT00000402"
FT   CDS             complement(join(1133295..1133345,1133449..1133869,
FT                   1133959..1134839,1134885..1135298))
FT                   /locus_tag="ANIA_07068"
FT                   /old_locus_tag="AN7068.4"
FT                   /product="aryl-alcohol oxidase; vanillyl-alcohol oxidase
FT                   (AFU_orthologue; AFUA_3G09500)"
FT                   /note="transcript_id=CADANIAT00000402"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000402"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000402"
FT                   /db_xref="GOA:Q5AXB2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB2"
FT                   /protein_id="CBF79150.1"
FT                   /translation="MAVYSPLDPFSLALTDKENEMANEVLSTWVGTASKSPTVNILPPG
FT                   LDAPTWADVLQQFRSILGDEGVLCGHEHRVRYIDPYAEQSDEQEKRGSSATLFPVTVEH
FT                   IQAILKICNKHKIPLWTVSRGKNLGYGGPAARVKGSIILDLQCMRKVLEMNDRYSYYTV
FT                   EPGVTFCDIYREIQAQKKDIWCSVPALGWGSVVGNALDRGWGYTPAGDHSNQICGIEVV
FT                   LADGTVVRTGAGAIDNSPCWPLFRGGYGPTYESMFSQSNFGIVTKLSLWATPSPEGFMN
FT                   CRVDVENEEDLVPLIDIFRDLLLHDVIPNHPLIGNVPREMVKRGQRKDFYNGAGAIPDT
FT                   RLKEIQTQLGIGFWSARFGLYGPKELIEYSFERCRRAFQSLPSAKLTGKAFYPPEGKTK
FT                   LSPEDIPPADRTVETGTPSLMALKAVEYRGKDGGHISFSPVLPPEGSSAMAFYRDVKPL
FT                   CAQYGFDYFGGLHLYPRHLAMINMIYFDRTSELERTNANKLFVELVHLARRHGYSEYRA
FT                   HIDYMDLVADQYDFNGCSLRQLNERIKDALDPNGILSPGKQGIWPGRSRELTEKKDSYQ
FT                   GSSQRLLGLILC"
FT   gene            1135948..1137766
FT                   /locus_tag="ANIA_07067"
FT                   /old_locus_tag="AN7067.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1135948..1136169,1136266..1136589,1136659..1137066,
FT                   1137110..1137766)
FT                   /locus_tag="ANIA_07067"
FT                   /old_locus_tag="AN7067.4"
FT                   /note="transcript_id=CADANIAT00000403"
FT   CDS             join(1135948..1136169,1136266..1136589,1136659..1137066,
FT                   1137110..1137766)
FT                   /locus_tag="ANIA_07067"
FT                   /old_locus_tag="AN7067.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000403"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000403"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000403"
FT                   /db_xref="GOA:Q5AXB3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB3"
FT                   /protein_id="CBF79152.1"
FT                   /translation="MSNTIQGEEVQTVTEGRRDTSLKANWRVFAITLYMGIALFEYGFD
FT                   KGAIAGFQAMPGFLQVFGYQTESGEWDIHAGPQQIITSFMILGSVIGSLLTGFVGARIG
FT                   RRYGLMLGSLIVIICVVIMSETTVLGALYFSRLLIGIGNGLLLNFTVLYLQECTPPRFR
FT                   GLCLSMVTCWITIGTTIGMVINHQTNGMMSREAYRIPLYVCYPAPAILILTLPLLPESP
FT                   RWLLQHGKPEAALRSLQFFRQGAYDEVAVQQEFEEMKAAAARERDQEIHQNKWLLFFEL
FT                   FRGHNLRRTIIAVAVGTANAAVGAMFILSYGTYFFQVVLQQANVGDPFKWIIVTNCVGL
FT                   AGLFTTWAIVTHVGRRRIILAGCVICTLPMLVMAAVYSAPNVSADGAGIALVVIVSIYV
FT                   FGFNFGLEPYVYLVAGEMPSQNLRGYTMGLSTAVSFVFAWLSAFTTPYFINPGELNWGP
FT                   KYGYIWFGSGIITTAFLWYYLPEVRGRTLEEIDEMFRNNVPTRAFAKYVCVERMEANAR
FT                   AVSTVKGESKPNATHVEVA"
FT   gene            1138323..1140153
FT                   /locus_tag="ANIA_07066"
FT                   /old_locus_tag="AN7066.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT   mRNA            join(1138323..1138728,1138790..1139083,1139134..1139378,
FT                   1139421..1139922,1139969..1140153)
FT                   /locus_tag="ANIA_07066"
FT                   /old_locus_tag="AN7066.4"
FT                   /note="transcript_id=CADANIAT00000404"
FT   CDS             join(1138323..1138728,1138790..1139083,1139134..1139378,
FT                   1139421..1139922,1139969..1140153)
FT                   /locus_tag="ANIA_07066"
FT                   /old_locus_tag="AN7066.4"
FT                   /product="cytochrome P450, putative (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000404"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000404"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000404"
FT                   /db_xref="GOA:Q5AXB4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB4"
FT                   /protein_id="CBF79154.1"
FT                   /translation="MDDFKIYYYASAGAGIAGILSHLVYFIRGEHHQYAHRWITRALAG
FT                   TAAVAIATLRLTDWQPLLSLILTALISTSYFLGLYSSIGIYRVFFHPLRRFKGPFWARA
FT                   SNLYHMYIIRKSDNYLVMKKMHEKYGPIIRTGPANLSVNDPAAIPLVLSDRATCVKGPW
FT                   YDRSLPLVNLHTVRDKRVHDARRKVFTKAFTPSALREYEERVAVHCEEFVRQMTRLSGK
FT                   PFDASEWFKYFAFDVMGDLGLGREFHMMTSETNRWIPTLLETSMAHVGPTSPVPWMAPI
FT                   LHNLPWAGRGARAWLEFVGSQVKERTQKKSDRRDQILSHLVEAYNQSEKKNIDYQWLRG
FT                   DTRLTIVGGSDTTAATLTFLFYHLAQNPSHVDKLRAELEPLLNGQPRLDPKDVSKAQHL
FT                   NGVIQETLRLHPAIPSGFPRTTPPEGITINGTYIPGGTTIVIPVYALQHDEANYTHAEE
FT                   FIPERWYSRPELIKNRDAFLTWNIGTNGCIGRALALTEMRNLVTYFIHHFSRVKFAHGE
FT                   DGKALLTETKDHFTVGVKPLRLIFEK"
FT   gene            complement(1140396..1142236)
FT                   /locus_tag="ANIA_10888"
FT                   /old_locus_tag="AN10888.4"
FT                   /product="monooxygenase, putative (AFU_orthologue;
FT                   AFUA_7G06960)"
FT   mRNA            complement(join(1140396..1141308,1141370..1141612,
FT                   1141676..1142193,1142231..1142236))
FT                   /locus_tag="ANIA_10888"
FT                   /old_locus_tag="AN10888.4"
FT                   /note="transcript_id=CADANIAT00000405"
FT   CDS             complement(join(1140396..1141308,1141370..1141612,
FT                   1141676..1142193,1142231..1142236))
FT                   /locus_tag="ANIA_10888"
FT                   /old_locus_tag="AN10888.4"
FT                   /product="monooxygenase, putative (AFU_orthologue;
FT                   AFUA_7G06960)"
FT                   /note="transcript_id=CADANIAT00000405"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000405"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000405"
FT                   /db_xref="GOA:C8VB37"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB37"
FT                   /protein_id="CBF79156.1"
FT                   /translation="MHFYRLPDIGVLHFHRGNFRQPTFMNFDITVDWAEQAVSNNITQF
FT                   QPNYEREIRNLIAQSYSHTCEVRTGCEAIACEERDDHSIVEYIARDGSHQFVRTAWLVG
FT                   ADGKRGVVRKRFLEPQGIRQVDGFYKYVGTWVAANLHITIPTPQSHPEFPLWRLGYTPQ
FT                   EVHDAFWPSGFHFCNSSSRPAVSGRFGPPNSGFWRHEYSVEPDDALDDVEEGFWRQFGP
FT                   WTKVPGSQFSKTLRNTLVEFPRDCIRLIRCRPFTFATKIVNRWFSRRTMLIGDAAHVFP
FT                   PFGGQGIAAGIRDAQSLSWRLALMSNLGVSVQLRERILEGWSQERRHAWNSATLATKLN
FT                   GSIVNDRSLVSGWIYRVCMRVVWLFPCLARWRTRRAFRDKLIYNARTCPDGFFLEQKGG
FT                   GRKVAQVWVRRRDTAPVLSDTVFLRNLPRLGLIVFVRSVVDAETAVGEVDEAIYQAGVS
FT                   PELLTTMDVTYYCLASKGIVAKVLEKLGLVDQTYYPCREEELKEEGISPIRGYCETAVQ
FT                   DRYPSSTKYVLMRPDFFVHSLAANGRELRANLQAANEYFSDL"
FT   gene            complement(1142898..1144012)
FT                   /locus_tag="ANIA_10883"
FT                   /old_locus_tag="AN10883.4"
FT                   /product="oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_7G06950)"
FT   mRNA            complement(join(1142898..1143456,1143504..1144012))
FT                   /locus_tag="ANIA_10883"
FT                   /old_locus_tag="AN10883.4"
FT                   /note="transcript_id=CADANIAT00000406"
FT   CDS             complement(join(1142898..1143456,1143504..1144012))
FT                   /locus_tag="ANIA_10883"
FT                   /old_locus_tag="AN10883.4"
FT                   /product="oxidoreductase, putative (AFU_orthologue;
FT                   AFUA_7G06950)"
FT                   /note="transcript_id=CADANIAT00000406"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000406"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000406"
FT                   /db_xref="GOA:C8VB38"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB38"
FT                   /protein_id="CBF79158.1"
FT                   /translation="MTDLKVTPGRIPLPIRNGPAKIQLNRISHVYHSHPDLDAFNAFAK
FT                   DFGFIEDSRDEKSKTIYYRGYGRDKCVYVASESHDGGRHFGGVAFIAQTEEDFLRASRL
FT                   AAATTPVREYTGPGGGKIVTVESPSGTKVHVLWGVEERPVPSKADTQTEVHKGGYNTAL
FT                   QKSRKGGMCIGEFQRFKLGPAMIHKLGHVGYVTALFDEDVAFYTQTFNFVPSDVLYEEN
FT                   AATGAQTDALTFMHLDHGKEYVDHHTVFLSRAPPDFNEKQKMHHCSFEVEDFDTQLLGH
FT                   EYLLSKKWTPIWGVGRHILGSQIFDYWKDPSGFAIEHYADGDLVNEDNETGREKSEGAA
FT                   SMYIWGPVRPEAGVA"
FT   gene            1144369..1145377
FT                   /locus_tag="ANIA_07064"
FT                   /old_locus_tag="AN7064.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_7G07000)"
FT   mRNA            join(1144369..1144836,1144904..1145377)
FT                   /locus_tag="ANIA_07064"
FT                   /old_locus_tag="AN7064.4"
FT                   /note="transcript_id=CADANIAT00000407"
FT   CDS             join(1144369..1144836,1144904..1145377)
FT                   /locus_tag="ANIA_07064"
FT                   /old_locus_tag="AN7064.4"
FT                   /product="fumarylacetoacetate hydrolase family protein
FT                   (AFU_orthologue; AFUA_7G07000)"
FT                   /note="transcript_id=CADANIAT00000407"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000407"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000407"
FT                   /db_xref="GOA:Q5AXB6"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB6"
FT                   /protein_id="CBF79160.1"
FT                   /translation="MAPWESLIRFKATDKNIYWAQLSLEQTPSAGLTLRGFPTIEALEA
FT                   DEQSTHVTVEEASISLFSGMMPIVTGPAPRSSSGNWDQYHLRWSQLPQPRQRGIGEIKT
FT                   ILFKVPRLISPSYQLAIPQCPPMWYKAPPALANPDSDIPFPVQAQNAFPDFEGELTIVL
FT                   RNTIKSVPAASSTSHILGYTIGNDLTARMFQRACGGQYTHAKGYDNFAPLGPRLVHPSV
FT                   FEPSNPASRITTRVNGRVVQDSPFDFIFPIDELLAFLSEGTTIPAGTAIMTGTPAGVGW
FT                   FQDPKRSLADGDVVGVEVKPIGVLRNRIVFEK"
FT   gene            1145909..1147918
FT                   /locus_tag="ANIA_07063"
FT                   /old_locus_tag="AN7063.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1145909..1146183,1146241..1146450,1146512..1146669,
FT                   1146732..1147053,1147111..1147388,1147431..1147644,
FT                   1147720..1147918)
FT                   /locus_tag="ANIA_07063"
FT                   /old_locus_tag="AN7063.4"
FT                   /note="transcript_id=CADANIAT00000408"
FT   CDS             join(1145909..1146183,1146241..1146450,1146512..1146669,
FT                   1146732..1147053,1147111..1147388,1147431..1147644,
FT                   1147720..1147918)
FT                   /locus_tag="ANIA_07063"
FT                   /old_locus_tag="AN7063.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000408"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000408"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000408"
FT                   /db_xref="GOA:Q5AXB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB7"
FT                   /protein_id="CBF79162.1"
FT                   /translation="MGSLGTQEQYFVKDQYIHQRRRIRIIVIGAGISGIAFAYKVRELE
FT                   NVEYQIYEKNEDVGGTWFESRYPGCSCDIPAHSYTYPWAGNPEWSRVYAGAEEIWRFYR
FT                   DRAEEYGVYRTTKFRHQVVGATWNEAQGRWTVKIEDLASGQVFEDSAEVVINCAGVLNK
FT                   WKWPDIPGLHSFNGTLVHTARYPQDLDLTDKRVAVIGAGSSAIQVVPTIQPVVKSLISF
FT                   NRSPTWIAPQFAGHLASAGRATAYTEEEKEKFRNDPDYLRQYRKQIDQALNSRFPNFYK
FT                   GSQEQKASRQIVETAMRERLSKMDPDLREKLIPDFDVGCRRVTPGDGYLEALQEPNVEV
FT                   VRTRIQEVTPEGVVTADGKLYAADVIIAATGYDTSYVPPFPLIGRNGVDLGKRWAQTGA
FT                   EAYLTCAVPDMPNYFMSVVVGPNTPISNGSLMPAIENQLQFALTFARKIQSEGVKAVVV
FT                   SQQATTEFNEHKDAVMKLLTFSGSCNSWYKGGTSDGRIVGPWCGSLNHFLESIAEPRLQ
FT                   DFEFTYETQNRFAYLGRGLSLRDVQKKDLAWYIR"
FT   gene            1148770..1150545
FT                   /locus_tag="ANIA_07062"
FT                   /old_locus_tag="AN7062.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1148770..1149393,1149451..1149745,1149797..1150545)
FT                   /locus_tag="ANIA_07062"
FT                   /old_locus_tag="AN7062.4"
FT                   /note="transcript_id=CADANIAT00000409"
FT   CDS             join(1148770..1149393,1149451..1149745,1149797..1150545)
FT                   /locus_tag="ANIA_07062"
FT                   /old_locus_tag="AN7062.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000409"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000409"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000409"
FT                   /db_xref="GOA:Q5AXB8"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXB8"
FT                   /protein_id="CBF79164.1"
FT                   /translation="MAHIFELAESLSPTANYTNGVKSSETLQFPTTETFTGFNSPSRIE
FT                   GDVENLQITGQIPADIDGTFFRVQPDHRFPPIYESDIHFNGDGNVTAIRITNSTAHFKQ
FT                   RYVRTDRFQAEGQAGRALFGKYRNPYTDNEAVKGVIRTAANTNIFFWRGMLLATKEDGP
FT                   PYAMDPVSLETIGRYDFEGQVLSPTFTAHPKFDPKTGEMVCYGYEAGGNGNDGSCDIVV
FT                   YTIDANGVKTEESWYKAPFCGIIHDCGISDKWVVLPMTPLKCDPERLKKGENHWAWDPE
FT                   EDQWYGVVPRRGGKPGDIRWYRSKNAFQGHTVSCYDTPDGKVVFDLTIADGNVFFFFPP
FT                   VDTPAGTVAKRNKLQNKTTRWIFDPQNTPTNSWVEPAEEFDTYSGEFSRIDDRFTTRKY
FT                   NHYWQAVIDGTKPYDFAKCGSPAGGLFNSLGHFTWDGAVRETFWAGPCATFQEPAFIPR
FT                   AGSTEEGDGYIVALLNHLDVLRNDVCIFDARKIAQGPIAVIHLPFKLRLGLHGNFVEES
FT                   EIRAWKQKRDRELGPVKAASEPLPWQQEEKANGTNGHA"
FT   gene            complement(1150628..1153165)
FT                   /locus_tag="ANIA_07061"
FT                   /old_locus_tag="AN7061.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT   mRNA            complement(join(1150628..1150748,1150809..1151587,
FT                   1151635..1151889,1151941..1152917,1152972..1152984,
FT                   1153049..1153165))
FT                   /locus_tag="ANIA_07061"
FT                   /old_locus_tag="AN7061.4"
FT                   /note="transcript_id=CADANIAT00000410"
FT   CDS             complement(join(1150628..1150748,1150809..1151587,
FT                   1151635..1151889,1151941..1152917,1152972..1152984,
FT                   1153049..1153165))
FT                   /locus_tag="ANIA_07061"
FT                   /old_locus_tag="AN7061.4"
FT                   /product="Putative Zn(II)2Cys6 transcription factor
FT                   (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000410"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000410"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000410"
FT                   /db_xref="GOA:C8VB42"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB42"
FT                   /protein_id="CBF79166.1"
FT                   /translation="MDPIGTFNPQKRPGDNPADQQRRKRARQSCETCKARKTKCVGLEN
FT                   GTCQYCTQLGLLCQVNLKARKRPFYRISEAAYESSIALLRRFVSEEELPELTVEGIQGV
FT                   LSKLDDPANDKERIDANPHSHSHSQSPTELSAAAAALGSSPRSQAGANEGRSSVAAIEE
FT                   QPESVGAEAEAEEGVMEPDEHPALQEERGCMVLDSLGKYRYVGADSSIRWNHAARMAQH
FT                   ATSNTDPKVIAPLKTGLLPPRTPESLTGSARGAGVYLPPAAMAMRYAGFFFQEVHCLYW
FT                   FYSLEQFYGALEETLEDHGAKASASWLCSLYSIFAIGSMAPDNQIARAGKDAEGDDKRA
FT                   ADYLALAKDLVPEVSEEADTESVKAFGLLSLGMHAMCYSVGAYLHLGTAVRIGFSLGLH
FT                   RNISPRKSSSVERERARRLWWTIYTLDHEMAIRFGYPCAVGDESGLVKTPPASEQVMDP
FT                   GPNMPLGYQSLCVSLVRIRKKIGQSCFVVPAQAGGRLPIRQVFESLNALRTWFDEIPQY
FT                   FSREASQPPQHRRAVSILHLRYWSSVIFVTRPFLLYTVSRPAAIKEPAKARCYEEISRK
FT                   CIEAAEQSVDIFKRMVKEQTLSSRILFDCHCIGEAMWILILAVQKLGLEKHRQMLQLCL
FT                   ETVRGMEQFGWCEKVAPELEARVHESGIMQPQSRREMQHTQQSGHRSLDFHSQANGAEA
FT                   NAGGGILPESRADSLEDTTLNFDISEFGLLETFDMDMDNGSGLMDMLADATLSASQLGF
FT                   "
FT   gene            1156514..1159010
FT                   /locus_tag="ANIA_07060"
FT                   /old_locus_tag="AN7060.4"
FT                   /product="tyrosinase (AFU_orthologue; AFUA_1G17430)"
FT   mRNA            join(1156514..1156834,1156898..1157287,1157343..1157684,
FT                   1157738..1157859,1157911..1158052,1158130..1158245,
FT                   1158297..1158597,1158655..1158828,1158894..1159010)
FT                   /locus_tag="ANIA_07060"
FT                   /old_locus_tag="AN7060.4"
FT                   /note="transcript_id=CADANIAT00000411"
FT   CDS             join(1156514..1156834,1156898..1157287,1157343..1157684,
FT                   1157738..1157859,1157911..1158052,1158130..1158245,
FT                   1158297..1158597,1158655..1158828,1158894..1159010)
FT                   /locus_tag="ANIA_07060"
FT                   /old_locus_tag="AN7060.4"
FT                   /product="tyrosinase (AFU_orthologue; AFUA_1G17430)"
FT                   /note="transcript_id=CADANIAT00000411"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000411"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000411"
FT                   /db_xref="GOA:Q5AXC0"
FT                   /db_xref="InterPro:IPR002227"
FT                   /db_xref="InterPro:IPR008922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC0"
FT                   /protein_id="CBF79167.1"
FT                   /translation="MIVVRGIKTRDANGKPYLRQDIDKWYMEQMAGDRIQLTLFVEALA
FT                   LIQRRDLDDLKSYFRLAAIHSAPWCEWDDVPQAQREPGERGYCVHSNYTFPTWHRVYMM
FT                   LYERTLYEAMLEWIHEAVPESHKDIWRKEADKWRLPYWDFARFADRPPSTAGPLPHDID
FT                   HDQLRLPILCMMPNVRITLFTKDSGPIIESRPNPLYKYITPQLMGEFRDPYKIRGETTE
FT                   PDPNDKVQTPKFTLQWDKCNATTKYGLLDGFHESIWADGGQNWLRANYALNEHSNFEKL
FT                   GENPVPTLQDLVHRLFQYGLDSWGAFSSVRYTKDSTKAESASTGIETYSEELDGNVKNA
FT                   LSLDFIHNNVHNFVGGSQFLRPPKEGIHLWGAGHMSSVAMAAFDPIFFIYHNNIDRLTA
FT                   IWQILNWEKWFDDDKSKLIKDNALTPFHKDADRNFWKSDDEILKGIETLYGKPTENLYG
FT                   LLPKHHGDSEDYVITVVYDKFALNGAPYKINLFLDGTRNFGGPDSKGFIASIYNFSGSL
FT                   ESCACGNCQRQKKDGVKCIAQVPATVPMRRFMGKTATAVQTTRDIRDEPKPVYLAVDSL
FT                   GTPVQMDIHVELHKSRREYYKKPFQPDPNDPLEYNFLKHGKQAPDWAFASTRSSDRLEV
FT                   YLISIPEARKVKSCLQELEVKKLGTHEGLWPNLTPELGI"
FT   gene            complement(1159330..1159790)
FT                   /locus_tag="ANIA_07059"
FT                   /old_locus_tag="AN7059.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1159330..1159625,1159679..1159790))
FT                   /locus_tag="ANIA_07059"
FT                   /old_locus_tag="AN7059.4"
FT                   /note="transcript_id=CADANIAT00000412"
FT   CDS             complement(join(1159330..1159625,1159679..1159790))
FT                   /locus_tag="ANIA_07059"
FT                   /old_locus_tag="AN7059.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000412"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000412"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000412"
FT                   /db_xref="GOA:Q5AXC1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC1"
FT                   /protein_id="CBF79169.1"
FT                   /translation="MSHLQYFSYKGFGEHMREALSYNQAVRIGDRIEISGQGGWDPETL
FT                   QVHSDLSRETEQAFANVDLALKDAGGKGWSQVYRVRIFTTEIKNEQATGFLVENLRKWM
FT                   PDHKPVLTCVGVSELALEGMRVEIEAIAQVV"
FT   misc_feature    1159456..1166176
FT                   /note="contig 1.211 1..6721(-1)"
FT   gap             1166177..1166276
FT                   /estimated_length=unknown
FT   misc_feature    1166277..1440851
FT                   /note="contig 1.117 1..274575(-1)"
FT   gene            1170061..1171213
FT                   /locus_tag="ANIA_07058"
FT                   /old_locus_tag="AN7058.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1170061..1170172,1170216..1171213)
FT                   /locus_tag="ANIA_07058"
FT                   /old_locus_tag="AN7058.4"
FT                   /note="transcript_id=CADANIAT00000413"
FT   CDS             join(1170061..1170172,1170216..1171213)
FT                   /locus_tag="ANIA_07058"
FT                   /old_locus_tag="AN7058.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000413"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000413"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000413"
FT                   /db_xref="GOA:Q5AXC2"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC2"
FT                   /protein_id="CBF79171.1"
FT                   /translation="MLGTNLACLFTVHSSHINLIPALIYKILVWRLNIWITGRTLSGGI
FT                   VNLTVGPSETPFDVHIELLCDRSPYFDNLLENRYTEISLQELVFPDDVPEVFADFISWV
FT                   YCGKISGARIARKLSRSLHLFQLWTLAERFQVPELQDIAFAICKELLDAEPAKVVGSEA
FT                   VQHAYSHSSPGSSIRQLAVDMWAARASDFKILRSRMNLPSEFIADLNATRLRTQKLFAF
FT                   EVYMLHPVTNHDDRLCTFVTNLNYAKAEKDTPDTPFSVAPISKQSEPTISDDSPRRASA
FT                   AQLAHNKDKALSSWRRDPDQISRLPPQVLIFTTPVSRALAPSASRLPRSGRRKVRVKLP
FT                   PSTDPSYTKFSTKSILGELYRIENNGEKV"
FT   gene            complement(1171783..1173169)
FT                   /locus_tag="ANIA_07057"
FT                   /old_locus_tag="AN7057.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1171783..1171923,1172073..1172126,
FT                   1172518..1172590,1172751..1172830,1172890..1172967,
FT                   1173104..1173169))
FT                   /locus_tag="ANIA_07057"
FT                   /old_locus_tag="AN7057.4"
FT                   /note="transcript_id=CADANIAT00000414"
FT   CDS             complement(join(1171783..1171923,1172073..1172126,
FT                   1172518..1172590,1172751..1172830,1172890..1172967,
FT                   1173104..1173169))
FT                   /locus_tag="ANIA_07057"
FT                   /old_locus_tag="AN7057.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000414"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000414"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000414"
FT                   /db_xref="GOA:Q5AXC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC3"
FT                   /protein_id="CBF79173.1"
FT                   /translation="MRTTKTTADTINGLLDKTASSTLRRLDLGFLTIGFLGYVFKYLDQ
FT                   INISNAYVSGMQDNLKLYSNELGYFTTYFNISTTNQVLWNVFTCCLSTVTNEKQGVCTI
FT                   FVALIAFVLLPRYFGYPPDMERLDGHGPPHLVNYEVFVTFIRPYEAGTLPILRTKTSEL
FT                   "
FT   gene            complement(1173729..1176088)
FT                   /locus_tag="ANIA_07056"
FT                   /old_locus_tag="AN7056.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1173729..1174018,1174148..1174509,
FT                   1174632..1174663,1174712..1175196,1175743..1176088))
FT                   /locus_tag="ANIA_07056"
FT                   /old_locus_tag="AN7056.4"
FT                   /note="transcript_id=CADANIAT00000415"
FT   CDS             complement(join(1173729..1174018,1174148..1174509,
FT                   1174632..1174663,1174712..1175196,1175743..1176088))
FT                   /locus_tag="ANIA_07056"
FT                   /old_locus_tag="AN7056.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000415"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000415"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000415"
FT                   /db_xref="GOA:Q5AXC4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC4"
FT                   /protein_id="CBF79175.1"
FT                   /translation="MNISISKFASFLIATDLLGGAFQAETFDYVVVGGGTAGVTLAVRL
FT                   AEASHSVALIEAGTYYEDSWPFAAIPGADVIPVGSDPDAKFGADWGFVTAPQAGADGRR
FT                   IHFARGKCVGDLHTQRLAKRILFDEHKSAIGVEVANGFGYLSNITASREVIISAGAFQY
FT                   PQLLMVSGIGPAEQLAKHGIEVISDLQVGQNMWDHPFFALSYRVNVETLTRAANDLLYL
FT                   GTTFLDYTTKHTGPLTNPVADFIAFEKIPSSHRTAFSAETEKHLAGFPEDWPEVETEAI
FT                   QYMSGAGYFRPPVINPNWLATEADQEAAIAIFKCIRDIFASDGMAPVILGDEYYPGNGT
FT                   QADAEILRFIQKNVMTLWHPSCTNKMGTKDDPSAVLDSKARVFGVGGLRVANASSFPFL
FT                   PPGHPQSTVFKQLYYCFYTAVGNLGGLNIYNRSMNPFLGCGMRKASNYNINLPKDSSSA
FT                   ARSYSFEWARAIFFLEQACQIMAQKYRIAYLMTLFNTASRGRLGPA"
FT   gene            complement(1176655..1177968)
FT                   /locus_tag="ANIA_07055"
FT                   /old_locus_tag="AN7055.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1176655..1176687,1176741..1177785,
FT                   1177883..1177968))
FT                   /locus_tag="ANIA_07055"
FT                   /old_locus_tag="AN7055.4"
FT                   /note="transcript_id=CADANIAT00000416"
FT   CDS             complement(join(1176655..1176687,1176741..1177785,
FT                   1177883..1177968))
FT                   /locus_tag="ANIA_07055"
FT                   /old_locus_tag="AN7055.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000416"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000416"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000416"
FT                   /db_xref="GOA:Q5AXC5"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC5"
FT                   /protein_id="CBF79176.1"
FT                   /translation="MRLSEGLAFLSVLPAALAARPFLNEPDTAIEEVLGDTPEGTLPDL
FT                   ESMLGLPDFEWAAKRYLNASSYTYYRNGAAGEWSYRNNLEVYGRFRFRPRVMVDITQIE
FT                   KTLPTTILGHNFSAPFYISPCASAGLAHPDAEANFVKAAYEENILYIPALLATLSMDEI
FT                   AAAKPEDGSQVLFQQAYLNSNDTATQQVFDDAERLGAKAIVWTIDSPADGNRHRANRYG
FT                   VGSSDSDYTLSTWEFYAKLQNMTTLPIVLKGIQHVEDVKLAIKHGVPAIILSNHGGRQL
FT                   DSSPSSLEVALEVYQEDPDLFNQIEIYADGGIRYGADVLKLLSLGVKAVGLGRSFMYAN
FT                   AYGAEGVRHAIQLLKHEIAIDAANLGVPDLKKIDASYVKWANNGWFT"
FT   gene            complement(1179164..1180710)
FT                   /locus_tag="ANIA_07054"
FT                   /old_locus_tag="AN7054.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1179164..1179447,1179953..1179992,
FT                   1180096..1180174,1180213..1180265,1180383..1180410,
FT                   1180577..1180710))
FT                   /locus_tag="ANIA_07054"
FT                   /old_locus_tag="AN7054.4"
FT                   /note="transcript_id=CADANIAT00000417"
FT   CDS             complement(join(1179164..1179447,1179953..1179992,
FT                   1180096..1180174,1180213..1180265,1180383..1180410,
FT                   1180577..1180710))
FT                   /locus_tag="ANIA_07054"
FT                   /old_locus_tag="AN7054.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000417"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000417"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC6"
FT                   /protein_id="CBF79178.1"
FT                   /translation="MLSVLFRLLFDFLTYLSSGIWTREAVFKVFKAIVAGAALIWDRYI
FT                   ISTDIRKKMWLKYSRGSEKPYPHTLWWIFCGMPNSVNENGKLTGLITMMPGLPIWNCIK
FT                   SSKQCRIGFFGATAAGLFHALCRLDTTASCTHPTPSGVPISLEPTQILNKTSDPRARTN
FT                   PAPPCPGHFALHPLIVLTLIGSSVSDFPPIKATLSCPPAPNH"
FT   gene            complement(1182237..1183125)
FT                   /locus_tag="ANIA_07053"
FT                   /old_locus_tag="AN7053.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1182237..1182967,1183029..1183125))
FT                   /locus_tag="ANIA_07053"
FT                   /old_locus_tag="AN7053.4"
FT                   /note="transcript_id=CADANIAT00000418"
FT   CDS             complement(join(1182237..1182967,1183029..1183125))
FT                   /locus_tag="ANIA_07053"
FT                   /old_locus_tag="AN7053.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000418"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000418"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000418"
FT                   /db_xref="GOA:Q5AXC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC7"
FT                   /protein_id="CBF79180.1"
FT                   /translation="MKPVIVLSTFTTILALGISLPPKSEDQAHADNHDLSERQVYYCDK
FT                   YSAGLCACFCRYNKYDYYKCAPNYCQCYNVYAPDCYYAYYYYSSGGYPSPAEYEVHPPK
FT                   YPHCPAYPYCSERPYTSEYTTSTTYTSTVTDHPTTTSDGGASGDSSPTDGAGGTSPGGS
FT                   SPTNSPGGGGSSPGGSSPSNPPSGGSTGGSTGGSSAGGSSGGSTGGSTGGSTGGSTGGS
FT                   SGGSSGGSTGGSSSGSSSPGGSSGDSVPGGSSPGGSSPGGGSGRGGSLPSSVP"
FT   gene            complement(1184181..1185200)
FT                   /locus_tag="ANIA_07052"
FT                   /old_locus_tag="AN7052.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1184181..1184997,1185052..1185200))
FT                   /locus_tag="ANIA_07052"
FT                   /old_locus_tag="AN7052.4"
FT                   /note="transcript_id=CADANIAT00000419"
FT   CDS             complement(join(1184181..1184997,1185052..1185200))
FT                   /locus_tag="ANIA_07052"
FT                   /old_locus_tag="AN7052.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000419"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000419"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000419"
FT                   /db_xref="GOA:Q5AXC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC8"
FT                   /protein_id="CBF79182.1"
FT                   /translation="MPQALQDAAFIPSPTKSWNTNRLGARFGVDIVSAATAGALTCPVI
FT                   TVIDRAIIEKAAKGVPIRETITSAFRSIIRKPSGFFLGTPFLLIYTLYTSTYLTANTID
FT                   TVTSMLKDKPFSTVFPGTAKFITTTAVNMGICVYKDARFARIFGKQSSQPQGQPQPQPP
FT                   LAKSPSNGLFTATMPASCHPSPLTVGAPKVPKISYTLFCLRDSITIFASFNIPALIAPS
FT                   IPDSIAATPAMKAAIAQFSCPALMQFVSTPMHLLGLDLYNRQPPGGLGWRERVGRIRRD
FT                   YVASCFARMGKIVPAYGIGGVVNVRMRAELMGWLEGLDQA"
FT   gene            complement(1185558..1187128)
FT                   /gene="metG"
FT                   /locus_tag="ANIA_07051"
FT                   /old_locus_tag="AN7051.4"
FT                   /product="Cystathionine beta-lyase (EC 4.4.1.8)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q12607]"
FT   mRNA            complement(join(1185558..1186754,1186813..1187128))
FT                   /gene="metG"
FT                   /locus_tag="ANIA_07051"
FT                   /old_locus_tag="AN7051.4"
FT                   /note="transcript_id=CADANIAT00000420"
FT   CDS             complement(join(1185558..1186754,1186813..1186992))
FT                   /gene="metG"
FT                   /locus_tag="ANIA_07051"
FT                   /old_locus_tag="AN7051.4"
FT                   /product="Cystathionine beta-lyase (EC 4.4.1.8)
FT                   [Source:UniProtKB/TrEMBL;Acc:Q12607]"
FT                   /note="transcript_id=CADANIAT00000420"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000420"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000420"
FT                   /db_xref="GOA:Q5AXC9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006238"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXC9"
FT                   /protein_id="CBF79184.1"
FT                   /translation="MSASSTLKKAFPQVDAEGHNLPPSPAPSSPHGSRRYNIATELVYT
FT                   ESNDQYNASSVPIYQSATFKQSSHEGGGEYDYTRSGNPTRTHLERHLAKIMSAQRALVV
FT                   SSGMAALDVITRLLRPGDEVVTGDDLYGGTNRLLKYLSTNGGIIVHHVDTTNPDKVKEV
FT                   LTDKTAMVLLETPTNPLIKIVDIPTIAAASHEANPNCLVIVDNTMMSPLLLSPLELGAD
FT                   VVYESGTKYLSGHHDVMAGVIAVNDPALGERLYFPINASGCGLSPFDSWLLMRGVKTLK
FT                   VRMDQQQANAQRIAEFLESHGFKVRYPGLRSHPQYDLHHSMARGAGAVLSFETGDVSVS
FT                   ERIVANAKLWAISVSFGCVNSLISLPCRMSHASIDAKTRKERAMPEDLIRLCVGIEDVD
FT                   DLIDDLRRAVSVSTRNRVFWVMLIFSSWYKLALSTSLWTALKRTRRSLRSQVMKEYGYG
FT                   "
FT   gene            complement(1187620..1191182)
FT                   /locus_tag="ANIA_07050"
FT                   /old_locus_tag="AN7050.4"
FT                   /product="FarA [Source:UniProtKB/TrEMBL;Acc:Q1WD26]"
FT   mRNA            complement(join(1187620..1187668,1187722..1188705,
FT                   1188755..1188937,1188989..1189417,1189469..1190341,
FT                   1190404..1190525,1190628..1190645,1190834..1190858,
FT                   1191046..1191182))
FT                   /locus_tag="ANIA_07050"
FT                   /old_locus_tag="AN7050.4"
FT                   /note="transcript_id=CADANIAT00000421"
FT   CDS             complement(join(1187620..1187668,1187722..1188705,
FT                   1188755..1188937,1188989..1189417,1189469..1190341,
FT                   1190404..1190525,1190628..1190645,1190834..1190858,
FT                   1191046..1191182))
FT                   /locus_tag="ANIA_07050"
FT                   /old_locus_tag="AN7050.4"
FT                   /product="FarA [Source:UniProtKB/TrEMBL;Acc:Q1WD26]"
FT                   /note="transcript_id=CADANIAT00000421"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000421"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000421"
FT                   /db_xref="GOA:Q5AXD0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD0"
FT                   /protein_id="CBF79186.1"
FT                   /translation="MSAAAGDKFIDSSASRPSPTPSTAGSTGTAGISVRAGANGQMSFR
FT                   RQRASRACETCHARKVRCDAASLGVPCTNCVAFSIECRIPTPKRKKSQAKPREVGDSNG
FT                   DGDDKSQSQEKREESLPMPGKDAFGYQNSNTSNTNAMAVNGMPVTTLTEAQAAQQASQN
FT                   STYAQFMKPKFARAPIKEAGRVAYLGESSNLSLLVQDRHGTTDVVHYPLPPNIRGSRAR
FT                   VSDLDNLELDILHQRGAFLLPPKSLCDELVDAYFKWVAPVVPIVNRSRFMRQYRDPKNP
FT                   PSLLLLQAILLAGSRVCTNPQLMDANGSTTPAAMTFYKRAKALYDANYEDDRVTIVQAL
FT                   VLLGWYWEGPEGWCPKPIMVTGLLTCPDVTKNVFYWTRVAIIVAQGSGMHRSVESSQLS
FT                   KPDKRLWKRIWWTLFTRDRSVAVALGRPICINTDDADVEMLTEEDFVEDEIDIAAEYPP
FT                   DPVHVQFFLQYVKLCEIMGLVLSQQYSVASKSRRMNAMDLTHSDMALADWLQNCPREVC
FT                   WQRQRHHFWAALLHANYYTTLCLLHRAHMPPASSVPSSYRVEEMAYPSRTIAFQAAGII
FT                   TSIVENLQTHNEIRYTPAFIVYSLFSALIMHVYQMRSSVPSIVATCQERINICMQALKD
FT                   VSKVWLVAKMVHTLFESILGNKLLEERLQKAAGKRHQRVKPDSNHSNQHLPSRRPDPPP
FT                   KRKFDDMDLALPNGGPTPPVSYERSRPQTPAATPSRELPQSTMSIPQTSPTAAKDGLPG
FT                   AGNSRANTRPTTPFNAQFSLPATPPDLFLVTRTSPNLSPSLWENFQPDQLFPDGTAIFP
FT                   ELTSPQNTTVDPQLQMQSQLHTHDMVQQQMPPRTSLAGTQGSPEILSSMPPAIGMQGQP
FT                   QQMYGMDPQQSWQMPGLDPTVAGAMDNASQDDNWSSSSRSGPTAPTTLNVEDWFQFFGI
FT                   NGSFGEMAV"
FT   gene            complement(1193905..1197146)
FT                   /locus_tag="ANIA_07049"
FT                   /old_locus_tag="AN7049.4"
FT                   /product="GPI ethanolamine phosphate transferase 1 (EC
FT                   2.-.-.-) [Source:UniProtKB/Swiss-Prot;Acc:Q5AXD1]"
FT   mRNA            complement(join(1193905..1194740,1194805..1194913,
FT                   1194981..1195110,1195163..1195190,1195318..1195350,
FT                   1195404..1195409,1195496..1197146))
FT                   /locus_tag="ANIA_07049"
FT                   /old_locus_tag="AN7049.4"
FT                   /note="transcript_id=CADANIAT00000422"
FT   CDS             complement(join(1193905..1194740,1194805..1194913,
FT                   1194981..1195110,1195163..1195190,1195318..1195350,
FT                   1195404..1195409,1195496..1197146))
FT                   /locus_tag="ANIA_07049"
FT                   /old_locus_tag="AN7049.4"
FT                   /product="GPI ethanolamine phosphate transferase 1 (EC
FT                   2.-.-.-) [Source:UniProtKB/Swiss-Prot;Acc:Q5AXD1]"
FT                   /note="transcript_id=CADANIAT00000422"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000422"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000422"
FT                   /db_xref="GOA:Q5AXD1"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AXD1"
FT                   /protein_id="CBF79187.1"
FT                   /translation="MARLGRTGFLTLAVVFHLIYAYSIFDIYFVSPIVSGMRPFRVERE
FT                   PGSEAPAKRLVLFVADGLRADKAFELTPDPDLPEESNGDDLTFLAPFIRSRVLSHGTFG
FT                   ISHTRVPTESRPGHVALIAGLYEDVSAVTTGWKLNPVNFDSVFNRSRHTWSWGSPDILL
FT                   MFKEGAVPGRVDADTYGEELEDFTSDATALDIWVFDKVKELFASAKKDPELNAKLREDK
FT                   NVFFLHLLGLDTTGHGYRPYSKEYLRNIKLVDQGIKEISQLVEDFYGDDKTAFVFTADH
FT                   GMSDWGSHGDGHPDNTRTPLVVWGSGVAPPKQPQHGVPSGHEDGVSADWHLNQVQRNDV
FT                   AQADVAALMAYLVGLDFPTNSVGQLPLEYVDGTPREKALAALANTQEVLEMYHVKEEHK
FT                   KAALLRYRPFEPLASDYGNSAEQRLAMIKDLIDRGFYEDAIETSAALFATALEGLRYLQ
FT                   TYDWLFLRTIVTFGYVGWIAYALTTVIHLHVLHGASESDRTTASISFFSSVLVALFSVF
FT                   LYQGSPWRYYLYGFFPIFFWEEVFARRKAFHAGRAGALLLPKRDLHSNKVEDIDTITYG
FT                   GAFMLLTGLLYLLFEDEILGTSHQPAAVSRKGSRNIMGLQLGMVLLALIVTRSSAASLQ
FT                   AKQGLPFGNQVVGWGVLIASLLLPFAHRLYPNSHYLHRLMIIFLTFSPTFIILTISYEG
FT                   LFYFAFCMTLVTWVRLEHATYVYTAKPVAKQAQETIEPPKKANPGATTVVDGETYRFRT
FT                   LTVSDARVALFFFFLLQSAFFSTGNIASISSFSLDSVYRLIPVFNPFSQGALLILKLLI
FT                   PFAIISANLGILNRRLEVAPSALFMVVMAISDVMTLNFFYMVRDEGSWLDIGTTISHFC
FT                   IASFLCTFVAGLEFLSEVFISGVDFGLRTDAITASVPDIVNGITSKGQKDVPNGVEDKE
FT                   "
FT   gene            complement(1197693..1199344)
FT                   /locus_tag="ANIA_07048"
FT                   /old_locus_tag="AN7048.4"
FT                   /product="chromosome segregation protein (Pcs1), putative
FT                   (AFU_orthologue; AFUA_4G03980)"
FT   mRNA            complement(join(1197693..1197931,1197967..1198404,
FT                   1198453..1199344))
FT                   /locus_tag="ANIA_07048"
FT                   /old_locus_tag="AN7048.4"
FT                   /note="transcript_id=CADANIAT00000423"
FT   CDS             complement(join(1197693..1197931,1197967..1198404,
FT                   1198453..1199344))
FT                   /locus_tag="ANIA_07048"
FT                   /old_locus_tag="AN7048.4"
FT                   /product="chromosome segregation protein (Pcs1), putative
FT                   (AFU_orthologue; AFUA_4G03980)"
FT                   /note="transcript_id=CADANIAT00000423"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000423"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000423"
FT                   /db_xref="GOA:Q5AXD2"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020981"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD2"
FT                   /protein_id="CBF79189.1"
FT                   /translation="MPKRKATARLSGLIESDDEDVMQPGADAARNHDERPTKKTRGRPR
FT                   SKSAEMKPTAEAEIPATQETEATTTRRGTRRGRPKGSRNSGQTALDATEDQDGSVRAGP
FT                   NAAAQNTVVDKTTVPDKTAQTTKPTRTTRGAARGKKKTTAQKQLETDGEFQYTPTGARQ
FT                   QKVIEGPEEQSEPTDRERRKSATAASEEDIPDAEPTVKEVVEETFIQEEASEPVTAPPE
FT                   KQRHLSSWASQSSPTKRKSGGDERGTEPELRRRLGDLTKKYDTLENRYRNLKEIGIAEA
FT                   NANMEKLKKQCESMANVSNNLVNSLKAELEAQRALGQKSRALQKELRERDAEVARLTAE
FT                   AEQSASQLAAAQSEVKALQTKLAAARNTAATLEQAAVKVPGSAVKGGGLNRAAAAANAE
FT                   AAQAAQYAQLKEDLYSDLTGLIIRDVKKRDEDNLYDCIQTGVNGKANLGIALHFKLVVP
FT                   HSSTADFETAEFQYIPLLDANRDRGLVDILPEYLTVDITFVRQQASKFYTRVMDALTKR
FT                   RQSQG"
FT   gene            1199587..1201034
FT                   /locus_tag="ANIA_07047"
FT                   /old_locus_tag="AN7047.4"
FT                   /product="membrane-spanning ATPase, putative
FT                   (AFU_orthologue; AFUA_4G03990)"
FT   mRNA            join(1199587..1199811,1199865..1201034)
FT                   /locus_tag="ANIA_07047"
FT                   /old_locus_tag="AN7047.4"
FT                   /note="transcript_id=CADANIAT00000424"
FT   CDS             join(1199749..1199811,1199865..1201034)
FT                   /locus_tag="ANIA_07047"
FT                   /old_locus_tag="AN7047.4"
FT                   /product="membrane-spanning ATPase, putative
FT                   (AFU_orthologue; AFUA_4G03990)"
FT                   /note="transcript_id=CADANIAT00000424"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000424"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000424"
FT                   /db_xref="GOA:Q5AXD3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD3"
FT                   /protein_id="CBF79190.1"
FT                   /translation="MASARSPRWQQIQDLIMIAGTSATAYFLVRHLLSRLDFDPDRQKK
FT                   EEQQRKSAAILRKLDGNLDENSSGESGGKTRKGDLVLNQYEQAIAMDVVAPEDIPVSFK
FT                   DIGGLEDIIEELKESVIYPLTMPHLFSSTSSLLTAPSGVLLYGPPGCGKTMLAKALAHE
FT                   SGASFINLHISTLTEKWYGDSNKLVNAVFSLARKLQPSIVFIDEIDAVLGTRRSGEHEA
FT                   SGMVKAEFMTHWDGLTSANSLGEPQRVVVLGATNRMQDIDEAILRRMPKKFPVELPPAA
FT                   QRLGILSLVLKDTKIDRQNFDLHYLVKAMAGMSGSDIKEACRDAAMVPVREFIRQKTAQ
FT                   GLKITSVDPSEVRGLRTEDFFASAGGAQRFIPVATQNIPPETSSEKEWSTEDEAASENG
FT                   TQQSRTTQAEA"
FT   gene            complement(1202806..1203537)
FT                   /locus_tag="ANIA_07046"
FT                   /old_locus_tag="AN7046.4"
FT                   /product="Triacylglycerol lipase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q876R3]"
FT   mRNA            complement(join(1202806..1202933,1202985..1203537))
FT                   /locus_tag="ANIA_07046"
FT                   /old_locus_tag="AN7046.4"
FT                   /note="transcript_id=CADANIAT00000425"
FT   CDS             complement(join(1202806..1202933,1202985..1203537))
FT                   /locus_tag="ANIA_07046"
FT                   /old_locus_tag="AN7046.4"
FT                   /product="Triacylglycerol lipase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q876R3]"
FT                   /note="transcript_id=CADANIAT00000425"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000425"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000425"
FT                   /db_xref="GOA:Q5AXD4"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD4"
FT                   /protein_id="CBF79191.1"
FT                   /translation="MRHFKLAFPWLAHLAIGSLLLPLQSSAYQSNPTPIVTLSNGPKSS
FT                   TTFIGRSLPEFDQELFLGIKYADKPVRFTPSSLKTVYASNDSDSGPIRHSSVSTRGTVL
FT                   YNATQYGYDCPGYGSDTTTLLNMGLIEMNEDCLNLNVIRPRRHGDEELLPVLVWIFGGG
FT                   WQQGATADPRYVLTICVAADRSLNGRPILGVSISYRLAAFGFLDSEEVRVRLVFVFTLS
FT                   SWQA"
FT   gene            complement(1204250..1207828)
FT                   /locus_tag="ANIA_07045"
FT                   /old_locus_tag="AN7045.4"
FT                   /product="FK506-binding protein 1B (FKBP)(EC
FT                   5.2.1.8)(Peptidyl-prolyl cis-trans
FT                   isomerase)(PPIase)(Rapamycin-binding protein)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AXD5]"
FT   mRNA            complement(join(1204250..1206123,1206720..1206779,
FT                   1206941..1206972,1207186..1207248,1207354..1207414,
FT                   1207492..1207556,1207680..1207828))
FT                   /locus_tag="ANIA_07045"
FT                   /old_locus_tag="AN7045.4"
FT                   /note="transcript_id=CADANIAT00000426"
FT   CDS             complement(join(1204250..1206123,1206720..1206779,
FT                   1206941..1206972,1207186..1207248,1207354..1207414,
FT                   1207492..1207556,1207680..1207828))
FT                   /locus_tag="ANIA_07045"
FT                   /old_locus_tag="AN7045.4"
FT                   /product="FK506-binding protein 1B (FKBP)(EC
FT                   5.2.1.8)(Peptidyl-prolyl cis-trans
FT                   isomerase)(PPIase)(Rapamycin-binding protein)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AXD5]"
FT                   /note="transcript_id=CADANIAT00000426"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000426"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000426"
FT                   /db_xref="GOA:P0CY37"
FT                   /db_xref="GOA:P0CY38"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CY37"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CY38"
FT                   /protein_id="CBF79193.1"
FT                   /translation="MNPPQGVTKTILRPGNGRDSPHTGDTVIIDYTGYLYDDTRGENEY
FT                   FMGTQFDTSQGRGPLKTEIGVGKVILGWDKGVQQMTLGEKAILTISSDNGYGKRGFPGL
FT                   IPPDSGLVLNIPCIGEHFQNKSSGEILIAQAIQRISTLKGMSSRSGSADTFTQRSDSNL
FT                   RPRRLISLDDVRDNNGRQPSSSGISTTGSSELPTLRSRGATPSPRPSRNVSPIPMGHPS
FT                   RATQPRSDARPGNSLGGFTPNGKYQDPFTESSRAAVDFLDASWSSLQGIASSLLGSDTA
FT                   RPTSNGGPRSHARKPSRPDYLAKHRAVSTSTWGPSGPTTPEIGAGTQDERQAMVHAKKM
FT                   EALLLADTDPSWNLNSRHKRRDSNDRTVQSRADTDQDEEALVYVHQVQPTDTITGVTIR
FT                   YGCQAAIFRKVNGFWPSDSIQARKTVLLPVDCCSIKGRPVKAREETDLLQDVPSRPSIE
FT                   DPSGSSIVPAPSPEKSTFSRISEQPGTEPEAESDQIWKHESWVQIDGFAEPVEIGRVPR
FT                   RALGFFPRTRRKSVSYSDSEPVRGRLQTPTISTASSPIQPSSSPNADQHDSYHAGSPAS
FT                   RGPGSKPKGRHRRRPSGLELSGTGVGTLDRNVNLPGPAMDGLSKFFAQHLPTLAPKQAP
FT                   PNFDSLSGNSSTVASINSTSLDSIGGAVEGWVRKITARAKSSINDLQQGTSSSQNQAMP
FT                   PETRRRGFSDLIELEDGVESRNSSGLLAGTGWKPDLTRSGSGYVNGANLRERFPSASPS
FT                   TSRTRTGLDRTKGD"
FT   gene            complement(1208471..1210022)
FT                   /locus_tag="ANIA_07044"
FT                   /old_locus_tag="AN7044.4"
FT                   /product="histidinol phosphatase (Eurofung)"
FT   mRNA            complement(join(1208471..1208719,1208819..1209355,
FT                   1209496..1209634,1209784..1209909,1209988..1210022))
FT                   /locus_tag="ANIA_07044"
FT                   /old_locus_tag="AN7044.4"
FT                   /note="transcript_id=CADANIAT00000427"
FT   CDS             complement(join(1208471..1208719,1208819..1209355,
FT                   1209496..1209634,1209784..1209909,1209988..1210022))
FT                   /locus_tag="ANIA_07044"
FT                   /old_locus_tag="AN7044.4"
FT                   /product="histidinol phosphatase (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000427"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000427"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000427"
FT                   /db_xref="GOA:Q5AXD6"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD6"
FT                   /protein_id="CBF79195.1"
FT                   /translation="MLLPKQMFIYAIYPTNSVDYHAVVLISLISPPLHPIYVQFLISGG
FT                   ASYPIALVLHSGQFCPGHAKDSLEEVIQLAIAKNFQVFCLTEHMPRGEQDYYPEEIEAN
FT                   QTKAWMIANEANYFREATRLREKYADQIKILIGFECDWIRPESRTLVETSMRAFPFEFF
FT                   MGSIHHTKTIPIDYDREMYEKARDLAGGSDEKLFEAFFDEQLDMLKQLKPVVVGHFDLI
FT                   RLKSDDPERSFKQWPGVWERILRNLDYVAGYGGILELNSAALRKGMSEPYPKAEICQEF
FT                   LARGGRFCFSDDSHGLDQIGLNYARMLEFIETNTDIKTLYYLDLGNEPETQTPVDSRFP
FT                   RTVVKSISMEEVKKMAFWQTN"
FT   gene            complement(1210332..1210963)
FT                   /locus_tag="ANIA_07043"
FT                   /old_locus_tag="AN7043.4"
FT                   /product="Phosphopantetheinyl transferase B Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:Q4FCS4]"
FT   mRNA            complement(join(1210332..1210464,1210515..1210963))
FT                   /locus_tag="ANIA_07043"
FT                   /old_locus_tag="AN7043.4"
FT                   /note="transcript_id=CADANIAT00000428"
FT   CDS             complement(join(1210332..1210464,1210515..1210963))
FT                   /locus_tag="ANIA_07043"
FT                   /old_locus_tag="AN7043.4"
FT                   /product="Phosphopantetheinyl transferase B Fragment
FT                   [Source:UniProtKB/TrEMBL;Acc:Q4FCS4]"
FT                   /note="transcript_id=CADANIAT00000428"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000428"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000428"
FT                   /db_xref="GOA:Q5AXD7"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD7"
FT                   /protein_id="CBF79197.1"
FT                   /translation="MKPNPIPFPLALNIGTDIVHLPRITRLISRPGGYLTRFTRRILSE
FT                   QEQRDFRTRFSLPPLDSPICQPNMARKMDITVTPDMARWLAGRFAAKEAARKAARGGAK
FT                   GVSWKDAVVSVADDGAEGRPDIILFDRDEDCRRGRVGRLSISHDGEINRHDATRYDLHA
FT                   GCHATAEKLDLVLDPARITQHVCTMNRLQS"
FT   gene            complement(1211231..1211959)
FT                   /locus_tag="ANIA_11543"
FT                   /old_locus_tag="AN11543.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1211231..1211511,1211637..1211764,
FT                   1211875..1211959))
FT                   /locus_tag="ANIA_11543"
FT                   /old_locus_tag="AN11543.4"
FT                   /note="transcript_id=CADANIAT00000429"
FT   CDS             complement(join(1211460..1211511,1211637..1211764,
FT                   1211875..1211922))
FT                   /locus_tag="ANIA_11543"
FT                   /old_locus_tag="AN11543.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000429"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000429"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000429"
FT                   /db_xref="GOA:C8VB61"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB61"
FT                   /protein_id="CBF79199.1"
FT                   /translation="MVVYYNIAGRQIGSHHLSLGILSSLFGGIYLATRGGGAAKKPAAP
FT                   PIQASSKDEEVFIQDFLKQMNGEGDKKADH"
FT   gene            1212618..1213901
FT                   /locus_tag="ANIA_07042"
FT                   /old_locus_tag="AN7042.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1212618..1212760,1212905..1213472,1213527..1213901)
FT                   /locus_tag="ANIA_07042"
FT                   /old_locus_tag="AN7042.4"
FT                   /note="transcript_id=CADANIAT00000430"
FT   CDS             join(1212621..1212760,1212905..1213472,1213527..1213901)
FT                   /locus_tag="ANIA_07042"
FT                   /old_locus_tag="AN7042.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000430"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000430"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000430"
FT                   /db_xref="GOA:Q5AXD8"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD8"
FT                   /protein_id="CBF79200.1"
FT                   /translation="MFWGSRKEEPSEPPALPPVKRGKLSPQLQKIVDSDDTNPYDDVYS
FT                   YYSVDSTDTNYRYAGYATRLRTLLLSAHRYVAYTSDVGESFRPVAHPILVRSAYAVSWA
FT                   YLLGDVGHEGYKAYLRNRRVLAPPCEAYKDSRDLTHQQIVMGMATGNVGGSLSSADWGE
FT                   GQKQVDSDTLTPWPTAHIPLIEDYRVVMAKRAVFQSIASMGLPALTIHSVVRYSGRALK
FT                   GAKSTFARTWVPIGLGLSVVPFLPYIFDHPVDEAVDWTFRTGLRIYGGEDAVKPLPQHP
FT                   HAAGGTTHEEDSTSLSHFHIKAPEVADAASANVSWDEYKEELRRAKERRKREREERGES
FT                   GILAMLGFGSKQKEEKGKTE"
FT   gene            complement(1214646..1217111)
FT                   /locus_tag="ANIA_07041"
FT                   /old_locus_tag="AN7041.4"
FT                   /product="mucin family signaling protein Msb2, putative
FT                   (AFU_orthologue; AFUA_4G04070)"
FT   mRNA            complement(1214646..1217111)
FT                   /locus_tag="ANIA_07041"
FT                   /old_locus_tag="AN7041.4"
FT                   /note="transcript_id=CADANIAT00000431"
FT   CDS             complement(1214646..1217111)
FT                   /locus_tag="ANIA_07041"
FT                   /old_locus_tag="AN7041.4"
FT                   /product="mucin family signaling protein Msb2, putative
FT                   (AFU_orthologue; AFUA_4G04070)"
FT                   /note="transcript_id=CADANIAT00000431"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000431"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000431"
FT                   /db_xref="GOA:Q5AXD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXD9"
FT                   /protein_id="CBF79202.1"
FT                   /translation="MVSQTALIAAALSLAGLELVAAQQPNAHHEHKQLKRQLFGSSDQS
FT                   NNLGWLESFLSSNSDSGTTSSTTTSQNSGVTAASSKDSDPDVVIVPITLSVDENGKTHT
FT                   ITGTANTGVATGAASTTTKQSTVAEVTASATTESQPTATSTSSSTREDTDLSGILGSLL
FT                   GGSSSSDSSASTTQTGISRAATDSTISETETTDSSTSPSSTSSSGGLLESLLGGSDSSA
FT                   STSTSSTTSSSTSTSDGLLGLNLNLNGDSTSSTSTTTGSSPSATSTSSSNGLLENLLGD
FT                   STSTSTSTSTADSSSATSTSSSGGLLDGLLGGDSTSSSGTTTATSPSATSTSGGLLDGL
FT                   FGTDSTSSSATTSVTTPTSTSGGLLGGLFGTDSSSSASTAVIPSSTSTSSGGFLDSLFG
FT                   TDSSTPTPLPGASSTSGGLIGNILPTISVSVPESTPTGSSDAVASSTPTLLPPDLTSIL
FT                   IPSSSSGATSVPVIPQVPTSSVAATPTPSVGISVPSSSSVSVQPAPTTTSTASSEDSTT
FT                   TVGTTTTTTVEAEPTDWVPTSIIIEPSPTETETSSEETTTVAPTQLPGSISPAGGVPDA
FT                   PEGSTLIQLGFTRELRYSFVATHSLSSSQIFLYIPQGLMYALEEASSDIAMFAISPYDS
FT                   EATTGYIATVAQAYIPTEKVDVLRKLLHNPISRLYDQPSESVKTLMSMIDPSIPLLVGE
FT                   YDDSSFGGSSGSGDGSGSDGDGDDSNDTYDDSTAGASSSGSTKASSVGIGVGVVAGAAA
FT                   YGAGMFWVARRYRKKRQLHRRTSSTADQMSDRGGSIFAGGGRLSRGSGSQRTQMISAPV
FT                   MAENSLGWN"
FT   gene            complement(1220317..1220965)
FT                   /locus_tag="ANIA_07040"
FT                   /old_locus_tag="AN7040.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1220317..1220415,1220519..1220668,
FT                   1220754..1220836,1220893..1220965))
FT                   /locus_tag="ANIA_07040"
FT                   /old_locus_tag="AN7040.4"
FT                   /note="transcript_id=CADANIAT00000432"
FT   CDS             complement(join(1220317..1220415,1220519..1220668,
FT                   1220754..1220836,1220893..1220965))
FT                   /locus_tag="ANIA_07040"
FT                   /old_locus_tag="AN7040.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000432"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000432"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000432"
FT                   /db_xref="GOA:Q5AXE0"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXE0"
FT                   /protein_id="CBF79204.1"
FT                   /translation="MSKIHIRTNNAPAPAPFLSQATVVGNIVFCSGQLGIDPKTGKMVE
FT                   GTVKDRTRQIIKNLSAVLEASGSSLADVAKVNVFLADMKDFQDMNEVYMEGFPEPRPAR
FT                   TCVCVKTLPMNSDVEIECSAVVTRPTKAKL"
FT   gene            1221819..1223707
FT                   /locus_tag="ANIA_07039"
FT                   /old_locus_tag="AN7039.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1221819..1222089,1222171..1222576,1222647..1222788,
FT                   1222859..1223707)
FT                   /locus_tag="ANIA_07039"
FT                   /old_locus_tag="AN7039.4"
FT                   /note="transcript_id=CADANIAT00000433"
FT   CDS             join(1221819..1222089,1222171..1222576,1222647..1222788,
FT                   1222859..1223707)
FT                   /locus_tag="ANIA_07039"
FT                   /old_locus_tag="AN7039.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000433"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000433"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000433"
FT                   /db_xref="GOA:Q5AXE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXE1"
FT                   /protein_id="CBF79206.1"
FT                   /translation="MDRPGSRPLSPVLEEKKRDRDPKVRKGLRESNQIETKLGPESDTD
FT                   TNADDDDDDTLPLEIDVHGLRAKVYLNCADVDIVPARYLEKADRSPILKRTPWIFRTAK
FT                   DGRCVNIAKWSKVDIRYRGVFKTLKKVPMFSGGLFGGSTCRISSAADEHEEVSTGWRTS
FT                   TDSRSGWGSGSCSASSKSSSSKVDFEEAVKAQGQAIYALLDEVLSMLGIKREAESHREM
FT                   FFLRPRLVSCQPEYWTGYRVKHRDSPLTAGSVSLDYEPSRGMPRAVMPVTTTSEPVVSL
FT                   KRTLEGEFKLLLSQLLINVHRLSPPGDKIPDQEAFLIGLHGSKLHILRGIFPGQKTSKL
FT                   WSGRHNPREVQSTNRLFRRRGGGSGNGPEGQDGRFYSKTNLERFMEQVEWNQLSNPDNE
FT                   VHPRSFQVLGSCEYDLWLKCDFGAAMKMLAGLIMYLMSGQARCGVLQDVFERYPYDEET
FT                   EPESDVGGDAAGMEKAAQKQKEIEEEEERLRKREREKKEEEKARLTEFEAIKGSMKDKI
FT                   GGLTEGLRQPWCDWVWEDKGCDTGERDGEEALIVGGPY"
FT   gene            complement(1223650..1225984)
FT                   /locus_tag="ANIA_07038"
FT                   /old_locus_tag="AN7038.4"
FT                   /product="conserved serine-threonine rich protein
FT                   (AFU_orthologue; AFUA_4G04090)"
FT   mRNA            complement(1223650..1225984)
FT                   /locus_tag="ANIA_07038"
FT                   /old_locus_tag="AN7038.4"
FT                   /note="transcript_id=CADANIAT00000434"
FT   CDS             complement(1223840..1225984)
FT                   /locus_tag="ANIA_07038"
FT                   /old_locus_tag="AN7038.4"
FT                   /product="conserved serine-threonine rich protein
FT                   (AFU_orthologue; AFUA_4G04090)"
FT                   /note="transcript_id=CADANIAT00000434"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000434"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000434"
FT                   /db_xref="GOA:C8VB66"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB66"
FT                   /protein_id="CBF79208.1"
FT                   /translation="MAVAQTRTSIRRLSKASGVNARYLSLSAQIRELWTCSHRYHNSND
FT                   LHRKHTRLIFHNHHRSQRPHHPPRSQRIIYPKYQYQSWWSPGWGWGWGGFNSGFLGFQD
FT                   TPTRYRYGQDDDKGGWEDRAKRRMEWIKKEIEADPYAALFGRRSQPLGLNWGNKLESGL
FT                   MSLWRSVFGLGEDMSNTNKGKGAKVIDSTLKGQDDSGRTSVDEKVREPMTRDGDMQRRP
FT                   STDFRGAGFEFDPISGRMVPVRSEPWGTPEERGKERQGDGQYVENKSIPAGDDLPQEKA
FT                   EADSNTLSEPNVLDSATKKDSTVPESSERFQGASGPSIVSESQIYASAPTQEASNCLNE
FT                   TVQAAKDEINAETQTHAQVERPVPPQNDNHEAVTPATMPFTQSPYSQKHNTTERSLAEH
FT                   SVSKAGPDRAGFLSRRENQMPKLVTAESQPYTAVDNRDKDIELLSARDIRAAYEPRRLS
FT                   IEAEIEAETPKQLDEPSASQTDLKDTHGKSPVNKLGGSVNMPGGPTAPFSGLPDGQALN
FT                   EDLLQNEPSTATQSSVTETYRIFAYDPSSAKVTEAETISSLQEPSEHLHPTEVLTRLAN
FT                   PAKFSPCLNQMHAEGYEIVSGGGDILVFRKAPAGSSKTIDRLASPSQEPSTESAQLADK
FT                   DVQGGNFSGQDAPRKQSRKSPQKATVSKVFRRMLVGGLATGGTCYALGVVSEYFRTGGK
FT                   DGFGIDGFTEFESERRHLER"
FT   gene            complement(1226269..1228328)
FT                   /locus_tag="ANIA_07037"
FT                   /old_locus_tag="AN7037.4"
FT                   /product="vacuolar protein sorting protein (Vps36),
FT                   putative (AFU_orthologue; AFUA_4G04100)"
FT   mRNA            complement(join(1226269..1227922,1227972..1228107,
FT                   1228201..1228328))
FT                   /locus_tag="ANIA_07037"
FT                   /old_locus_tag="AN7037.4"
FT                   /note="transcript_id=CADANIAT00000435"
FT   CDS             complement(join(1226294..1227922,1227972..1228107,
FT                   1228201..1228301))
FT                   /locus_tag="ANIA_07037"
FT                   /old_locus_tag="AN7037.4"
FT                   /product="vacuolar protein sorting protein (Vps36),
FT                   putative (AFU_orthologue; AFUA_4G04100)"
FT                   /note="transcript_id=CADANIAT00000435"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000435"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000435"
FT                   /db_xref="GOA:C8VB67"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB67"
FT                   /protein_id="CBF79209.1"
FT                   /translation="MFFKALELTTALRPLLLPDETLLFVQDAVGLYDGKYKIANYQDGH
FT                   AYLTSHRVCYVAVDEPRKYSVGIDLKDVDRAEYQAGFWKSSPKIIIYPKPVKNAGGPRS
FT                   SSASPSRLPLRAQLSGAQSPLSQTSAHNYTPPPPNLLNATWVCPICSFSNPVPSNFDPS
FT                   TATNSTPIPPCLACGIKPPFTTVLKAAITAATSREAPPISPAVSQAQQECQSARTGQAN
FT                   AANGGGSIMCPRCTFLNHPSLLDCEICGASLASANFLRASGQDRSDSPAPVFEDGNIRN
FT                   SAITDHIKLSFREGGEKIFLERLKGALIQRKWLLYNAPPAPQRPSQSTPTSAPDQTGLS
FT                   TSVDTQARSPGVGIAGLERRGLEARKNNELVIGNAFEDLEALMASAKQIVALAETLARE
FT                   SGMASDESSAETSAVLSESAAALGMITTKDMLGSSAGNLYLSELSRTLAEYLTDDRKGV
FT                   LQREGGIMSLIDLWAVFNRSRNGVELVSPSDFKRAAELWERLKLPVRLRRFKSGLLVVQ
FT                   RYDWSDEKTLRQLQDWMADLRRIPPPDPVPWDWRLFGRPVTAQEAAQRFGWSVGVAAEE
FT                   LEMAEDKGVFCREEGIEGLKFWSNFIIFDPTPDDPSNLAVSLLEV"
FT   gene            complement(1231125..1232729)
FT                   /locus_tag="ANIA_10876"
FT                   /old_locus_tag="AN10876.4"
FT                   /product="CDF divalent metal cation transporter (Eurofung)"
FT   mRNA            complement(join(1231125..1231442,1231493..1231572,
FT                   1231622..1231850,1231902..1232005,1232182..1232329,
FT                   1232389..1232433,1232478..1232527,1232594..1232729))
FT                   /locus_tag="ANIA_10876"
FT                   /old_locus_tag="AN10876.4"
FT                   /note="transcript_id=CADANIAT00000436"
FT   CDS             complement(join(1231125..1231442,1231493..1231572,
FT                   1231622..1231850,1231902..1232005,1232182..1232329,
FT                   1232389..1232433,1232478..1232527,1232594..1232675))
FT                   /locus_tag="ANIA_10876"
FT                   /old_locus_tag="AN10876.4"
FT                   /product="CDF divalent metal cation transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000436"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000436"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000436"
FT                   /db_xref="GOA:C8VB68"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB68"
FT                   /protein_id="CBF79211.1"
FT                   /translation="MHFSITRSQRLGAAIGISAAFFLTEISVGFYTHSLALVADAFHYL
FT                   NDLVGFIVAFVALKVSNSEHSPKELSFGWQRAQILGAFFNGSLLFALGISIFLQSIERF
FT                   ITLHQHHHHHDDHRHPDSEAEPQGQGDFEQQRELENKAKHHDHRHTEHEELPIFGGHDL
FT                   GMMGVLLHVAGDAANNLGVMVAALVIWLTRYEARYYADPATSMGIAAMIFLSALPLIRQ
FT                   SGLILLESAPNKLDPADVKHDLEKIPGVLSVHELHIWRLNQHKTLASVHVAMLDHSISE
FT                   FSEVSRTLQECFHAWGVHSVAIMPEIATPLSARALTQNQSDISGMEVSEKYLNLCQSQC
FT                   SSFCRELACCG"
FT   gene            complement(1233725..1234651)
FT                   /locus_tag="ANIA_10880"
FT                   /old_locus_tag="AN10880.4"
FT                   /product="AN1 zinc finger protein (AFU_orthologue;
FT                   AFUA_4G04280)"
FT   mRNA            complement(1233725..1234651)
FT                   /locus_tag="ANIA_10880"
FT                   /old_locus_tag="AN10880.4"
FT                   /note="transcript_id=CADANIAT00000437"
FT   CDS             complement(1233725..1234651)
FT                   /locus_tag="ANIA_10880"
FT                   /old_locus_tag="AN10880.4"
FT                   /product="AN1 zinc finger protein (AFU_orthologue;
FT                   AFUA_4G04280)"
FT                   /note="transcript_id=CADANIAT00000437"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000437"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000437"
FT                   /db_xref="GOA:C8VB69"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB69"
FT                   /protein_id="CBF79213.1"
FT                   /translation="MSPISVGRGSGASESFTQLADADLESIGRHCEYSYCNQLDFLPFR
FT                   CMSCRGTFCLDHRTETAHRCPNEGEWARRRDGSASATSTPTQKPTIYNSDQCAHVSCKT
FT                   LINTLKDPGVKCPECKREYCLRHRLKEEHDCAKIAPRSGTGGAATPNETVRSMFAKVRL
FT                   WGKDKSQAAAAAAAAARPKPKANSPAARMVAVNAMKKAAKGDASVPADKRIYLHVVGTS
FT                   ETQGTDPPNGDFWFDSRWKVGRILDDAARRLGVENLNNRVGEEARLRIFHVESGDFLEF
FT                   SDTLGGGKVKTGDTIVMLRGAGVILGK"
FT   gene            1236195..1237469
FT                   /locus_tag="ANIA_07035"
FT                   /old_locus_tag="AN7035.4"
FT                   /product="aminopeptidase, putative (AFU_orthologue;
FT                   AFUA_4G04210)"
FT   mRNA            join(1236195..1236386,1236437..1237183,1237236..1237469)
FT                   /locus_tag="ANIA_07035"
FT                   /old_locus_tag="AN7035.4"
FT                   /note="transcript_id=CADANIAT00000438"
FT   CDS             join(1236195..1236386,1236437..1237183,1237236..1237469)
FT                   /locus_tag="ANIA_07035"
FT                   /old_locus_tag="AN7035.4"
FT                   /product="aminopeptidase, putative (AFU_orthologue;
FT                   AFUA_4G04210)"
FT                   /note="transcript_id=CADANIAT00000438"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000438"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000438"
FT                   /db_xref="GOA:Q5AXE5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AXE5"
FT                   /protein_id="CBF79215.1"
FT                   /translation="MKLSTALVLGATATGAWSYAIPQLEQEVLELPETHYEQQEKYLIE
FT                   LSPYQTRWVTEEEKWALKLDGVNFIDITEDRNYGLFPTLDAGSYVNYPQKMGYVDTVKG
FT                   LIAGLSMDNMRKDLENFTSFHTRYYKSSSGVESAQWLYDQVSKVVRDSGADKFGATVQK
FT                   FDHSWGQFSIIARIPGLSKKTVVLGAHQDSINLFLPSFLGAPGADDDGSGTVTILEALR
FT                   GLLKSDIVAHGQSPNTIEFHWYSAEEGGMLGSQAIFSKYKKNQADVKAMLQQDMTGYVQ
FT                   GTKHAGQKESIGVMTDFVDPALTSFLKNTIVTYCAIPFVETKCGYACSDHTSASKYGYP
FT                   SAMATESTMENSNKHIHTTDDKISYLSFDHMLEHAKLTLGFAYELAFAAL"
FT   gene            1239695..1240753
FT                   /locus_tag="ANIA_07034"
FT                   /old_locus_tag="AN7034.4"
FT                   /product="myo-inositol-1(or 4)-monophosphatase
FT                   (AFU_orthologue; AFUA_4G04200)"
FT   mRNA            1239695..1240753
FT                   /locus_tag="ANIA_07034"
FT                   /old_locus_tag="AN7034.4"
FT                   /note="transcript_id=CADANIAT00000439"
FT   CDS             1239695..1240753
FT                   /locus_tag="ANIA_07034"
FT                   /old_locus_tag="AN7034.4"
FT                   /product="myo-inositol-1(or 4)-monophosphatase
FT                   (AFU_orthologue; AFUA_4G04200)"
FT                   /note="transcript_id=CADANIAT00000439"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000439"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000439"
FT                   /db_xref="GOA:Q5AXE6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXE6"
FT                   /protein_id="CBF79217.1"
FT                   /translation="MEYTGPYAKELEIACLTVQRAAILTKKLIQAVDKGSFDKQDDTPV
FT                   TISDFGAQSLIIAAIHRHFPDDDIVGEEDSKTLRAEPELLERTWDLVSSTRLEDDESEK
FT                   LLSAPSSKDEMLHLIDLGAQGSCKPKGRTWVLDPVDGTATFMRGQQYAVCLGLVEDGKQ
FT                   IIGVTGCPNLNLEFGGIQEDLADVAGRGLMVFAVAGEGAWTRPMGGGSLVPATKIQPVE
FT                   QITDPKDIRFVDCKSATSSNYELNERLAASLGAPWPPAADLWSAQLRYIAIAVGGCNVL
FT                   IKIPRKASYRSKVWDHVGGMLIVEELGLTVSDLEGKPVDLTLGRTLSGCEGMIIAPTSI
FT                   HGRLVEAVKQIK"
FT   gene            1241584..1243024
FT                   /locus_tag="ANIA_07033"
FT                   /old_locus_tag="AN7033.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1241584..1241624,1241698..1241914,1241971..1242410,
FT                   1242485..1243024)
FT                   /locus_tag="ANIA_07033"
FT                   /old_locus_tag="AN7033.4"
FT                   /note="transcript_id=CADANIAT00000440"
FT   CDS             join(1241618..1241624,1241698..1241914,1241971..1242410,
FT                   1242485..1242705)
FT                   /locus_tag="ANIA_07033"
FT                   /old_locus_tag="AN7033.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000440"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000440"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000440"
FT                   /db_xref="GOA:Q5AXE7"
FT                   /db_xref="InterPro:IPR013920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXE7"
FT                   /protein_id="CBF79219.1"
FT                   /translation="MAFYNPFARRESHGQYPLTAYRVLAPLSWALVVVVGIYYSIHEPS
FT                   DISNGWTIWSQLGRQFTAFSVNVTVVEIYWVVLLLSQIFYLFQLFNKDTAIVALAGNSA
FT                   AHFILNNLFVVAWILLWTRNHFWPAEIIVIAHIINQHLLFWRIRNLPPISHIAVVAGPY
FT                   AWTLITLFWTGAAAVRSHNLASNIAANIFLWIIFLIGSIHIFLAVDDLLGYSLSLLTFG
FT                   LAVAQTSRKSHLHLQWIFAWVIFGVFLLDSLYVTSAKYVGRNVLFRSPREPESSDAERA
FT                   PLLNDATAPASTS"
FT   gene            1244166..1247350
FT                   /locus_tag="ANIA_07032"
FT                   /old_locus_tag="AN7032.4"
FT                   /product="Chitin synthase A (EC 2.4.1.16)(Chitin-UDP
FT                   acetyl-glucosaminyl transferase A)(Class-II chitin synthase
FT                   A) [Source:UniProtKB/Swiss-Prot;Acc:P30584]"
FT   mRNA            join(1244166..1245948,1245996..1246180,1246230..1246396,
FT                   1246444..1247350)
FT                   /locus_tag="ANIA_07032"
FT                   /old_locus_tag="AN7032.4"
FT                   /note="transcript_id=CADANIAT00000441"
FT   CDS             join(1244166..1245948,1245996..1246180,1246230..1246396,
FT                   1246444..1247350)
FT                   /locus_tag="ANIA_07032"
FT                   /old_locus_tag="AN7032.4"
FT                   /product="Chitin synthase A (EC 2.4.1.16)(Chitin-UDP
FT                   acetyl-glucosaminyl transferase A)(Class-II chitin synthase
FT                   A) [Source:UniProtKB/Swiss-Prot;Acc:P30584]"
FT                   /note="transcript_id=CADANIAT00000441"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000441"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000441"
FT                   /db_xref="GOA:P30584"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30584"
FT                   /protein_id="CBF79220.1"
FT                   /translation="MDCQNGRRANRTVRFARTAESRYPERYSYEYDPEETLSRAAPSMR
FT                   NAPTIPPPTASGADEMRYTASRPASPARPWSPTRAADWVRPPSAAASYYERADINGSPR
FT                   PGTPSSRYGGSPRRPLPPAPLFSKPGTTTQDTKIDIGDGEEDPFGGGGRTISSRHGPQG
FT                   SVQSFTSESTFIADETDLEKVDLDEYEEESNETKSMVDPNLHYGPAPEKQSRRGVRNAQ
FT                   MAKKEVQLVNGELILECKIPTILHSFLPRRDDREFTHMRYTAVTCDPDDFTQRGYKLRQ
FT                   QIGRTMRETELFICITMYNEDETHFTRTMHGVMQNISHFCSRSKSRTWGKDGWKKIVVC
FT                   IISDGRKKVHPRTLNALAALGVYQEGIAKNVVNQKQVNAHVYEYTTQVSLDSDLKFKGA
FT                   EKGIVPCQVIFCLKEHNQKKLNSHRWFFNAFGRALQPNICILLDVGTRPEPTALYHLWK
FT                   AFDQDSNVAGAAGEIKASKGKNMLGLLNPLVASQNFEYKMSNILDKPLESVFGYITVLP
FT                   GALSAYRFFALQNDAEGNGPLNQYFKGETLHGKDADVFTANMYLAEDRILCWELVAKRE
FT                   ERWVLRFVKSAVGETDVPDSIPEFISQRRRWLNGAFFAAVYSIVNVKQLWKTDHSLARK
FT                   ILLQIESVYQLLQLIFTYFGLANFYLAFFFIAGSLTDEKIDPFGHNMGKYIFIVLRYAC
FT                   VLVMCLQFIFSMGNRPQGAKKLYLSSMIVYSIVMAYTAFCTLYLIVLELMAKTGHDVPI
FT                   TMSDTLFVNIVVSLLSTVGLYFFTSFMYLDPWHMFTSSAQYFALLPSYICTLQCYAFCN
FT                   THDVTWGTKGDNTINTDLGTARIINGSIVEVEMPSEQLDIDSGYDAALRNLRDRLEVPD
FT                   PGVSESQQQEDYYRAVRTYMVSVWMVANVVLAMAVSEVYGVGSSGTNVYLAIILWSVAV
FT                   LAIIRAIGSTAYAVLYLIQKLVEGKAKFQAGNIASANASAAGSSLGTKSNVSYGSKGLN
FT                   MTDRINETKWAISRGMQKAMFWKK"
FT   gene            1247683..1249923
FT                   /locus_tag="ANIA_07031"
FT                   /old_locus_tag="AN7031.4"
FT                   /product="SAC3/GANP domain protein (AFU_orthologue;
FT                   AFUA_4G04110)"
FT   mRNA            join(1247683..1248008,1248071..1248619,1248806..1249328,
FT                   1249379..1249923)
FT                   /locus_tag="ANIA_07031"
FT                   /old_locus_tag="AN7031.4"
FT                   /note="transcript_id=CADANIAT00000442"
FT   CDS             join(1247936..1248008,1248071..1248619,1248806..1249328,
FT                   1249379..1249595)
FT                   /locus_tag="ANIA_07031"
FT                   /old_locus_tag="AN7031.4"
FT                   /product="SAC3/GANP domain protein (AFU_orthologue;
FT                   AFUA_4G04110)"
FT                   /note="transcript_id=CADANIAT00000442"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000442"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000442"
FT                   /db_xref="GOA:Q5AXE9"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXE9"
FT                   /protein_id="CBF79222.1"
FT                   /translation="MSSGIPPWRASASATATTAVYPSHATPAYIPVQARRSLTTPASTS
FT                   ATPAPQPKTTAADAGNRKRVEWPEPVRKYVQRCFAPENQISGVSRQEMEAKLRSVITEA
FT                   AQSDVLDKINWEAQPLPQVMVQNDKLRILTNPEASTWGTPFAAQSPKRTASDDASRKRK
FT                   SAEYQTESNACPPWRQTNKSNVFEDRVTYSPTDKRQRIESKNSNIRPLPVLMKTLDLLK
FT                   KKWKKDNNYTYICDQFKSLRQDLTVQHIRNEFTVSVYEIHARIALEKGDLGEYNQCQTQ
FT                   LRALYAQQLGGHPTEFKAYRILYFIHTRNWTAMNDALADLIPADKRSAAVKHALDVRSA
FT                   LALGNYHRFFQLYLATPNMGAYLMDMFVDRERLSALSAICKAYKPDVKIRFITEELGFE
FT                   SDEQSARFILDHSSEDMLLEKDGSVRLLTGGKAAQLFEAAKADAHRVIDIKGQI"
FT   gene            1251889..1254194
FT                   /locus_tag="ANIA_07030"
FT                   /old_locus_tag="AN7030.4"
FT                   /product="protein kinase activator Bem1, putative
FT                   (AFU_orthologue; AFUA_4G04120)"
FT   mRNA            join(1251889..1252030,1252156..1252284,1252432..1253208,
FT                   1253256..1254194)
FT                   /locus_tag="ANIA_07030"
FT                   /old_locus_tag="AN7030.4"
FT                   /note="transcript_id=CADANIAT00000443"
FT   CDS             join(1252025..1252030,1252156..1252284,1252432..1253208,
FT                   1253256..1254194)
FT                   /locus_tag="ANIA_07030"
FT                   /old_locus_tag="AN7030.4"
FT                   /product="protein kinase activator Bem1, putative
FT                   (AFU_orthologue; AFUA_4G04120)"
FT                   /note="transcript_id=CADANIAT00000443"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000443"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000443"
FT                   /db_xref="GOA:Q5AXF0"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF0"
FT                   /protein_id="CBF79224.1"
FT                   /translation="MKALRRSLKGEKDSKPHHHHQHHHQQHHHLSITPKSAVAILPPKK
FT                   VIKALYDYQPEPGNTQELAFSKGDFFHVISREDDSDWYEACNPLIPTARGLVPVTFFEV
FT                   IGKTQRDSSGSIDLGKKKEPHDSGFADRATSSGSEFGSGSSKSYQSHPAFPRTSMMGKA
FT                   GGGAMVYGVVQYDFQAERPDELDAKAGEAIIVIAQSNPEWFVAKPIGRLGGPGLIPVSF
FT                   IELRDMQSGQAVADPLEAVRRAGVPKVEEWKKMTAEYKNSSISLGKIETTGSMQSVTSG
FT                   MERMSVRQSADHVSHMSQNGHANAYHNRNASKASIAPSTHQQPPPHSQQPLVAPIAASI
FT                   PRYCFDNDKYWYIIEVKMEDGRCWELSRYYHDFYDFQIALLTQFEEEAGNRGKPRTLPF
FT                   MPGPVAHVTDAISDGRRHNLDEYIKKLLAMPPHITRCALVRQLFAPRPGDFEIDPSAFG
FT                   EDARFSGGSQHSSGHELSPSASRQSSQQQNGPSERSSHSHSHSHSHSHQRSQTSSSIPN
FT                   GKPPMVRQQSSLTQVSTSSGGALKVKVNFQDDLIAIRVPSDINVQQLKEKLMDRLKIND
FT                   EIVVQYKDEASGAYVDLISDSDLDTAIQRNSKLTLYVGLA"
FT   gene            1255161..1257716
FT                   /locus_tag="ANIA_07029"
FT                   /old_locus_tag="AN7029.4"
FT                   /product="mitochondrial ATPase (Afg1), putative
FT                   (AFU_orthologue; AFUA_4G04130)"
FT   mRNA            join(1255161..1255957,1256013..1256529,1256593..1256951,
FT                   1257283..1257338,1257484..1257716)
FT                   /locus_tag="ANIA_07029"
FT                   /old_locus_tag="AN7029.4"
FT                   /note="transcript_id=CADANIAT00000444"
FT   CDS             join(1255161..1255957,1256013..1256529,1256593..1256951,
FT                   1257283..1257338,1257484..1257716)
FT                   /locus_tag="ANIA_07029"
FT                   /old_locus_tag="AN7029.4"
FT                   /product="mitochondrial ATPase (Afg1), putative
FT                   (AFU_orthologue; AFUA_4G04130)"
FT                   /note="transcript_id=CADANIAT00000444"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000444"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000444"
FT                   /db_xref="GOA:Q5AXF1"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF1"
FT                   /protein_id="CBF79226.1"
FT                   /translation="MSGPSARLCAHHIAGAPSRPALIRPVAVRTSKPVFVAGCRRNFHG
FT                   LRTAPSRKHNGYGWCNPGFVNHATHQRRSAATAAEVATPVKASAAEAAGPLAEYNARVE
FT                   QGRLRDDPYQRQIIEQLQDLYERLKSYKAPAVVRPSIESLDAAPKKSFFGSLFGKAPAK
FT                   PESSIPEDLPKGLYMYGDVGCGKTMLMDLFYETLPSNIRSKSRIHFHNFMQDVHRRMHV
FT                   VKMKFGNDFDALPLVAADIAEKSSVLCFDEFQCTDVADAMILRRLLESLMSHGVVLVTT
FT                   SNRHPDDLYLNGIQRQSFIPCITLLKTVLTVINLNSPTDYRKIPRPPSGVYHHPLGPEA
FT                   DQHAQKWFDYLGDPINDPPHPTTQEVWGRKIQVPLASGKAAKFSFQQLIGAATGAADYL
FT                   ELVRNYEAFIVTDVPGMTLHQRDLARRFITFIDAVYESRAKLVLTTATPLTNLFISESE
FT                   VKTSLDDNGEHTDLSDAMRMMMDDLGLSMKALKTSSLFSGDEERFAFARALSRLSEMGS
FT                   KEWVERGLLGKSGLDAEGKEKEKNEHEAYLKARSRWSEDNIFNPRLHIAICPVTFQFYA
FT                   SLWLSISGLAPDEADTCSFFILEQGQNPAALLGASDQEYWWLYKGLTGIMHLEISKLSF
FT                   RYQLKFSVGQFPLVTASL"
FT   gene            complement(1258757..1261746)
FT                   /locus_tag="ANIA_07028"
FT                   /old_locus_tag="AN7028.4"
FT                   /product="hypothetical protein similar to thymidylate
FT                   synthase (Broad)"
FT   mRNA            complement(join(1258757..1259867,1260324..1260403,
FT                   1260562..1260639,1260688..1260745,1260790..1261110,
FT                   1261157..1261491,1261544..1261627,1261679..1261746))
FT                   /locus_tag="ANIA_07028"
FT                   /old_locus_tag="AN7028.4"
FT                   /note="transcript_id=CADANIAT00000445"
FT   CDS             complement(join(1258817..1259867,1260324..1260403,
FT                   1260562..1260639,1260688..1260745,1260790..1261110,
FT                   1261157..1261491,1261544..1261627,1261679..1261696))
FT                   /locus_tag="ANIA_07028"
FT                   /old_locus_tag="AN7028.4"
FT                   /product="hypothetical protein similar to thymidylate
FT                   synthase (Broad)"
FT                   /note="transcript_id=CADANIAT00000445"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000445"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000445"
FT                   /db_xref="GOA:C8VB77"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="UniProtKB/TrEMBL:C8VB77"
FT                   /protein_id="CBF79227.1"
FT                   /translation="MRNITRPLARSMSTTPPRKAMPSALTFDLHRKCSTTKARASTLHL
FT                   PHGSVSLPIFMPVATQASLKGLTYDQLKQTGCMLCLNNTYHLGLKPGQAVLDEVGGAHA
FT                   LQGWNRNILTDSGGFQMVSLLELAEVTEEGVRFLSPHDGTPMLLTPEHSISLQNSIGSD
FT                   IIMQLDDVIATTSPDHERIHEAMERSVRWLDRCIAAHKTPETQNLFCIIQGGLDLELRK
FT                   RCCAEMVARDTPGIAIGGLSGGEAKEDFCKVVDTCTGLLPEYKPRYVMGVGYQEDLIVG
FT                   VALGADMFDCVWPTRTAPREEGGSGITRAYLHHLAAKETAGAHLIESSTTGYKMTVSLD
FT                   TPRENATTATAGPQPPAHNPSHEEHQYLNLIRQILAEGEHRPDRTGTGTRSIFAPNPMR
FT                   FSLSKPSPTNPSTKIPILPLLTTKRVFLRAVLAELLWFISGSTSSIPLSEAGIKIWDGN
FT                   GSREFLDKVGLSHREVGDLGPVYGFQWRHFGAEYVDAHTDYTGQGVDQLADIVRKIKET
FT                   PFDRRIIMSAWNPADLKKMALPPCHMFAQYYVSYPEGIEDGKGKGKGELSCLLYQRSCD
FT                   MGLGVPFNIASYALLTHIIAHATDLNPGKLIHTMGDAHVYLDHVEALEEQLTREPTDFP
FT                   ELKIKREDRGSGVIDGWKEEEFEVIGYAPHKAIKMKMSV"
FT   gene            1262579..1264460
FT                   /locus_tag="ANIA_07027"
FT                   /old_locus_tag="AN7027.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_4G04250)"
FT   mRNA            join(1262579..1262653,1262707..1262830,1262882..1262957,
FT                   1263003..1263084,1263134..1263236,1263301..1263704,
FT                   1263764..1263952,1264134..1264460)
FT                   /locus_tag="ANIA_07027"
FT                   /old_locus_tag="AN7027.4"
FT                   /note="transcript_id=CADANIAT00000446"
FT   CDS             join(1262591..1262653,1262707..1262830,1262882..1262957,
FT                   1263003..1263084,1263134..1263236,1263301..1263704,
FT                   1263764..1263952,1264134..1264460)
FT                   /locus_tag="ANIA_07027"
FT                   /old_locus_tag="AN7027.4"
FT                   /product="MFS transporter, putative (AFU_orthologue;
FT                   AFUA_4G04250)"
FT                   /note="transcript_id=CADANIAT00000446"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000446"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000446"
FT                   /db_xref="GOA:Q5AXF3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF3"
FT                   /protein_id="CBF79229.1"
FT                   /translation="MEKEVAPDGVVNATDAELVIQNSGGDAAVQAREKALIWKQDLHII
FT                   PLSAAIYLLCYLDRSNIGNAKIMNSETGNDLLTETNMSSYEYTIALMVFLIAYALFEVP
FT                   SNYFLKKLKPSRWIAFLMLSWGAVTMGLGGAHNYAQVTGLRFLLGVLEAGLFPGLVYFL
FT                   TFWYRTSERSMRVALILASATLAGAFGGAIAYGVGHMNQAQGLSAWRWLFIIEGAPSLA
FT                   SAFLVWFILPDYPESASWLSEEEKALAAQRLAVEGSKGGAKAMTWQDAKEILLDWRLYA
FT                   HYVVYFGISAPFSSLSLFTPAITSGLGYTSLNAQLMTVPPWAVAYVVTTAVAWSADHFN
FT                   RYPRISLHRYGCLIVATSGSFACIPPLLGWLSSNIRSTAGTGLAIALNVSFGAPGQIVG
FT                   VWIYKSNEAKRGYPTGHWTNAALLLLVTVGCLALRVYYGWRNKRLKAGGSGQRFAY"
FT   gene            1266376..1266897
FT                   /locus_tag="ANIA_11542"
FT                   /old_locus_tag="AN11542.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1266376..1266422,1266630..1266648,1266698..1266711,
FT                   1266780..1266897)
FT                   /locus_tag="ANIA_11542"
FT                   /old_locus_tag="AN11542.4"
FT                   /note="transcript_id=CADANIAT00000447"
FT   CDS             join(1266376..1266422,1266630..1266648,1266698..1266711,
FT                   1266780..1266897)
FT                   /locus_tag="ANIA_11542"
FT                   /old_locus_tag="AN11542.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000447"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000447"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000447"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC69"
FT                   /protein_id="CBF79231.1"
FT                   /translation="MVEVEEWRGVMELDGGRPAEPKFYLGESSLSFSQKHMCELGDLDA
FT                   LAPERYIVPKSIKAVSRNNR"
FT   gene            complement(1268572..1269266)
FT                   /locus_tag="ANIA_11541"
FT                   /old_locus_tag="AN11541.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1268572..1268747,1269023..1269082,
FT                   1269215..1269266))
FT                   /locus_tag="ANIA_11541"
FT                   /old_locus_tag="AN11541.4"
FT                   /note="transcript_id=CADANIAT00000448"
FT   CDS             complement(join(1268572..1268747,1269023..1269082,
FT                   1269215..1269266))
FT                   /locus_tag="ANIA_11541"
FT                   /old_locus_tag="AN11541.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000448"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000448"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000448"
FT                   /db_xref="GOA:C8VC70"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC70"
FT                   /protein_id="CBF79233.1"
FT                   /translation="MSDPRLDIKYDWRLRLEMYCKKVGFGDPVYHTYSDRRGGRTAWSC
FT                   NVTVNKVTYAARYWFDGSCLQNAMEDAAEVALKKLEPSDQYPSREPQGTV"
FT   gene            complement(1270903..1272675)
FT                   /locus_tag="ANIA_07026"
FT                   /old_locus_tag="AN7026.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1270903..1271286,1271347..1272675))
FT                   /locus_tag="ANIA_07026"
FT                   /old_locus_tag="AN7026.4"
FT                   /note="transcript_id=CADANIAT00000449"
FT   CDS             complement(join(1271166..1271286,1271347..1272377))
FT                   /locus_tag="ANIA_07026"
FT                   /old_locus_tag="AN7026.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000449"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000449"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000449"
FT                   /db_xref="GOA:C8VC71"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC71"
FT                   /protein_id="CBF79235.1"
FT                   /translation="MVSYRAWSCPERSAASSSSTNSDTSDRSKSTAPTIYSDRPMSKRH
FT                   EEEMDLYDDDEDLDPRDSASTFDSSTSADEIDEPPLFEVPDRRRVIFRPDVIPSNSSSF
FT                   AKLFPSCRRLLIRHDDQTDDGNMQLRVDTRVPHRGGYQQDVILFHLRMYDLFTRKFSFR
FT                   RYCRESGREVCHSEKRAASSIFVAPMLQRSWSNMLASLRPGSSGHGHHKRRGSEQSGFS
FT                   EDGVASGLVRPATLADSIMLEFSNYAHVELKRRGAGRTKRYEYEYWATKYQWRRKSRRE
FT                   DGLREVSFHLVDMRTSKKIAHIVPEILSPQEAIEEEAKGGWIPPSSMWINDVSTYKNMQ
FT                   DVADVIVATGLVVLVDDCIRSRWPHGTSTPRHQHLGTDQAQAV"
FT   gene            complement(1275032..1276309)
FT                   /locus_tag="ANIA_07025"
FT                   /old_locus_tag="AN7025.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1275032..1275248,1275302..1275806,
FT                   1275922..1276309))
FT                   /locus_tag="ANIA_07025"
FT                   /old_locus_tag="AN7025.4"
FT                   /note="transcript_id=CADANIAT00000450"
FT   CDS             complement(join(1275032..1275248,1275302..1275806,
FT                   1275922..1276309))
FT                   /locus_tag="ANIA_07025"
FT                   /old_locus_tag="AN7025.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000450"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000450"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000450"
FT                   /db_xref="GOA:Q5AXF5"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR025952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF5"
FT                   /protein_id="CBF79237.1"
FT                   /translation="MAIHPSFPSQRDGRGPLSPQQAQAISAWTEQAAASLQDLTITDSA
FT                   PTSAGNATLRGTTVSLSIPLDDPVPAAEGGAPRVKTPGQGTEEARKIPAVSFRRREPLR
FT                   RDSLKRREALLKGKDGSRRRQRWENDRLLHNPWAEPPSPNDWMPQPTHTRHEPMPYFLA
FT                   PLWDKHYAHIERRSPGDAKTERHHIPKELRLKLKHARAARGMLQDLEEDIRQFIERWNE
FT                   RQLVRQKDGLADAPSSSEEDSEDEVVFVGRNGQMHDSPDRRKKLQSMRETMSSHNERDG
FT                   EKMVFESLVDDRAAGFGRWLVHSIASYYGLHTWSVTVGSPARREAYVGFYPPSSGSRAG
FT                   LLTQPPSRCRDRVLIQPGEKLPRPLWSQV"
FT   gene            1278764..1279395
FT                   /locus_tag="ANIA_07024"
FT                   /old_locus_tag="AN7024.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1278764..1278768,1278911..1279032,1279079..1279395)
FT                   /locus_tag="ANIA_07024"
FT                   /old_locus_tag="AN7024.4"
FT                   /note="transcript_id=CADANIAT00000451"
FT   CDS             join(1278764..1278768,1278911..1279032,1279079..1279395)
FT                   /locus_tag="ANIA_07024"
FT                   /old_locus_tag="AN7024.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000451"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000451"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000451"
FT                   /db_xref="GOA:Q5AXF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF6"
FT                   /protein_id="CBF79238.1"
FT                   /translation="MSIEARGMMFKGRQQARKERSTISSSLRTQSHQSSVSPRAGNYPL
FT                   LYAHLQREAKRVRLARIIQNDFHDHVVCGIHLCNFYALISARGLGQAGHWRLETDEHKL
FT                   KCESGGSGTRIEIPGSLAEEEGSRDALMRNLCVWLYDNGFTEI"
FT   gene            1280080..1280595
FT                   /locus_tag="ANIA_07023"
FT                   /old_locus_tag="AN7023.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1280080..1280433,1280545..1280595)
FT                   /locus_tag="ANIA_07023"
FT                   /old_locus_tag="AN7023.4"
FT                   /note="transcript_id=CADANIAT00000452"
FT   CDS             join(1280080..1280433,1280545..1280595)
FT                   /locus_tag="ANIA_07023"
FT                   /old_locus_tag="AN7023.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000452"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000452"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000452"
FT                   /db_xref="GOA:Q5AXF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF7"
FT                   /protein_id="CBF79240.1"
FT                   /translation="MARNGVMQRDPWPNVLDEVTKTRDLVVKGKHFSLSTVLDKSQEWL
FT                   KAHGGQFDFVDSDNGHMGIAAKECGVRYGYLHIISDNLAKKYAYELSNERLQKVQMGRK
FT                   RLIREMKEVLVEFFIILHRELSALSLYNYS"
FT   gene            complement(1281189..1284904)
FT                   /locus_tag="ANIA_07022"
FT                   /old_locus_tag="AN7022.4"
FT                   /product="PKS-like enzyme, putative (JCVI)"
FT   mRNA            complement(join(1281189..1281765,1282028..1282460,
FT                   1282490..1282811,1282862..1283049,1283104..1283216,
FT                   1283694..1283703,1284121..1284472,1284626..1284904))
FT                   /locus_tag="ANIA_07022"
FT                   /old_locus_tag="AN7022.4"
FT                   /note="transcript_id=CADANIAT00000453"
FT   CDS             complement(join(1281189..1281765,1282028..1282460,
FT                   1282490..1282811,1282862..1283049,1283104..1283216,
FT                   1283694..1283703,1284121..1284472,1284626..1284904))
FT                   /locus_tag="ANIA_07022"
FT                   /old_locus_tag="AN7022.4"
FT                   /product="PKS-like enzyme, putative (JCVI)"
FT                   /note="transcript_id=CADANIAT00000453"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000453"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000453"
FT                   /db_xref="GOA:Q5AXF8"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF8"
FT                   /protein_id="CBF79242.1"
FT                   /translation="MIPIFQVQGKSKSRPAPLFLIHAISGLALPYNSFGTLDFRGRAIY
FT                   AIGSPLNGPRRYRLPSSIDDVARQYIRFVLSKQATGPYLLGGCSFGGLRAGQPILDARQ
FT                   STPSREDANAKENKGDESTAMWEKMYKHIYNVLALVKRAANGEFVSALREVKVDFIKCS
FT                   VLEVPPAGIITEPSRKFYLDRYENEYMGWQPGQFAGWEGHSIDAEHDRWSRISVKIRVR
FT                   SSTCSGNEAEAMDPQQRLLLEVVYEALEDGIPLIKVAGSQTSVLCGTFTNDYNSTITKD
FT                   LEYYPKYSITDTGNSILSNRISYFYNLHGASATTLQAGEASMSIVLGSALHFDPNIFIT
FT                   MTDLGMLSTDGRCRAFDADRSGYVRGEGICAIIHKRKSQAEFDGDVIRAIVRGTGVNHD
FT                   GTKQGITLPSSESQEALIRQVTRADSTEHCRGLISAQEGPAASMGHQKPYLGFSELQAK
FT                   SVRSLVPRMFYEQIHSLGLQYGVSFALMSGGIKSGSVFATAPLRWTSHWFNSAAPSHAT
FT                   LIHPSLLDAALHAIFAAVERRTGQPINGPYVPTFMQSLQVSGVFADRATEALQFLGGRN
FT                   GEQRRFCSLTLLQMAAEEVISSTEQLQLELASLVKLEELNEGEYDLVILDDVVVPLAYD
FT                   IRNYLKPDAFAINSGKHSSMSKREAFTPVFSPARYHVWRKDSTNPLPGTELALATAANP
FT                   SARTVAMTSAIASAHSERLFRVSLDKLFKITPVPENIVILAALDKNLKTPRSSQRVLAD
FT                   MFVY"
FT   gene            complement(1285966..1287224)
FT                   /locus_tag="ANIA_07021"
FT                   /old_locus_tag="AN7021.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1285966..1286430,1286546..1286629,
FT                   1286795..1286843,1286894..1286969,1287023..1287224))
FT                   /locus_tag="ANIA_07021"
FT                   /old_locus_tag="AN7021.4"
FT                   /note="transcript_id=CADANIAT00000454"
FT   CDS             complement(join(1285966..1286430,1286546..1286629,
FT                   1286795..1286843,1286894..1286969,1287023..1287224))
FT                   /locus_tag="ANIA_07021"
FT                   /old_locus_tag="AN7021.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000454"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000454"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000454"
FT                   /db_xref="GOA:Q5AXF9"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXF9"
FT                   /protein_id="CBF79244.1"
FT                   /translation="MSFLESTGESDEQRSVDEPAEVTSIDYESPSEKQINDASNFPDGA
FT                   TKAWLNVVGGWCIFFSMFGWANAFGVFQDYYQEHQLKHYSAFQNSWISSIQTFILFGGG
FT                   IVAGKYYQFILSQGILQFSSHCYPFTRHTKHIQYRRRRVSICLEHPCPRLDLVGPSAFA
FT                   PSSLPTVTSRLPPTPKPVSIMNHIRPLKELPFLMLSAGCALFYLGIYLPFNYIIVQAEY
FT                   EGMSAALAGYLIPILNGASLFSRIIPGKAADKLGRLNTMIAMCAFAGIIVLALWLPGTG
FT                   NAPIIAFSAL"
FT   gene            complement(1289732..1290313)
FT                   /locus_tag="ANIA_07020"
FT                   /old_locus_tag="AN7020.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1289732..1290160,1290302..1290313))
FT                   /locus_tag="ANIA_07020"
FT                   /old_locus_tag="AN7020.4"
FT                   /note="transcript_id=CADANIAT00000455"
FT   CDS             complement(join(1289732..1290160,1290302..1290313))
FT                   /locus_tag="ANIA_07020"
FT                   /old_locus_tag="AN7020.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000455"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000455"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000455"
FT                   /db_xref="GOA:Q5AXG0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG0"
FT                   /protein_id="CBF79246.1"
FT                   /translation="MFVNSKPAPNPTARAKREMRPDSQIMIIPIVQLQDVLCAMLSLSM
FT                   RLGIVVCVDMGNISANGDTVQLIQKRINAFRLHDELAFGSLVHLQKKFKQAGTVRSNQI
FT                   LLGLGVSQLARTDVLHCADADSQPQSKYLSSDGKTLGSVGLE"
FT   gene            1294317..1294973
FT                   /locus_tag="ANIA_11540"
FT                   /old_locus_tag="AN11540.4"
FT                   /product="hypothetical protein"
FT   mRNA            join(1294317..1294460,1294527..1294552,1294838..1294860,
FT                   1294960..1294973)
FT                   /locus_tag="ANIA_11540"
FT                   /old_locus_tag="AN11540.4"
FT                   /note="transcript_id=CADANIAT00000456"
FT   CDS             join(1294317..1294460,1294527..1294552,1294838..1294860,
FT                   1294960..1294973)
FT                   /locus_tag="ANIA_11540"
FT                   /old_locus_tag="AN11540.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000456"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000456"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000456"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC78"
FT                   /protein_id="CBF79248.1"
FT                   /translation="MPKQLLNRTFNTEALVDPWKTQDKNLALRIGWRIYIANHAGISAW
FT                   ESARYSEKSRIYSINNLINGGSW"
FT   gene            complement(1295847..1299224)
FT                   /locus_tag="ANIA_07019"
FT                   /old_locus_tag="AN7019.4"
FT                   /product="Putative HOS3-like histone deacetylase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q7Z8L9]"
FT   mRNA            complement(1295847..1299224)
FT                   /locus_tag="ANIA_07019"
FT                   /old_locus_tag="AN7019.4"
FT                   /note="transcript_id=CADANIAT00000457"
FT   CDS             complement(1295847..1299224)
FT                   /locus_tag="ANIA_07019"
FT                   /old_locus_tag="AN7019.4"
FT                   /product="Putative HOS3-like histone deacetylase
FT                   [Source:UniProtKB/TrEMBL;Acc:Q7Z8L9]"
FT                   /note="transcript_id=CADANIAT00000457"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000457"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000457"
FT                   /db_xref="GOA:Q5AXG1"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG1"
FT                   /protein_id="CBF79250.1"
FT                   /translation="MDSSKTSAAPNETLSRTPPRPPPPIDPFVVSDRLSDPSLTATPLP
FT                   ASPSAVSSSSLLSPSDLPARSGVNPVPHPAPRRVPSASSLRDERRQSTPNLKKRSSTAS
FT                   LRSSQLGGSTSPRPSMSRRSSSALATSPTAASANAGGPAAPSKASLAVEQPVLTAASIA
FT                   AEHFKKEFNHHQSADLQSETLVIIHDACYGHRFSRPRTTRAALSSIVERPERVQACVVG
FT                   ISAAYVRLARRHAGGLFAPHPDLDLRELPVPPFQIRKTDRALAINSPAVTHVHGTKWME
FT                   DLKLMCDAAESRLALNGKELVRPRSAGKDNSSGNPGPVFHEGDLYLCSESLDAFEGALG
FT                   GVCEGIDAVFSPGPTKRAFVCIRPPGHHCSSGNPSGFCWINNVHVGISYAAMTHDLTHA
FT                   AILDFDLHHGDGSQDIAWEQNKKALAAPKNAAAHKKAMVGYFSLHDINSYPCEMGEAEK
FT                   IRNASVCIEKAHGQSIWNVHLEPWKTEQDFWELYSAKYSILIEKARDFLKMHTDRLASV
FT                   PNGPPPKAAIFISAGFDASEWEGMGMQRHKVNVPTEFYARFTADVVRMAEEEGLGVDGR
FT                   IVSVLEGGYSNRALTTGVLSHLSGLGDTKGVQLLDDRHIDRLATEMTERLGLSDTPPER
FT                   PAFQAAYDQEWWSLPLLEELEALVYPPPPSKPKEKSAPTYFAPTQSFAAKVVLPARDRR
FT                   STGSHSSEQESPPLPPVNWAVAAHELSKVLIPSDRRTGSCRPEELNAEASRLRRERHAT
FT                   ATGISDAVKTPTGPAAGEEKMKLRIRKPKTSSPIVSEPATPARRTNKDNRRTTLDPPSV
FT                   ARDSSKSPGPRISRRKSAAPTTSKTSSATEEDQPPPRPLSQGSVTIRKTSVSRSAAPRR
FT                   SASPKGAPPLPRMPTKFLPATTQDEQSRASQHTSGASERASDDMDSLTSGVRKLSIKLK
FT                   VPSPEENAARERKAAEERKRKILKGSSKAPRSPKKAPAAKQPLTDTSKKISQPSPNNSH
FT                   MDSPLPDVPRQMSTDTEASSAENQISQPLATTDASSPTPTIEAKESLPIEDHHRGKEQA
FT                   IGGLSHSSSQGTYAVISPPLTPGHAGDPAGPMSTLFSPPASASVTRDGLPGFTSNGRIP
FT                   FAPTDDSQRSTMTITRSE"
FT   gene            complement(1299700..1300840)
FT                   /locus_tag="ANIA_07018"
FT                   /old_locus_tag="AN7018.4"
FT                   /product="hypothetical protein"
FT   mRNA            complement(1299700..1300840)
FT                   /locus_tag="ANIA_07018"
FT                   /old_locus_tag="AN7018.4"
FT                   /note="transcript_id=CADANIAT00000458"
FT   CDS             complement(1299941..1300288)
FT                   /locus_tag="ANIA_07018"
FT                   /old_locus_tag="AN7018.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000458"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000458"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000458"
FT                   /db_xref="GOA:C8VC80"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC80"
FT                   /protein_id="CBF79251.1"
FT                   /translation="MCRQYLTLYNWCQCEEDAGYQACGAGPEVCPGTGFETVTMHCFCN
FT                   KHATKKFTTEKKHAKHQRKQSRASLSSVNTSGSGSSRNSRYSNESLVQEKDTQQGSVTR
FT                   RRWYRRWSGIF"
FT   gene            1301735..1302915
FT                   /locus_tag="ANIA_07017"
FT                   /old_locus_tag="AN7017.4"
FT                   /product="alanine racemase family protein, putative
FT                   (AFU_orthologue; AFUA_4G04300)"
FT   mRNA            1301735..1302915
FT                   /locus_tag="ANIA_07017"
FT                   /old_locus_tag="AN7017.4"
FT                   /note="transcript_id=CADANIAT00000459"
FT   CDS             1301968..1302786
FT                   /locus_tag="ANIA_07017"
FT                   /old_locus_tag="AN7017.4"
FT                   /product="alanine racemase family protein, putative
FT                   (AFU_orthologue; AFUA_4G04300)"
FT                   /note="transcript_id=CADANIAT00000459"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000459"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000459"
FT                   /db_xref="GOA:C8VC81"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC81"
FT                   /protein_id="CBF79253.1"
FT                   /translation="MTSQSEGQPVIMPASPSRTTTLLANLASVTSRIQSASSKLPLPKE
FT                   PRLVAVSKLKPASDILALHNPPTAHSHFGENYLQELQEKARLLPPTIKWHFIGGLQSNK
FT                   CVSLARDTRALWAVESVDSEKKATLLDKGWGERKAEMGGEEKLRVFVQVNTSGEENKSG
FT                   VDPGEEVVRLCRFIMDKCPRLRLQGLMTIGAIARSKATTAETENEDFICLKQARERVNE
FT                   ALGLEGDARLELSMGMSEDFEGAIALGSDEVRVGTTIFGDRPPKDRARIL"
FT   gene            complement(1302942..1305962)
FT                   /locus_tag="ANIA_07016"
FT                   /old_locus_tag="AN7016.4"
FT                   /product="AP-2 adaptor complex subunit alpha, putative
FT                   (AFU_orthologue; AFUA_4G04310)"
FT   mRNA            complement(join(1302942..1303103,1303151..1304050,
FT                   1304114..1305072,1305122..1305456,1305511..1305962))
FT                   /locus_tag="ANIA_07016"
FT                   /old_locus_tag="AN7016.4"
FT                   /note="transcript_id=CADANIAT00000460"
FT   CDS             complement(join(1302942..1303103,1303151..1304050,
FT                   1304114..1305072,1305122..1305456,1305511..1305962))
FT                   /locus_tag="ANIA_07016"
FT                   /old_locus_tag="AN7016.4"
FT                   /product="AP-2 adaptor complex subunit alpha, putative
FT                   (AFU_orthologue; AFUA_4G04310)"
FT                   /note="transcript_id=CADANIAT00000460"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000460"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000460"
FT                   /db_xref="GOA:Q5AXG4"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR003164"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013038"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG4"
FT                   /protein_id="CBF79255.1"
FT                   /translation="MSSMRGLVQFIADLRNARARELEEKRVNKELANIRQKFKSGNLDG
FT                   YQKKKYVCKLLYVYIQGYDVDFGHLEAVNLISSNKYSEKQIGYLAVTLFLHEEHELLHL
FT                   VVNSIRKDLLDQNELNNCLALHAVANVGSREMGEALSTDVHRLLISPTSKAFVKKKAAL
FT                   TLLRLYRKYPSIVQNQWAERIISLMDDPDMGVTLSVTSLVMALAQDRPEEYRGSYVKAA
FT                   QRLKRIVVDNDIAPDYLYYRVPCPWLQVKLLRLLQYYPPSGDSHVRDIIRESLQQIMQI
FT                   AMDTPKNVQQNNAQNAVLFEAINLLIHLDTEHTLMMQISSRLGKYIQSRETNVRYLGLE
FT                   AMTHFAARAETLDPIKKHQNIILGSLRDRDISVRRKGLDLVYSMCDSTNAAPIVNELMR
FT                   YLQSADYAIREEMVLKVAILTEKYATDAQWYIDVTLKLLSLAGDHVNDEVWQRVIQIVT
FT                   NNEELQAYAAQTLLTYLKSDCHESLVKIGCYVLGEFGHLIADNQGSSPIEQFLALQAKM
FT                   MTSTDNTRAMILSSFVKFVNLFPEIKPQLLHIFRLYSHSPDPELQQRAFEYLSLATLPT
FT                   DDLLRTKTAGTTDKKTWVVGGKDANSDGAEILMAQNTGLKRSFTTIVHGTSTGTNGTAT
FT                   SSATGDLAGLDLSAPTPPPPSTNMASAANLSPDWEIGYNRLYFSDEGVLFQDAQIQVGL
FT                   RSEFRGHLGVLKLYISNRSSFPIGSLTTTVDNPSAPHLRIDSKSLPEPSVPASGQTQQT
FT                   LFFEAKGPFSKAPTIRISYLAGALQAYTLQLPILMHRYLEPSTLTPEDFFKRWRQIGGG
FT                   PLEAQNTFGLVAKAGGISEGFTRRLVEQFGWKLLSGVDPISTNIVGCAVYHSAQGKTGC
FT                   LLRLEPNYERKMYRVTIRATQEEIPQALARQMEERLSQGSLPDRSHVREKPKGINVDDN
FT                   FTSGY"
FT   gene            complement(1306750..1308311)
FT                   /locus_tag="ANIA_07015"
FT                   /old_locus_tag="AN7015.4"
FT                   /product="TFIIH and nucleotide excision repair factor 3
FT                   complexes subunit (Tfb2), putative (AFU_orthologue;
FT                   AFUA_4G04360)"
FT   mRNA            complement(join(1306750..1307989,1308039..1308126,
FT                   1308191..1308311))
FT                   /locus_tag="ANIA_07015"
FT                   /old_locus_tag="AN7015.4"
FT                   /note="transcript_id=CADANIAT00000461"
FT   CDS             complement(join(1306750..1307989,1308039..1308126,
FT                   1308191..1308311))
FT                   /locus_tag="ANIA_07015"
FT                   /old_locus_tag="AN7015.4"
FT                   /product="TFIIH and nucleotide excision repair factor 3
FT                   complexes subunit (Tfb2), putative (AFU_orthologue;
FT                   AFUA_4G04360)"
FT                   /note="transcript_id=CADANIAT00000461"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000461"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000461"
FT                   /db_xref="GOA:Q5AXG5"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG5"
FT                   /protein_id="CBF79257.1"
FT                   /translation="MAAASRPFDYLESLPGTVFFKLYQQPSTALAIFRRMLPDLAKCFV
FT                   MALLYLKDPLPAADLETWVRSESLRLSFLRERDSALSILGRLHILTNTTTSGNVRAYMV
FT                   TDPFAASLRQALTGAKETQSFGVLHHIPDDQTVPIHDLDEYARRQWEGVLGYMVGTSGL
FT                   GIQRDVNLSKGVKQLLQAGHLVEIRDRRVEITQDGFAFVLQDVGTQVWHILILYVESAE
FT                   AIGMDSVEVLSFIFLLSSLELGKSYEKKHLTSNQLRTLTDLADFGIVYQDSPEASHFYP
FT                   TRLATTLTSDSSALSNPISGALSDPDGGDSNQPGSGFIIIETNYRLYAYTSSPLQISLI
FT                   ALFTTLKYRFPNLVTGKVTRQSIRRAIEMGITADQIISYLATHAHPQMRKHNVARSTSN
FT                   QAGMPPSVLPPTVVDQIRLWQLERDRVKATAGFLFKDFVSLAEYEAPCRYAEEIGVLIW
FT                   KSDRKRMFFVTRHEQVAAFLRSRK"
FT   gene            complement(1310062..1314577)
FT                   /locus_tag="ANIA_07014"
FT                   /old_locus_tag="AN7014.4"
FT                   /product="DEAD helicases superfamily protein (Aquarius),
FT                   putative (AFU_orthologue; AFUA_4G04350)"
FT   mRNA            complement(join(1310062..1310602,1310655..1314137,
FT                   1314187..1314287,1314342..1314577))
FT                   /locus_tag="ANIA_07014"
FT                   /old_locus_tag="AN7014.4"
FT                   /note="transcript_id=CADANIAT00000462"
FT   CDS             complement(join(1310154..1310602,1310655..1314137,
FT                   1314187..1314287,1314342..1314577))
FT                   /locus_tag="ANIA_07014"
FT                   /old_locus_tag="AN7014.4"
FT                   /product="DEAD helicases superfamily protein (Aquarius),
FT                   putative (AFU_orthologue; AFUA_4G04350)"
FT                   /note="transcript_id=CADANIAT00000462"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000462"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000462"
FT                   /db_xref="GOA:C8VC84"
FT                   /db_xref="InterPro:IPR026300"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC84"
FT                   /protein_id="CBF79258.1"
FT                   /translation="MGLQTQNAMAPGLDSRPTVEDFRDDSPWVRLAKTHWLDAANVRKV
FT                   KHDVIKKDIWDPLETESFSFRSLLILENLNILEKFLWPTYTEDASNYHVLLLALIVSVK
FT                   QREHLPIWEIFSDRSDDFSNLFHRILSMSIDQSLPTFSRLSILSFMISAFQSLENTLIR
FT                   KECAPLVSISIWHNLHSDEARERVLANAPNLRKAWRAALKRYDAGDEATKAKMRFERSW
FT                   LYTMLLDFLRRLNGAEKDQADNLRYCERFLEFLVDLESQLPTRRYVNTLLKDLHLLPLM
FT                   RLSRLYRSADNALFRDFHNLLKHFTGFAINDYTGETLSTQAMYDAHCHDLARLQRTSMK
FT                   HFKDKLTILALSNYGSIEQRSELEGQLKALDDSELQDLCAHLGFRTSYPKQANVAADRH
FT                   LYMEVLLSYHERTTSFQEATSNLDVVPTEESLYDPSLLRNETYDGSRPLAIPKLNLQYL
FT                   SLGDFLWRSFLLYRAEAFFQIRKDMELIVKRMQPRSSQDGRTLTFDGFSRMAIPIPKPA
FT                   IIEVAPPKVGSTKPAFVRAEITIEVGRLADHVRTEWDSLRPDDVVFLLAVQPGNQGKYG
FT                   FRDVEAPQTPGIVHVRSADIVQVLDENGRPLREPASGQTNGYRSRPRVRRLLVNLDSAA
FT                   FKADKDRTSQGKPDIYPLINVVARRKARENNFKSILETMQRLIASDITLPQWIQDIFLG
FT                   YGDPAGACYTELPNRLKSVDFRDTFLDWQHLIESFPGLTIEPSGDATSSFQPPYVLEYV
FT                   EESAQPSTSSAPKKRRRDQHAEERGGPKSLRVSTYKPPNPGPYPVDAPRLNAVRFTPAQ
FT                   IQAIASGTQPGLTVIVGPPGTGKTDVATQIINNIYHNFPTERTLLVAHSNQALNQLFQK
FT                   IVALDIDERHLLRLGHGEEELDTETSYSKYGRVESFLDNRNHFLAEVTRLAASIGAQGA
FT                   HGNSCETAGYFHTVYIRPAWTKFWELARSENTSTEEIIAAFPFHEYFSNAPAPVFDPSA
FT                   SKETVVDVAEGCQRHIDRIFSELEDIRPFEILRQPKDKANYLLVKEARIIAMTSTHAAM
FT                   RRQEIADLGFHYDNIVMEEAAQITEVESFIPTALQNMKEGQLPLKRIVLCGDHLQNSPI
FT                   IQNLAFRQYAHFEQSLFLRLIRLGVPAITLDQQGRARPSIAELFRWRYQNLGNLPIVEQ
FT                   APEFKQANAGFQFEYQFINVPDYQGTGEREPTPHFVQNLGEAEYAVAIFQYMRLLGYPA
FT                   SKISILATYAGQTALIKDVLNHRCSKNTLFGMPKIVTTVDRYQGEQNDYIILSLTRTRT
FT                   VGYLRDVRRLTVALSRARLGLYILGRREVFESCYELKPAFDLLLQRPDKLMLAPGEMYP
FT                   ATRTLDDEVKGTPMEGVEHLGQYVFEMTQAKIKALGGEGAIVDETMPDEEGDLIEDGDE
FT                   EMLGGGEEGDEDPLHEHVYA"
FT   gene            1314821..1317126
FT                   /locus_tag="ANIA_07013"
FT                   /old_locus_tag="AN7013.4"
FT                   /product="THO complex subunit Tho1, putative
FT                   (AFU_orthologue; AFUA_4G04330)"
FT   mRNA            join(1314821..1315060,1315132..1315210,1315260..1315378,
FT                   1315505..1316098,1316151..1316300,1316349..1316662,
FT                   1316709..1317126)
FT                   /locus_tag="ANIA_07013"
FT                   /old_locus_tag="AN7013.4"
FT                   /note="transcript_id=CADANIAT00000463"
FT   CDS             join(1314821..1315060,1315132..1315210,1315260..1315378,
FT                   1315505..1316098,1316151..1316300,1316349..1316662,
FT                   1316709..1317126)
FT                   /locus_tag="ANIA_07013"
FT                   /old_locus_tag="AN7013.4"
FT                   /product="THO complex subunit Tho1, putative
FT                   (AFU_orthologue; AFUA_4G04330)"
FT                   /note="transcript_id=CADANIAT00000463"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000463"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000463"
FT                   /db_xref="GOA:Q5AXG7"
FT                   /db_xref="InterPro:IPR021861"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG7"
FT                   /protein_id="CBF79260.1"
FT                   /translation="MANTEVDVIEIYRRLIDSLLDKAEQVKPGKEIEPPLTDTQLGESF
FT                   WLVRGEDEQTVKQLSQQTQFAAVEIAFRERFYSLLATTTIDDPEFVRIWNLLDVISVFS
FT                   DNEQCEPGLIFWLIEELLDSQTIDGCRKVFDYLESRRERNTKDTVFCGRVFIFLFQSFP
FT                   LGDKSAVNLRGEYHTENVTTFDTIANDAISEAHDMDVDMPDVKATNSVAETQKQPVAEG
FT                   DAKSAEQDVTKIPKVTVSQSSDQTGERSLNLDTLYPIFWGLQAYFSSPTKIFDAQHFAT
FT                   FKSGLEATLNAFRTVNTELETSNSKTQEELRKSTKRKRTADGPEIASSFNPKYLTSREL
FT                   FDLEVNDTAFRRHVLVQALILLDFMLSLTSKSKAKLADLTNKSVLYGFVLNDEDAQWAV
FT                   KMRKSIEGYLQEGAGGKFYYRMVDTVLSRDKNWVRWKAEGCPPIEKPAVSVDEYLGARD
FT                   KAIKTYANKRLRASPMNSLNLKFLSESESSSGFDRLKEPERFNVPTSESLMRVIEDVEF
FT                   DIDTAQTSEDKEAAVQAKASKTWLLLRLSAKSKLAAFDKIEDGKNLKTLFETPQSAEST
FT                   TQAAGSTPQEPPTKTSQETEAINNGPSQDEKMETETGSSAAVAEANKVEGSDAATIDAP
FT                   GS"
FT   gene            1322557..1324491
FT                   /locus_tag="ANIA_07012"
FT                   /old_locus_tag="AN7012.4"
FT                   /product="homeobox transcription factor, putative
FT                   (AFU_orthologue; AFUA_4G04320)"
FT   mRNA            join(1322557..1323122,1323359..1323972,1324025..1324388,
FT                   1324458..1324491)
FT                   /locus_tag="ANIA_07012"
FT                   /old_locus_tag="AN7012.4"
FT                   /note="transcript_id=CADANIAT00000464"
FT   CDS             join(1322557..1323122,1323359..1323972,1324025..1324388,
FT                   1324458..1324491)
FT                   /locus_tag="ANIA_07012"
FT                   /old_locus_tag="AN7012.4"
FT                   /product="homeobox transcription factor, putative
FT                   (AFU_orthologue; AFUA_4G04320)"
FT                   /note="transcript_id=CADANIAT00000464"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000464"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000464"
FT                   /db_xref="GOA:Q5AXG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG8"
FT                   /protein_id="CBF79262.1"
FT                   /translation="MSVSGPCAWVSTIPSPAAAHPSSITSSWASVSWNSEPALTKSRAD
FT                   LSALSGLGKTVGEPDKAPPTEMQPAAFKAENAFSTQPAAGSSNSVQYSGVDVLSKGLEN
FT                   RNTNAHSDSSLTANPERQNADIQGSSESQTNDELSSKVKSEEVHEDEKDHGEANAGSSD
FT                   DDGSIADEKKSSQDVKLDKKKMKRFRRAKLKRLTSNDRERMLKSRALPDDFDTTQVLRT
FT                   PFGSKGPSEASVESLRLALYTQTKVSQGLLTEGLPRLNDDDYVISPLSSASTSGPGYPP
FT                   TSSDRGFENYQNRGAAATVPDLRSSRANFPFPRSSSFSEPSFNTSLQYPGRFSRPGDAV
FT                   GHPGISYRRPMDYVMNRPANGMMVGYGQHRPLEGSVSPSGQQEAQLTYGMDNTNQIHNY
FT                   QPPLSMPAPKSYGGIEMNSHMHHPGRSMPTLQHLPVSETPDYRPYPYEHHPYSMGTGIP
FT                   FTQANASSLSLPASFSSEQGHVAVSSPADDRMTTSPQVMDPLRAKYSQGYDYANYLYLV
FT                   TRTMAKFD"
FT   gene            1325118..1325881
FT                   /locus_tag="ANIA_07011"
FT                   /old_locus_tag="AN7011.4"
FT                   /product="copper resistance protein Crd2, putative
FT                   (AFU_orthologue; AFUA_4G04318)"
FT   mRNA            join(1325118..1325460,1325526..1325621,1325671..1325881)
FT                   /locus_tag="ANIA_07011"
FT                   /old_locus_tag="AN7011.4"
FT                   /note="transcript_id=CADANIAT00000465"
FT   CDS             join(1325301..1325460,1325526..1325621,1325671..1325744)
FT                   /locus_tag="ANIA_07011"
FT                   /old_locus_tag="AN7011.4"
FT                   /product="copper resistance protein Crd2, putative
FT                   (AFU_orthologue; AFUA_4G04318)"
FT                   /note="transcript_id=CADANIAT00000465"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000465"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000465"
FT                   /db_xref="GOA:Q5AXG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXG9"
FT                   /protein_id="CBF79264.1"
FT                   /translation="MVHPTSTCCKTNPSGGCVCAAQARCSCGKESALHCTCNKASSENT
FT                   IQGARCSCRARPAGQCTCERAASENNPVDGQTCPCGKRPEASCTCEKAEAVESALETDF
FT                   TTAKA"
FT   gene            complement(1327716..1328879)
FT                   /locus_tag="ANIA_07010"
FT                   /old_locus_tag="AN7010.4"
FT                   /product="phenazine biosynthesis-like protein, putative
FT                   (AFU_orthologue; AFUA_4G04380)"
FT   mRNA            complement(1327716..1328879)
FT                   /locus_tag="ANIA_07010"
FT                   /old_locus_tag="AN7010.4"
FT                   /note="transcript_id=CADANIAT00000466"
FT   CDS             complement(1327788..1328879)
FT                   /locus_tag="ANIA_07010"
FT                   /old_locus_tag="AN7010.4"
FT                   /product="phenazine biosynthesis-like protein, putative
FT                   (AFU_orthologue; AFUA_4G04380)"
FT                   /note="transcript_id=CADANIAT00000466"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000466"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000466"
FT                   /db_xref="GOA:C8VC88"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC88"
FT                   /protein_id="CBF79265.1"
FT                   /translation="MAIDLPLEYESSFKLQEQVSDDSSLSQGVPFFGLIQMDFVPQDPS
FT                   TFKPYLTTMARVDFVTLDVFTTKIYEGNPLAVVFLPAPTSTQLTQRQKQTIAREFNLSE
FT                   TIFVHSESGPSESRKIDIFTGSEELPFAGHPTIGAASWFLHHAPESKPVTRLTMKAGDF
FT                   PITFQNADLGVVSARVAHNVHIHENQYPLDEILRLYPSVKPYLTQSSIALISIVKGMSQ
FT                   LLVELPSLEALGAVTTANGGEEASSSYLDAGWAEGMVTTYFYVKDVKDELLGRNVIRTR
FT                   TILGSLEDPATGSAASGLTAYLSLKEGRAGRFVYDIVQGVEMGRRSEIGLEVVTGEKGI
FT                   ESLELRGSAVKVSEGSIVVPQAK"
FT   gene            1329390..1330966
FT                   /locus_tag="ANIA_07009"
FT                   /old_locus_tag="AN7009.4"
FT                   /product="Actin-like protein arp6
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AXH1]"
FT   mRNA            join(1329390..1329885,1329919..1330660,1330712..1330774,
FT                   1330828..1330966)
FT                   /locus_tag="ANIA_07009"
FT                   /old_locus_tag="AN7009.4"
FT                   /note="transcript_id=CADANIAT00000467"
FT   CDS             join(1329390..1329885,1329919..1330660,1330712..1330774,
FT                   1330828..1330966)
FT                   /locus_tag="ANIA_07009"
FT                   /old_locus_tag="AN7009.4"
FT                   /product="Actin-like protein arp6
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5AXH1]"
FT                   /note="transcript_id=CADANIAT00000467"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000467"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000467"
FT                   /db_xref="GOA:Q5AXH1"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AXH1"
FT                   /protein_id="CBF79267.1"
FT                   /translation="MGSTKPRPSGKNSISHAQSLPGKTFIIDNGAYNMKAGYAPDSQPL
FT                   DDEEIALSACAAIPNAIVKTRANRTYVGAQIGTNVTDWNEMLFRRPVEKGYTVNWEAQK
FT                   EIWENSFFDERTVRSKELHIADPEDVTIIFTEAPNALPALQKNADEIIMEEWGFGGYLR
FT                   CVVGMAKPFALNTGPSLNAWNEIQSLFEDSVLSQPRAVASPAECLLVVDSGYSHTVITP
FT                   VYRGRPLQRGIRRLDLGGKHLTNYLKELVSMRQYNMVDETYIMNEVKESVCFVSNDFNR
FT                   DLERTWKGNRKRGQPDPTDGVVVDYVLPDPNGGKRGFMRPHDPLLGSKKRKAVLAGASA
FT                   EQLNEDVLVLGNERFTVPEILFTPSDIGMKSAGIPDIILQSLSVLPTGLHPAFLANVLV
FT                   VGGNSLLPGFMERLETELRQIASAECVVRVRRPKDPIRFAWLGGSRLATNKEELKKVAI
FT                   TRQEYQEHGSSWTTRKFSGAL"
FT   gene            complement(1331717..1332885)
FT                   /locus_tag="ANIA_07008"
FT                   /old_locus_tag="AN7008.4"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase, putative
FT                   (AFU_orthologue; AFUA_4G04410)"
FT   mRNA            complement(join(1331717..1332533,1332581..1332680,
FT                   1332730..1332885))
FT                   /locus_tag="ANIA_07008"
FT                   /old_locus_tag="AN7008.4"
FT                   /note="transcript_id=CADANIAT00000468"
FT   CDS             complement(join(1331803..1332533,1332581..1332680,
FT                   1332730..1332858))
FT                   /locus_tag="ANIA_07008"
FT                   /old_locus_tag="AN7008.4"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase, putative
FT                   (AFU_orthologue; AFUA_4G04410)"
FT                   /note="transcript_id=CADANIAT00000468"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000468"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000468"
FT                   /db_xref="GOA:C8VC90"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC90"
FT                   /protein_id="CBF79269.1"
FT                   /translation="MLSPALRLLCRRGASMRSRAFSTSPAVHAAEVKSLGVIGAGQMGL
FT                   GIALVAAQKAQVPVTLVDNSQASLDKGLKFADKLLEKDVSKDRITKEAADAARGRITSS
FT                   LSLDDLSSVDFVIEAVPEIPDLKTSIFSKLAQIAPEHVILATNTSSISITKIAAATTTD
FT                   PTNLQAPSRVISTHFMNPVPVQKGVEIIAGLQTSKETIDTAIAFVQRMGKIASVSADSP
FT                   GFLANRILMPYINEAIICLETGIGSREDIDSIMKNGTNVPMGPLTLADFIGLDTCLAIM
FT                   NVLHQESGDSKYRPSGLLKNMVNAGWLGKKSGKGFYDY"
FT   gene            1333179..1336843
FT                   /locus_tag="ANIA_07007"
FT                   /old_locus_tag="AN7007.4"
FT                   /product="hypothetical protein similar to drug resistance
FT                   protein MdrA (Eurofung)"
FT   mRNA            join(1333179..1333250,1333309..1333546,1333602..1335719,
FT                   1335915..1336843)
FT                   /locus_tag="ANIA_07007"
FT                   /old_locus_tag="AN7007.4"
FT                   /note="transcript_id=CADANIAT00000469"
FT   CDS             join(1333179..1333250,1333309..1333546,1333602..1335719,
FT                   1335915..1336843)
FT                   /locus_tag="ANIA_07007"
FT                   /old_locus_tag="AN7007.4"
FT                   /product="hypothetical protein similar to drug resistance
FT                   protein MdrA (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000469"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000469"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000469"
FT                   /db_xref="GOA:Q5AXH3"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="InterPro:IPR007725"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AXH3"
FT                   /protein_id="CBF79271.1"
FT                   /translation="MEEAVPAQTVEVIDPEVRAHVYSLLGGFNGEDADKYVLGDDALSC
FT                   LRDIKRWLKLYDEKFNRMDVARCLGEANLVNGDLIQILSLWWREGQQSKYMTRIALACV
FT                   ELLVPLTWPLEIHGEMTVNHHRHIPYLQQAQVGYKRGILNMASCGILRAVIRIGLPSMA
FT                   IPPSERTARDEGILKIMLYLLRNIAIITANARLAAEGEEEETSRSATINAFHDQDVFAL
FT                   LLTLCSNVSDDFNMLDIPLLEILFHMVRGIDVEKLFMNDAQRSAKRTDELNDLLRQESS
FT                   MRREYAKNAPTRHGRFGTMIWVKRDDAKMSTVSGQDVLRDEQTTLYKMDQSKRWNKPRR
FT                   GRKAQDMSVNNDFNTPVHISPSATTNLRMFVEEFLDSGFNPLFVHVRKAIERESIRVLD
FT                   INKRHFLYTVSWFLGAERARRARQREKYAQSGKKPDNELEPDSFGLVAGVLNQETFVFL
FT                   NRSMQNSLDNKEWDDLNAAMRCFTQILLTVQEMSQSPLEEDQEIAENIQNRIFYEETTH
FT                   DRILAILRGYTDQGFGYLDACTELSHVFLRMLERYSKTNVDMQVRSRRRARKRKREEQL
FT                   VNKGSDEEQESEDEDYAEAEKMSKERKFDFTRFAAKFSNQKCVDTFVAFTKFYKELNNE
FT                   QLKRAHRYFYRIAFKQEMTVLLFRVDILNLFYRIIKGPGGMDSSKPIYKEWEELVRQLI
FT                   RRLIKKLEQRPALITELLFSKINSTAFYLEYGFEKQTVTTSKRAPAELEVDPKAASTPE
FT                   EKLSIVVAALVKDEQSALVKWISEVLGSAADEREAWELNSHDVDLAGPRDTQNPIINEL
FT                   RESKAVIDKALLIGNTDERDPNDLLRKKYSHEPRDGFSGQNLDVNFGSDSEGEDVIPDG
FT                   PLFPANPRSKAHALNELKQKRKKRKDKGEEEPVDEETLEERRQARLENTRWRLAKIKSD
FT                   LYVHASDEESDAEADQEFFRLEEERRNEQSERIKKALLLGRTEDAGNKARQRKRGKRSN
FT                   EPNIAGEEETSGKRRRHSGGTNVELEEDDILMDDMEMPSRASSGEYSSNDADAIDKSMA
FT                   AAEDELYFDDDLAFGRDRDKDETSVDRDGADASSPRKHNDGSESAEEDIPLAPPNRRRL
FT                   RAGFVVESDSE"
FT   gene            1337176..1338350
FT                   /locus_tag="ANIA_07006"
FT                   /old_locus_tag="AN7006.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1337176..1338350
FT                   /locus_tag="ANIA_07006"
FT                   /old_locus_tag="AN7006.4"
FT                   /note="transcript_id=CADANIAT00000470"
FT   CDS             1337253..1338350
FT                   /locus_tag="ANIA_07006"
FT                   /old_locus_tag="AN7006.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000470"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000470"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000470"
FT                   /db_xref="GOA:Q5AXH4"
FT                   /db_xref="InterPro:IPR026907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXH4"
FT                   /protein_id="CBF79273.1"
FT                   /translation="MSQILQVVLKTTLALIEQFQVSLTTTQPNPGPVTSEENQNSDPLP
FT                   LLSISSTALKSHVTKLSLLAINSPFTPSAVAKTLSTLNESVLPSLVTAALLITPESHTR
FT                   AFQSEIRVLTGTALKELSLLVKEVQLIAEEKADKRSLEQAEKDAVTAVTGRVWDACDVL
FT                   VDVAAKGVVGFVVRRAQEYRDLVRDAVEEIEEWDPDEEGDEFFDDLLDNGDEYEAGSGD
FT                   DEDEGSDDGESSAALHARKKSALRILKPIAQIYPALIANRLERVPVPLAPSNIGILDSM
FT                   LKSLQQIPDHIDEVAGALYEADFDKFTRQLRKTKESAFNAIELVVLPWDLKQTANDQEN
FT                   QGDKFTAWSKTWTKVIEEVSKSIDV"
FT   gene            complement(1338497..1341415)
FT                   /locus_tag="ANIA_07005"
FT                   /old_locus_tag="AN7005.4"
FT                   /product="conserved leucine-rich repeat protein
FT                   (AFU_orthologue; AFUA_4G04440)"
FT   mRNA            complement(1338497..1341415)
FT                   /locus_tag="ANIA_07005"
FT                   /old_locus_tag="AN7005.4"
FT                   /note="transcript_id=CADANIAT00000471"
FT   CDS             complement(1338497..1341415)
FT                   /locus_tag="ANIA_07005"
FT                   /old_locus_tag="AN7005.4"
FT                   /product="conserved leucine-rich repeat protein
FT                   (AFU_orthologue; AFUA_4G04440)"
FT                   /note="transcript_id=CADANIAT00000471"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000471"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000471"
FT                   /db_xref="GOA:Q5AXH5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXH5"
FT                   /protein_id="CBF79275.1"
FT                   /translation="MDQTKTPTRPSGIPRLVSRIPLPTSTTSSASLRPSPSREKLRIDP
FT                   GLKATRLRRPSEEPEFKKPLPRTLQPRNTQNGNPQKRLVSQARSDGVGSENEKVPDTMD
FT                   TRSEDTALQDAEPRGRIRPSLSERTIETLSQIPPSPASSRRPSSFFNATSPIRSPSRPP
FT                   SSMTSYSRSPSRSSTSRQLSGNDFLSGPPSSIRLPSRPRTSVHKTGPANEHASVDSADS
FT                   TPKLTKPAPLKTLRSAGSQSKAPESRLALNRAPADSGVAPPALEVKKTRRAQQKASNSR
FT                   LNSTAPKSPAVSEPAETTSPELKKTSKSSSALRESIAKAKAARKAAAHQPSPLDAWTEA
FT                   DIKDPFNQQPKDQNKVLRKKLDAGRTTGHLNIAAMSLTTFPDEVLTMYDFDPNATTDWY
FT                   ESVDLVKFIAADNEFTELPDAAFPDVDSEQLDPDSEERGNQFGGLEVLDVHGNLLERLP
FT                   IGFRRLQRLHTLNLSNNKLTMEDIDVIFEMASLRDLKLAKNQLQGPFSQKIGQLDKLEV
FT                   LDIHENTITALPETVEGLKRLRVLNVGQNQLTELPFEILCTLPLREIIAPKNKLQGVLI
FT                   PATVDKLDSLQELDVVGNALTSLGEKLTLPALKTLAISMNRIKNLPNVSSWQALLKLSA
FT                   EDNSISEFPLGFTELKNVRNVDLTGNNISRLDEKIGLMDNLFTFRIANNPLRERKFLNM
FT                   TVEDIKRDLRSRCEPEPQETDDEEGSVATQFTLAPETPAQNSGWLLKPGGVLDRSYTDM
FT                   QEFDVEQLEAINPSDVRYLYLQHNSLRSFPVPALSVLAANLTDLDLSHNPLDISSLTAT
FT                   PVMLASLQTLNLSATGITTLEPLMTGLKAPSLTFLDVSSNNLSGSLPYIRRAYSKLTTF
FT                   LIAENQLDSLDFEAVQGLQVLDVGNNSISSLPPRIGLLRAAGNSANWGGGSALRRFEVA
FT                   GNSFRVPRWQIVAKGTDSILEWLKDRMPAEELQEYESGGEGD"
FT   gene            1342214..1344275
FT                   /locus_tag="ANIA_07004"
FT                   /old_locus_tag="AN7004.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1342214..1342322,1342770..1342786,1342896..1344275)
FT                   /locus_tag="ANIA_07004"
FT                   /old_locus_tag="AN7004.4"
FT                   /note="transcript_id=CADANIAT00000472"
FT   CDS             join(1342214..1342322,1342770..1342786,1342896..1344275)
FT                   /locus_tag="ANIA_07004"
FT                   /old_locus_tag="AN7004.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000472"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000472"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000472"
FT                   /db_xref="GOA:Q5AXH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXH6"
FT                   /protein_id="CBF79277.1"
FT                   /translation="MFTSALTCGPDSWLRIRPYLDLGGIGARLADLTNVIGLESEVNIT
FT                   SMSQNSESCGSLAPPVEISRPVTPVQRANLSASPDMSVPAESRSPHTDNLKFISPPSLP
FT                   SSDMTPPPSTQIPGAPLRRSRSRSRSSSYLAPSPDIQETLCAAYGASENLPTNDEIETA
FT                   DEGKLRTIAKELLAVAREARVSALHFKLQYGLLSFRSNVAIKRAEVEHKLARREAEILQ
FT                   SAEYRSRHSLPDTEPTPSPSNVELELAVKRNQELERTNATLDRRLRRAKKLIEQEQDRA
FT                   DRLTEENKLLKQRIRENREHFSRMIEHGPMSPAAPPQGVLDSSDNNHPFAALLAADRVL
FT                   NRESSNFTPNRHKSHRQHSNGHVRGSHSLSSLPITPSEGGRKGRHYVTPGEESSEENRD
FT                   RDSTISASDVEEAETEVDIPSSHASSLATSMLRRNHPAMQQDMRDAVKSAPKSSTLLQT
FT                   KLFGQVRKPGVERPTNNLKREASFDGASSKKPRAEDHVGLGIH"
FT   gene            1345040..1346445
FT                   /locus_tag="ANIA_07003"
FT                   /old_locus_tag="AN7003.4"
FT                   /product="60S ribosomal protein L13 (AFU_orthologue;
FT                   AFUA_4G04460)"
FT   mRNA            join(1345040..1345106,1345214..1345247,1345368..1345414,
FT                   1345550..1345708,1345761..1346445)
FT                   /locus_tag="ANIA_07003"
FT                   /old_locus_tag="AN7003.4"
FT                   /note="transcript_id=CADANIAT00000473"
FT   CDS             join(1345104..1345106,1345214..1345247,1345368..1345414,
FT                   1345550..1345708,1345761..1346198)
FT                   /locus_tag="ANIA_07003"
FT                   /old_locus_tag="AN7003.4"
FT                   /product="60S ribosomal protein L13 (AFU_orthologue;
FT                   AFUA_4G04460)"
FT                   /note="transcript_id=CADANIAT00000473"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000473"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000473"
FT                   /db_xref="GOA:Q5AXH7"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXH7"
FT                   /protein_id="CBF79279.1"
FT                   /translation="MAIKHNNQIQKHHFHKDWQRRVRVHFEQAGRKHSRREARLAKAAA
FT                   VAPRPVDKLRPIVRCPTVKYNRRVRAGRGFTLAELKEAGIPKKLARTIGIAVDHRRTNY
FT                   SKESLVANVARLKDYKARLIIFPRKSGQFKKTDSTAEEVNAAKAAFAAEGQTQGYATNV
FT                   GAILPIKNTTAEEAVTEVKRDDLPKGEEAAYRRLREARSEARYKGIREKRAKAKAEEES
FT                   AAKK"
FT   gene            complement(1346618..1348489)
FT                   /locus_tag="ANIA_07002"
FT                   /old_locus_tag="AN7002.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1346618..1347392,1347603..1348489))
FT                   /locus_tag="ANIA_07002"
FT                   /old_locus_tag="AN7002.4"
FT                   /note="transcript_id=CADANIAT00000474"
FT   CDS             complement(join(1346618..1347392,1347603..1348489))
FT                   /locus_tag="ANIA_07002"
FT                   /old_locus_tag="AN7002.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000474"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000474"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000474"
FT                   /db_xref="GOA:Q5AXH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXH8"
FT                   /protein_id="CBF79281.1"
FT                   /translation="MEPLPPRIASQRRSPPRSSFQAPTKASIARSNPELLERALSRSPT
FT                   RTSTRSSQDDKQKEAETRAFGLRDRKALRPSIALTASPSNSLNRGRQSQSPFALASQRS
FT                   SGLGAFAAPPRRVSKRISASDFLFQSPSTSRETRVEESLVNTPEDQLAVELGSATGMDL
FT                   NEDTVLHNGFDEPDLPPTPTQLGLEPPPGRPRGLLSDSPGMQHAKWGKRRASEDLDSSP
FT                   SKLRTVNYSNEPEDLTITTNLAPFPESIVKKRKLKRELSAQLESLKQDLAQLEGLCDKL
FT                   DKKEGDIEPFLNDLCQSAQTDQYLTALAPLKITASLNAITKSDLGMFVERHQITLSAPR
FT                   PFPPNVYKIDVSYETNPETQSVVSLAASVDGTTLNYLQQWINGRLQDPLRRLDISGLCW
FT                   GINRYWEALVSRAQIWAQIWDQHPALIPSRNKSPSVKVNSDIDIRRILPHLERTSILFK
FT                   SKQRTLEALLSCELTIDPWTGEPELTPTICVSISGNGSSSDRKVEQESKKLFEAVLNES
FT                   KKQQLGTAGGSEAEAVVKATKCVLDVLFGQSGGHQL"
FT   gene            1348863..1349639
FT                   /locus_tag="ANIA_07001"
FT                   /old_locus_tag="AN7001.4"
FT                   /product="conserved hypothetical protein"
FT   mRNA            1348863..1349639
FT                   /locus_tag="ANIA_07001"
FT                   /old_locus_tag="AN7001.4"
FT                   /note="transcript_id=CADANIAT00000475"
FT   CDS             1348863..1349639
FT                   /locus_tag="ANIA_07001"
FT                   /old_locus_tag="AN7001.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00000475"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000475"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000475"
FT                   /db_xref="GOA:Q5AXH9"
FT                   /db_xref="InterPro:IPR019180"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXH9"
FT                   /protein_id="CBF79283.1"
FT                   /translation="MEDHALFTIRHLLLRSFRASPFPSIRTSLAQNSRHRRISSPKRLL
FT                   HHHAKHTNHLGDGQAYPLSGYYSDILSARHSHRGQATTSPSAPQQKPETPRAQTNQLPQ
FT                   SPEERMAIVFGTRLAGPGRSSRYNRGSNSAWKTVNGVPIPPRPEEPDNCCMSGCVHCVW
FT                   DDYRDEMEEWAALLAQAKAKGGTSKSPKVVPTAIPKTPVDVAASTSMDDDGGGSETNWS
FT                   LPGSGDDLFADIPVGIREFMKTEKRLKQLHRNADDA"
FT   gene            1350902..1353141
FT                   /locus_tag="ANIA_07000"
FT                   /old_locus_tag="AN7000.4"
FT                   /product="succinyl-CoA synthetase beta subunit, putative
FT                   (AFU_orthologue; AFUA_4G04520)"
FT   mRNA            join(1350902..1351104,1351171..1351248,1351299..1351371,
FT                   1351428..1351527,1351589..1352134,1352179..1352225,
FT                   1352274..1352566,1352617..1353141)
FT                   /locus_tag="ANIA_07000"
FT                   /old_locus_tag="AN7000.4"
FT                   /note="transcript_id=CADANIAT00000476"
FT   CDS             join(1351054..1351104,1351171..1351248,1351299..1351371,
FT                   1351428..1351527,1351589..1352134,1352179..1352225,
FT                   1352274..1352566,1352617..1352751)
FT                   /locus_tag="ANIA_07000"
FT                   /old_locus_tag="AN7000.4"
FT                   /product="succinyl-CoA synthetase beta subunit, putative
FT                   (AFU_orthologue; AFUA_4G04520)"
FT                   /note="transcript_id=CADANIAT00000476"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000476"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000476"
FT                   /db_xref="GOA:C8VC98"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C8VC98"
FT                   /protein_id="CBF79284.1"
FT                   /translation="MFTVLRSRPVAALRAATGSSSRIAQQQRNLSIHEYLSANLLKSYG
FT                   VGVPKGEVARSAEEAEKVAKSLGNDDMVIKAQVLAGGRGKGHFDNGLKGGVRVIYSPTE
FT                   AKMFAGQMIGHKLITKQTGAGGRLCNAVFIVERKFARREFYLAVLMDRKTQGPVIVASS
FT                   QGGMDIEAVAKENPDAIITTPIDINVGVTDAIATKIANELGFSEQCVDDAKKTIQNLYK
FT                   AFMETDATQIEINPLSETSDHQVLAMDAKLGFDDNAEFRQKEIFSWRDTTQEDADEVKA
FT                   AEHGLNFIKLDGDIGCLVNGAGLAMATMDIIKLNGGSPANFLDVGGGATPAAIKSAFEL
FT                   ITSDPKVSAIFVNIFGGIVRCDAIAQGLINVVQEMGLRTPIVARLQGTNMEQAHKLINE
FT                   SGLKIFSIEDLQSAAEKSVQFSKVVKMAREIDVGVEFTLGI"
FT   gene            1353414..1354905
FT                   /locus_tag="ANIA_06999"
FT                   /old_locus_tag="AN6999.4"
FT                   /product="hypothetical protein (Eurofung)"
FT   mRNA            join(1353414..1354006,1354059..1354905)
FT                   /locus_tag="ANIA_06999"
FT                   /old_locus_tag="AN6999.4"
FT                   /note="transcript_id=CADANIAT00000477"
FT   CDS             join(1353414..1354006,1354059..1354905)
FT                   /locus_tag="ANIA_06999"
FT                   /old_locus_tag="AN6999.4"
FT                   /product="hypothetical protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00000477"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00000477"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00000477"
FT                   /db_xref="GOA:Q5AXI1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AXI1"
FT                   /protein_id="CBF79286.1"
FT                   /translation="MDSNIQDIISRFKQLNTASARRTVYQQIIDQLNPHEWRDVQKRVN
FT                   QRTFQKDILGSLPIEIAVQIVQYLDINDVHLLQRVSRRWHEVLSSEPVCSILFRQYTGG
FT                   SLDSDFKSTFARYSRQRSRLEQGRPVAHVQLDIPFSQDLDYCDGRYAWSADGGTTIVVF
FT                   EMCSRKTQRFCTENRERFEKFCLSEDLVAAITVRGYCHAWDIRTEYTRSIRLPNTNLSH
FT                   FVIDSFRVAVYYENFRLDGQEGGVVMHFDLRPGSPRTHRIQPVEELALLSLDKSSNFLT
FT                   TICLKHYSNRDPSYIPNKPRLRVLKYELHENGEASIARSYTLNLPSSSNRTYLARDLPQ
FT                   YYKNMGFLYVSSSSALSFVLPITYHPQTEQVCIHALLDLRVADSLSMANVDNGILYWVR
FT                   DDDGKQSIWISNPYAVTPLCASRGLEFDLPRAPPDETPLMGHHRRLLTGDSRFVSMTDI
FT                   SGTQVWFFEDANQLGYVETNP"
FT   gene            1355744..1357724
FT                   /locus_tag="ANIA_06998"
FT                   /old_locus_tag="AN6998.4"
FT                   /product="flocculation suppression protein (AFU_orthologue;
FT                   AFUA_4G04502)"
FT   mRNA            join(1355744..1356090,1356205..1356258,1356307..1356422,
FT                   1356577..1356767,1356815..1356884,1356931..1357724)
FT                   /locus_tag="ANIA_06998"
FT                   /old_locus_tag="AN6998.4"
FT                   /note="transcript_id=CADANIAT00000478"
FT   CDS             join(1355744..1356090,1356205..1356258,1356307..1356422,
FT                   1356577..1356767,1356815..1356884,135