spacer

EBI Dbfetch

ID   AL766852; SV 1; linear; genomic DNA; STD; PRO; 174050 BP.
XX
AC   AL766852;
XX
DT   25-OCT-2002 (Rel. 73, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Streptococcus agalactiae NEM316 complete genome, segment 10
XX
KW   .
XX
OS   Streptococcus agalactiae NEM316
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RX   DOI; 10.1046/j.1365-2958.2002.03126.x.
RX   PUBMED; 12354221.
RA   Glaser P., Rusniok C., Chevalier F., Buchrieser C., Frangeul L., Zouine M.,
RA   Couve E., Lalioui L., Msadek T., Poyart C., Trieu-Cuot P., Kunst F.;
RT   "Genome sequence of Streptococcus agalactiae, a pathogen causing invasive
RT   neonatal disease";
RL   Mol. Microbiol. 45(6):1499-1513(2002).
XX
RN   [2]
RA   Glaser P., Rusniok C., Frangeul L.;
RT   ;
RL   Submitted (31-MAY-2002) to the INSDC.
RL   Glaser P., Institut Pasteur, Genomique des Microorganismes Pathogenes, 25,
RL   rue du Docteur Roux, 75724 Paris Cedex 15, FRANCE. E-mail:
RL   pglaser@pasteur.fr Phone: +33 (0)1 45 68 89 96, Fax: +33 (0)1 45 68 87 86
XX
DR   MD5; e563ed4edb5c18bd95965ab0add16d98.
DR   ENA-CON; AL732656.
DR   BioSample; SAMEA3138330.
DR   RFAM; RF01065; 23S-methyl.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..174050
FT                   /organism="Streptococcus agalactiae NEM316"
FT                   /strain="NEM316"
FT                   /mol_type="genomic DNA"
FT                   /serovar="serovar III"
FT                   /db_xref="taxon:211110"
FT   regulatory      complement(252..284)
FT                   /gene="gbs1558"
FT                   /regulatory_class="terminator"
FT   CDS             complement(328..582)
FT                   /transl_table=11
FT                   /gene="gbs1558"
FT                   /product="unknown"
FT                   /db_xref="GOA:Q8E445"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E445"
FT                   /protein_id="CAD47217.1"
FT                   /translation="MFVMRTFGNSLSGPLVVILSSILFSWSHLHGLSVVDFVVYFGMGL
FT                   IFASLHHYTKSIHYSIGEHIVWNSLSYIFYFLAFLLDLL"
FT   CDS             complement(1312..1713)
FT                   /transl_table=11
FT                   /gene="gbs1559"
FT                   /product="Unknown"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E444"
FT                   /protein_id="CAD47218.1"
FT                   /translation="MHNILRFLGIVIISAVILFSIGSFYDLSLMKNILLICWSFLFDLL
FT                   VFVFKQRQTTEVLTWYQVVKQFWLFIKCTILIPILVAFIIMKGCLTSISDILIYFYLHL
FT                   VVVYYTIGMILSLGRIISPEHSMFNKLRK"
FT   regulatory      complement(1721..1726)
FT                   /gene="gbs1559"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(1950..2849)
FT                   /transl_table=11
FT                   /gene="gbs1560"
FT                   /product="Unknown"
FT                   /note="similar to GTP binding proteins"
FT                   /db_xref="GOA:Q8E443"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E443"
FT                   /protein_id="CAD47219.1"
FT                   /translation="MTFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIM
FT                   GIYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDM
FT                   IIERLKAAKIPVILVINKIDKVHPDQLLEQIDDFRSQMDFKEVVPISALQGNNVPTLIK
FT                   LLTDNLEEGFQYFPEDQITDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEE
FT                   TDKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKN
FT                   WRDKKLDLADFGYNEKEY"
FT   regulatory      complement(2858..2864)
FT                   /gene="gbs1560"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(2891..3289)
FT                   /transl_table=11
FT                   /gene="gbs1561"
FT                   /product="Unknown"
FT                   /note="similar to diacylglycerol kinase"
FT                   /db_xref="GOA:Q8E442"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E442"
FT                   /protein_id="CAD47220.1"
FT                   /translation="MDLNDNNQKKWKNRTLTSSMEFAVTGIFTAFKEERNMRKHLVSAI
FT                   LVILAGLTFQVSMVEWLFLLLSIFLVITFEIINSAIENVVDLASNYHFSMLAKNAKDMA
FT                   AGAVLVVSLFAVLVGLIIFIPKILALLL"
FT   CDS             complement(3270..3767)
FT                   /transl_table=11
FT                   /gene="gbs1562"
FT                   /product="Unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:P67138"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67138"
FT                   /protein_id="CAD47221.1"
FT                   /translation="MYVEMIDETGQVSEDIKKQTLDLLEFAAQKTGKENKEMAVTFVTN
FT                   ERSHELNLEYRDTDRPTDVISLEYKPEVDISFDEEDLAENPELAEMLEDFDSYIGELFI
FT                   SIDKAKEQAEEYGHSYEREMGFLAVHGFLHINGYDHYTPEEEKEMFSLQEEILTAYGLK
FT                   RQ"
FT   CDS             complement(4162..4968)
FT                   /transl_table=11
FT                   /gene="gbs1563"
FT                   /product="Unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8E440"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E440"
FT                   /protein_id="CAD47222.1"
FT                   /translation="MKITLHGVAETLLITLYIRAKDAMAKHPILNDQKSLAIVEQIEYD
FT                   FDKFDNSEASFYATLARIRVMDREIKKFIRENPNSQILSIGCGLDTRFERVDNGQIRWY
FT                   NLDLPEVMEIRKLFFEEHERVTNIAKSAIDETWTREVNPQNAPFLIVSEGVLMFLKEDD
FT                   VETFLHILTNSFSQFMAQFDLCHKEMINKGKQHDTVKYMDTEFQFGITDGHEIVDLDPK
FT                   LKQINLINFTDEMSKFELGTLRSLLPTIRKFNNCLGVYEYKASEKK"
FT   regulatory      complement(4977..4982)
FT                   /gene="gbs1563"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(5290..5766)
FT                   /transl_table=11
FT                   /gene="gbs1564"
FT                   /product="Unknown"
FT                   /note="similar to other proteins"
FT                   /db_xref="GOA:Q8E439"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E439"
FT                   /protein_id="CAD47223.1"
FT                   /translation="MKQDYISYIRSKVGHETIFLTYSGGILTDGKGRVLLQLRADKNSW
FT                   GIIGGCMELGESSVDTLKREFFEETGLRVEPIRLLNVYTNFQDSYPNGDKAQTVGFIYE
FT                   VSCPKPVNIEGFHNEETLQLDYFSKEDVKNITIVNEQHQLILDEYFSQTFQMGR"
FT   regulatory      complement(5774..5779)
FT                   /gene="gbs1564"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      5946..5951
FT                   /gene="gbs1565"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             5958..6761
FT                   /transl_table=11
FT                   /gene="gbs1565"
FT                   /product="Unknown"
FT                   /db_xref="InterPro:IPR025117"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E438"
FT                   /protein_id="CAD47224.1"
FT                   /translation="MDHFTKLWQDFSKLPNVVAIALGGSRSGDSFDQSSDYDLYVYCAA
FT                   TPDITSRKRILNKHCHYIELNNHYWELEDNGTLNDGTDIDILYRNIDNFLSDLEDVVEH
FT                   HNSRIGYTTCFWHNLINCQILYDPENQLQSLKERFEVSYPSQLQKQIIIQNRNLLTGKL
FT                   PSYDKQIIKALKRQDFVSTHHRTTAFLDSYFDIIFALNKLTHPGEKRMISYAKKNATLL
FT                   PKHFEENIIKLCHHNSNEHTVKETLNDIIMHLDVMLKENFQHFIG"
FT   regulatory      6785..6802
FT                   /gene="gbs1565"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(6785..6802)
FT                   /gene="gbs1566"
FT                   /regulatory_class="terminator"
FT   CDS             complement(6852..7838)
FT                   /transl_table=11
FT                   /gene="gbs1566"
FT                   /product="Unknown"
FT                   /note="similar to phosphate starvation inducible protein,
FT                   unknown function"
FT                   /db_xref="GOA:Q8E437"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E437"
FT                   /protein_id="CAD47225.1"
FT                   /translation="MQEYSIEITLQHPDDMMSLFGSNERHLKLIEENLDVIIHARTERV
FT                   QVLGDSEEAVETARLTIEALLVLVNRGMTVNTSDVVTALSMAQNGSIDKFVALYEEEII
FT                   KDSYGKPIRVKTLGQKIYVDSVKNHDVVFGIGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYQILGKEQTSRLMEREIIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDVSQIDLPKNVKSGLIDA
FT                   VEKLRNIKKIDFIHLSAKDVVRHPVVAEIINAYSDSESSHKLQSDKD"
FT   regulatory      complement(7845..7850)
FT                   /gene="gbs1566"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(7927..7949)
FT                   /gene="gbs1567"
FT                   /regulatory_class="terminator"
FT   CDS             complement(7962..9734)
FT                   /transl_table=11
FT                   /gene="gbs1567"
FT                   /product="Unknown"
FT                   /note="similar to myosin-crossreactive streptococcal
FT                   antigen (unknown function)"
FT                   /db_xref="GOA:Q8E436"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E436"
FT                   /protein_id="CAD47226.1"
FT                   /translation="MRYTNGNFEAFARPRKPEGVDKKSAYIVGSGLAGLAAAVFLIRDG
FT                   QMDGQRIHIFEELPLSGGSLDGVKRPDIGFVTRGGREMENHFECMWDMYRSIPSLEVPD
FT                   ASYLDEFYWLDKDDPNSSNCRLIHKQGNRLESDGDFTLGTHSKELVKLVMETEESLGAK
FT                   TIEEVFSKEFFESNFWTYWATMFAFEKWHSAIEMRRYAMRFIHHIGGLPDFTSLKFNKY
FT                   NQYDSMVKPIISYLESHNVDVQFDSKVTNISVDFKNGQKLAKAIHLTVGGEAKTIDLTP
FT                   DDFVFVTNGSITESTNYGSHDTVAKPNTDLGGSWNLWENLAAQSDEFGHPKVFYKDIPK
FT                   ESWFVSATATIKDPAIEPYIERLTHRDLHDGKVNTGGIVTVTDSNWMMSFAIHRQPHFK
FT                   EQKENETIVWIYGLYSNVEGNYIKKPIEECTGREITEEWLYHLGVPEMKIHDLSDKQYV
FT                   STVPVYMPYITSYFMPRVKGDRPDVIPQGSVNLAFIGNFAESPSRDTVFTTEYSIRTAM
FT                   EAVYTFLNIERGVPEVFNSAFDIRVLLQSLYYLNDKKSVEDMDLPIPALMRKVGMKKIR
FT                   GTYLEELLREAHLL"
FT   regulatory      complement(9742..9747)
FT                   /gene="gbs1567"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(9862..9881)
FT                   /gene="gbs1568"
FT                   /regulatory_class="terminator"
FT   CDS             complement(9892..10107)
FT                   /transl_table=11
FT                   /gene="gbs1568"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E435"
FT                   /protein_id="CAD47227.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPVAILADYAFDETTFPKHSSDFETVS
FT                   RYLEDEASFSFNLTDFDDIWEDYLNH"
FT   CDS             complement(10104..10613)
FT                   /transl_table=11
FT                   /gene="gbs1569"
FT                   /product="unknown"
FT                   /note="similar to peptide methionine sulfoxide reductase"
FT                   /db_xref="GOA:Q8E434"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E434"
FT                   /protein_id="CAD47228.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEELDGIESVLSGYTGGHVENPTYKEVC
FT                   SKTTGHTEAVEIIFNPEKISYANLVELYWAQTDPTDAFGQFEDRGDNYRPVIFYENEEQ
FT                   RQIAQKSKDKLQASGRFDRPIVTSIEPADTFYPAEDYHQAFYRTNPARYALSSARRHAF
FT                   LEENWH"
FT   regulatory      complement(10115..10120)
FT                   /gene="gbs1568"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(10619..10624)
FT                   /gene="gbs1569"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(10656..10676)
FT                   /gene="gbs1570"
FT                   /regulatory_class="terminator"
FT   CDS             complement(10751..11605)
FT                   /transl_table=11
FT                   /gene="gbs1570"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8E433"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E433"
FT                   /protein_id="CAD47229.1"
FT                   /translation="MNTLLATVITGLVTDENKDFYFIQKDGFTFALSKSEGEHHIGEMV
FT                   KGFAYTDMQQKARLTTKETFATRDHYGWGTVTEVRKDLGVFLDTGLPDKQVVVSLDVLP
FT                   ELKELWPKKGDRLYVCLDVDKKDRLWALPADPEVFQRMATPAYNNMQNQNWPAIVYRLK
FT                   LSGTFVYLPENNMLGFIHPSERYSEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMILTYLESNGGFMTLNDKSSPEEIKATFGISKGQFKKALGGLMKAKKIKQDQLGT
FT                   ELL"
FT   regulatory      complement(11609..11614)
FT                   /gene="gbs1570"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(11723..12280)
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="GOA:P66740"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66740"
FT                   /protein_id="CAD47230.1"
FT                   /translation="MTKEIVTKAQERFEQSHQSLSREFAGIRAGRANASLLDRIQVEYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERAINESDLGINPANDGSVIRLVIPA
FT                   LTEETRRDLAKEVKKVGENAKIAIRNIRRDAMDEAKKQEKNKEITEDDLKSLEKDIQKA
FT                   TDDAVKHIDEMTANKEKELLEV"
FT   regulatory      complement(12292..12297)
FT                   /gene="frr"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(12296..13024)
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /product="uridylate kinase"
FT                   /db_xref="GOA:Q8E431"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E431"
FT                   /protein_id="CAD47231.1"
FT                   /translation="MEPKYQRILIKLSGEALAGDKGVGIDIPTVQSIAKEIAEVHNSGV
FT                   QIALVIGGGNLWRGEPAAEAGMDRVQADYTGMLGTVMNALVMADSLQQYGVDTRVQTAI
FT                   PMQTVAEPYVRGRALRHLEKDRIVVFGAGIGSPYFSTDTTAALRAAEIEAEAILMAKNG
FT                   VDGVYNADPKKDANAVKFDELTHVEVIKRGLKIMDATASTISMDNDIDLVVFNMNETGN
FT                   IKRVVLGEQIGTTVSNKASE"
FT   regulatory      complement(13033..13038)
FT                   /gene="pyrH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(13145..13825)
FT                   /transl_table=11
FT                   /gene="gbs1573"
FT                   /product="unknown"
FT                   /note="Similar to oligopeptide or nickel ABC transporter
FT                   (ATP-binding protein)"
FT                   /db_xref="GOA:Q8E430"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E430"
FT                   /protein_id="CAD47232.1"
FT                   /translation="MLVCNHVGKTFGRQEVLKDCHFHLKRGEIIGIMGKSGSGKSSLAR
FT                   LIIGLDSPTCGSIHFQGKNYTPKDGRAQIILVFQDALSSVNPYFSIEEILNEAFYGKKT
FT                   TFELCQILEAVGLDGTYLKYKARQLSGGQLQRVCIARALLLKPKIIIFDESLSGLDPVT
FT                   QIKMLHLLQKIKRRYELSFIMISHDPKICQAICNRVFLIKNGYLVEDNEFLKRACSTNC
FT                   LTNL"
FT   CDS             complement(13812..14600)
FT                   /transl_table=11
FT                   /gene="gbs1574"
FT                   /product="unknown"
FT                   /note="Similar to oligopeptide ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q8E429"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E429"
FT                   /protein_id="CAD47233.1"
FT                   /translation="MEQLEIRKLSLQIGEVPVLRDFSCKIGMGESLTIIGESGSGKTLL
FT                   AKLLVGHIPQGMTVRGNIFFKGVDLGKLTVKQWQKLRGRDIAYLVQNPMSMFNPFQKIE
FT                   AHILETILSHEKCSKRVALSKALEWMKRLNLDDAISLLKKYPFELSGGMLQRIMLATIL
FT                   SLDPQVIILDEPTSAVDCHNCSTISAILQELQNNGKTLITVTHDYQLARDLGGQLLVIS
FT                   EGEVVEQGQTQTILSNPQHNYTKALTVQMEYEGDILNVGL"
FT   regulatory      complement(13834..13839)
FT                   /gene="gbs1573"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(14588..15394)
FT                   /transl_table=11
FT                   /gene="gbs1575"
FT                   /product="unknown"
FT                   /note="Similar to oligopeptide and nickel ABC transporter
FT                   (permease)"
FT                   /db_xref="GOA:Q8E428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E428"
FT                   /protein_id="CAD47234.1"
FT                   /translation="MSKRIYFSSSLLVLLVISAIFAPILSSFDPQYVDLSQKLLAPNNV
FT                   HLLGTDQLGRDVLSRLLYGARYSLFLAIIISLLELTIGMFVGLIVGWYQGKLENLFLWI
FT                   ANIILAFPSFLLSLATVGILGHGLGNLIFAIVFVEWVYYAKLMTNLVKSAKKEPYVINA
FT                   QIMGLSVWHILRKHIFPFVYQPILVMVLMNIGNIILMISGFSFLGIGVQPNITEWGMML
FT                   HDARGYFRTATWMMLSPGIAIFLTVFSFNTLGDAIDKKDWKRQWNS"
FT   CDS             complement(15394..16338)
FT                   /transl_table=11
FT                   /gene="gbs1576"
FT                   /product="unknown"
FT                   /note="Similar to nickel ABC transporter (permease)"
FT                   /db_xref="GOA:Q8E427"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E427"
FT                   /protein_id="CAD47235.1"
FT                   /translation="MYLSSSIIKKILSAFLALFFISLLTFILIKLSTVNPAENYLRLSK
FT                   ISVSPEALKEAEHYLGLDKPLWKQYWLWFQKALTGDFGYSYVLRLPVLDLVLQRFLATL
FT                   FLGTSAFLLIVTISTPLGVWAGLHESSRSDYLIRFLSFSSVSMPSFWVAYLLMLLFSAK
FT                   LNLLPVSGGNDLQSLILPSITLSFSTVGQYIALIRKAISQENRSLNVENARLRGVKERY
FT                   IVTHHLLRNALPAIMTALSLTWVYLLTGSIIVEEIFSWNGIGRLFVTSLRTSDLPVIQA
FT                   CMLIFGTLFLANNFMTQCLMNWVDPRLRKSREK"
FT   regulatory      complement(15400..15405)
FT                   /gene="gbs1575"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(16325..17941)
FT                   /transl_table=11
FT                   /gene="gbs1577"
FT                   /product="unknown"
FT                   /note="Similar to nickel ABC transporter (binding protein)
FT                   "
FT                   /db_xref="GOA:Q8E426"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E426"
FT                   /protein_id="CAD47236.1"
FT                   /translation="MRRNILLSITCLLMVTLTACHSQDSKSHKLNSDKLTLAWGEDFGD
FT                   VNPHRYNPDQFVIQDMVYEGLVRYGDNGKIEPALAESWSISQDGKTYTFKLRNAKYSDG
FT                   SNFNAANVKRNFDSIFSKSNRGNHNWFNLTNQLENYRALNQSTFEIKLKQAYSATLYDL
FT                   SMIRPIRFLSDSAFPKGDDTTKKNVKKPIGTGQWVVKSKKQNEYITFKRNENYWGKKPK
FT                   LKEVTVKVIPDAQTRALAFESGDVDLIYGNGIIGLDTFAQYTKDKKYVTAISQPMSTRL
FT                   LLLNAKETIFQDKKVRQAMNHAIDKVSIAKNTFRGTEKPADTIFSKSTPHSDAKLNPYS
FT                   YNVDKANQLLDQAGWKMGKNKVREKDGKALTLRLPYIATKATDKDLVTYFQGEWRKIGI
FT                   NVSLIAMEEDDYWANAKKGNFDMMLTYSWGAPWDPHAWMSALTAKADHGHPENIALENL
FT                   ATKTEMDRLIKSALVDPKEENVDRDYKKVLELLHDEAVYIPLTYQSVISVYRKGDFKTM
FT                   RFAPEENSFPLRYIEKNNVSK"
FT   regulatory      complement(17951..17957)
FT                   /gene="gbs1577"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(18301..18318)
FT                   /gene="rplA"
FT                   /regulatory_class="terminator"
FT   CDS             complement(18331..19020)
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="GOA:P66093"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66093"
FT                   /protein_id="CAD47237.1"
FT                   /translation="MAKKSKNLRAALEKIDSTKAYSVEEAVALAKETNFAKFDATVEVS
FT                   YNLNIDVKKADQQIRGAMVLPAGTGKTSRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   QGGWLDFDVVIATPDMMALVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDDAKLVDNFKAFNDVIVKAKPATAKGTYITNLSITTTQGVGI
FT                   KVDPNSL"
FT   regulatory      complement(19029..19034)
FT                   /gene="rplA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(19124..19549)
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="GOA:Q8E424"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E424"
FT                   /protein_id="CAD47238.1"
FT                   /translation="MAKKVEKLVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQAGMIIPVVISVYEDKSFDFITKTPPAAVLLKKAAGVEKGSGEPNKTKVATVTRAQ
FT                   VQEIAETKMPDLNAANLESAMRMIEGTARSMGFTVTD"
FT   regulatory      complement(19560..19565)
FT                   /gene="rplK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(19760..21142)
FT                   /transl_table=11
FT                   /gene="gbs1580"
FT                   /product="unknown"
FT                   /note="similar to transmembrane efflux pump protein"
FT                   /db_xref="GOA:Q8E423"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E423"
FT                   /protein_id="CAD47239.1"
FT                   /translation="MLTTKENFKGNNKLLVGIVLAVLSFWLFAQSILNMGPDVQSSLGI
FT                   SSGAMDIGVSSTALFSGLFIVVTGGLADKLGRVKFTFIGLCLNIIGSLLIVLANGAVLF
FT                   IMGRIFQGLAAAFIMPSTMALVKTYYDGKDRQRAVSFWSIGSWGGSGLCSYFGGAVAST
FT                   LGWRYVFIFSIIASVVSFLLILGTPESKNVGQKTHFDYLGLIIFIISMLSLNIGISMAQ
FT                   EHGLMNVIPLSLFTVMLIGFVLFYYVETRKSNSFIDFHLFENRFYLGATISNFLLNAVA
FT                   GTLIVINTYMQQGRQLTPKVAGEMSLGYLVCVLIAIRVGEKILQRFGARKPMLLGAMST
FT                   FVGIFLMTLVNIQGPLYLVLVFVGYALFGTGLGIYATPSTDTAISSIPNEKVGSASGIY
FT                   KMASSLGGAIGVATSIAIYHAFSGNADFHKAALCGLILNLVFCSLSILSILFVIPKKIE
FT                   DK"
FT   CDS             complement(21150..22364)
FT                   /transl_table=11
FT                   /gene="gbs1581"
FT                   /product="unknown"
FT                   /note="similar to hypothetical N-acyl-L-amino acid
FT                   amidohydrolase"
FT                   /db_xref="GOA:Q8E422"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E422"
FT                   /protein_id="CAD47240.1"
FT                   /translation="MANASLRHQLFEKLDQKCDQMVAIRRYLHENPELSFKETKTAAYI
FT                   SDFYKGKDCHVQTQFGGMNGVVVDIYGDKATDKPIKHIALRADFDALPIQEETGLSFAS
FT                   KTAGVMHACGHDAHTAYLLILAESLIELKSEFSGHIRILHQPAEEVPPGGAKAMIEAGC
FT                   LDGIDAVLGIHVMSTMEEGTVQYHAGPIQTGRATFKVILQGKGGHGSMPHRANDTIVAA
FT                   SSFVIAAQTIVSRRVNPFDTAVVTIGSFDGKGSANVIKDSVTLEGDVRVMSEETRGVVE
FT                   EEFKRILDGIAQTYGVSYQLDYQNDYPVLVNNSEVTQKVANSLKSVAIKEILDVIDCDP
FT                   QTPSEDFAYYAQTIPACFFYVGAHEEGQPYYPHHHPKFQIAESSLMVSAKSMATAALAM
FT                   LEEGE"
FT   regulatory      complement(21154..21159)
FT                   /gene="gbs1580"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(22372..22377)
FT                   /gene="gbs1581"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             22623..23528
FT                   /transl_table=11
FT                   /gene="gbs1582"
FT                   /product="unknown"
FT                   /note="similar to transcriptional regulator (LysR family)"
FT                   /db_xref="GOA:Q8E421"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E421"
FT                   /protein_id="CAD47241.1"
FT                   /translation="MKNQQKLMYLESIELYSNITKAAAHLFISQPYLSKVIKQLENELK
FT                   IKLIQSQGHQTFLTYAGQRYLFYLKEIDMIERQMAKELYLIRSDKKGEITLGINSGLAS
FT                   SILANVLPKFNLEHPEISVKLLENNQNISEQLVASGDIDLAVGMAPIVYKDGIASTTIY
FT                   RDELFLMIPTTSQLYNAEKRGQIIPFEYPISVLDNEPLILTPLEYGIGKTIAQFYELHH
FT                   MSLNQMITTSTVPTAASLSLSGMGATFVPQTLIHRYLDKECNVYHFHKNKLFSEYIMIY
FT                   KKDVELSGIALLLYKAFLTK"
FT   CDS             23589..23942
FT                   /transl_table=11
FT                   /gene="gbs1583"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E420"
FT                   /protein_id="CAD47242.1"
FT                   /translation="MIYKIIASLFLVLIPIFSQVLVKIFKLKKFNIMFPDVAFPIFVFL
FT                   IPLISSSLLKQNLLPYYLILISLLAIGITIKLLRTKTLFSYKRFLKLFWRSGFILTFLF
FT                   YLGLLVIIFIKVQ"
FT   regulatory      23946..23967
FT                   /gene="gbs1583"
FT                   /regulatory_class="terminator"
FT   CDS             complement(23971..25686)
FT                   /transl_table=11
FT                   /gene="gbs1584"
FT                   /product="unknown"
FT                   /note="similar to para-aminobenzoate synthase, component I"
FT                   /db_xref="GOA:Q8E419"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E419"
FT                   /protein_id="CAD47243.1"
FT                   /translation="MHIETVIDFKELGKRYRFKNPTKELIADTLEQVLEVIKEVDYYQS
FT                   QNYYVVGYLSYEASAAFDSHFKVSQQKLAGEHLAYFTVHKDCENEAFPLSYENVRLADN
FT                   WTANVSEQEYQEAIANIKGQIRQGNTYQVNYTLELSQQLCSDPFSVYERLMVEQGAGYN
FT                   AYIAYDDKRILSVSPELFFKKKDEVLTTRPMKGTSARKPTYQEDVAERDWLANDPKNRS
FT                   ENMMIVDLLRNDMGRICDVGTVKVKKLCQVEQYATVWQMTSTIEGVLSPEVTLMSIFQA
FT                   LYPCGSITGAPKISTMAIINELEKRPRGIYCGTIGLCMPDGQAIFNVPIRTVQMKGQQA
FT                   YYGVGGGITWESQTDSEYEETRQKSAVLTRVNPKFQLITTGRVTENKLLFSQQHVERLV
FT                   ESASYFAYSFDKSKFERELKKYLHQLDEKDYRLKIMLDKTGKVTFEVKQLVNLSKKFLT
FT                   AEVVVQDYPIKLSPFTYFKTSYRPHIIEGQNEKIFVSPEGLLLETSIGNIVLEKNGRFL
FT                   TPDLSEGGLNGIYRRHLLKNQKVIEAPLTLKDLESADAVYACNAVRGLYPLNLK"
FT   regulatory      complement(25693..25698)
FT                   /gene="gbs1584"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(25733..25760)
FT                   /gene="gbs1585"
FT                   /regulatory_class="terminator"
FT   CDS             complement(25768..28209)
FT                   /transl_table=11
FT                   /gene="gbs1585"
FT                   /product="Unknown"
FT                   /note="Similar to DNA translocase"
FT                   /db_xref="GOA:Q8E418"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E418"
FT                   /protein_id="CAD47244.1"
FT                   /translation="MANKKKTKGKKTRRPTKAEIERQRAIQRMITALVLTIILFFGIIR
FT                   LGIFGITVYNVIRFMVGSLAYLFIAATLIYLYFFKWLRKKDSLVAGFLIASLGLLIEWH
FT                   AYLFSMPILKDKEILRSTARLIVSDLMQFKITVFAGGGMLGALIYKPIAFLFSNIGAYM
FT                   IGVLFIILGLFLMSSLEVYDIVEFIRAFKNKVAEKHEQNKKERFAKREMKKAIAEQERI
FT                   ERQKAEEEAYLASVNVDPETGEILEDQAEDNLDDALPPEVSETSTPVFEPEILAYETSP
FT                   QNDPLPVEPTIYLEDYDSPIPNMRENDEEMVYDLDDDVDDSDIENVDFTPKTTLVYKLP
FT                   TIDLFAPDKPKNQSKEKDLVRKNIRVLEETFRSFGIDVKVERAEIGPSVTKYEIKPAVG
FT                   VRVNRISNLSDDLALALAAKDVRIEAPIPGKSLIGIEVPNSEIATVSFRELWEQSDANP
FT                   ENLLEVPLGKAVNGNARSFNLARMPHLLVAGSTGSGKSVAVNGIISSILMKARPDQVKF
FT                   MMIDPKMVELSVYNDIPHLLIPVVTNPRKASKALQKVVDEMENRYELFSKIGVRNIAGY
FT                   NTKVEEFNASSEQKQIPLPLIVVIVDELADLMMVASKEVEDAIIRLGQKARAAGIHMIL
FT                   ATQRPSVDVISGLIKANVPSRIAFAVSSGTDSRTILDENGAEKLLGRGDMLFKPIDENH
FT                   PVRLQGSFISDDDVERIVGFIKDQAEADYDDAFDPGEVSETDNGSGGGGGVPESDPLFE
FT                   EAKGLVLETQKASASMIQRRLSVGFNRATRLMEELEAAGVIGPAEGTKPRKVLMTPTPS
FT                   E"
FT   regulatory      28374..28379
FT                   /gene="gbs1586"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             28384..29187
FT                   /transl_table=11
FT                   /gene="gbs1586"
FT                   /product="Unknown"
FT                   /note="similar to peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="GOA:Q8E417"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E417"
FT                   /protein_id="CAD47245.1"
FT                   /translation="MKKIIYLGLACVSILTLSGCESIERSLKGDRYVDQKLAENSSKEA
FT                   TEQLNKKTKQALKADKKAFPQLDKAVAKNEAQVLIKTSKGDINIKLFPKYAPLAVENFL
FT                   THAKEGYYNGLSFHRVIKDFMIQSGDPNGDGTGGKSIWNSKDKKKDSGNGFVNEISPYL
FT                   YNIRGSLAMANAGADTNGSQFFINQSQQDHSKQLSDKKVPKVIIKAYSEGGNPSLDGGY
FT                   TVFGQVISGMETVDKIASVEVTKSDQPKEKITITSIKVIKDYKFK"
FT   regulatory      29200..29225
FT                   /gene="gbs1586"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(29200..29225)
FT                   /gene="gbs1587"
FT                   /regulatory_class="terminator"
FT   CDS             complement(29239..30072)
FT                   /transl_table=11
FT                   /gene="gbs1587"
FT                   /product="Unknown"
FT                   /note="similar to metal ABC transporter (permease)"
FT                   /db_xref="GOA:Q8E416"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E416"
FT                   /protein_id="CAD47246.1"
FT                   /translation="MFTKFFEGLLTYHFLQNAFITAIVIGIVAGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVAISFILGINFFIGAIVFGLLSSIIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGIILIGLANSTTDLFHILFGNILAVQDSDKYMTIIVGLIVLTLITIFFKELLLTSFD
FT                   PVLAKSMGMRVSFYHYLLMILLTLVAVTAMQSVGTILIVALLITPAATAYLYVKSLRTM
FT                   LFLSSALGAVASVLGLYIGYTFNIAAGSSIVLTSTFMFLLAFLFSPKQSLFKKKQ"
FT   CDS             complement(30074..30790)
FT                   /transl_table=11
FT                   /gene="gbs1588"
FT                   /product="unknown"
FT                   /note="similar to metal ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q8E415"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E415"
FT                   /protein_id="CAD47247.1"
FT                   /translation="MIISKHLSVSYDNNLVLEDINLRLEGSGIIGILGPNGAGKSTLMK
FT                   ALLGLVDSTGESGIGGDLLPLMGRVAYVEQKTNIDYQFPITVGECVSLGLYKERGLFKR
FT                   LSKTDWEKVSRVIDQVGLRGFENRPINALSGGQFQRMLMARCLVQEADYIFLDEPFVGI
FT                   DSISEQIIVNLLKKLSKAGKLILVVHHDLSKVDHYFDQVIILNRHLIACGPIDQAFTRE
FT                   NLSAAYGDAILLGQGD"
FT   regulatory      complement(30078..30083)
FT                   /gene="gbs1587"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(30795..30800)
FT                   /gene="gbs1588"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(30961..31887)
FT                   /transl_table=11
FT                   /gene="gbs1589"
FT                   /product="unknown"
FT                   /note="similar to metal ABC transporter (binding protein)"
FT                   /db_xref="GOA:Q8E414"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E414"
FT                   /protein_id="CAD47248.1"
FT                   /translation="MKKWLVIVSCFVAFLGLGACANKQDQAKNEKLKVVVTNSILADIT
FT                   KNIAGNKIDLHSIVPVGKDPHEYEPLPADVEKTTQADLVFYNGINLETGGNAWFTKLIK
FT                   NAKKKDNKDYFAVSDGVDVIYLNGQSGKGKEDPHAWLNLENGIIYSKNIAKQLIAKDPK
FT                   NKATYEKNRDAYVAKLEKLDKEAKSKFNAIPANKKLIVTSEGCFKYFSKAYGVPSAYIW
FT                   EINTEEEGTPDQITSLVKKLKQVRPSALFVESSVDKRPMKSVSRESGIPIYAEIFTDSI
FT                   AKKGQKGDSYYAMMKWNLDKIAEGLAK"
FT   regulatory      complement(31894..31899)
FT                   /gene="gbs1589"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      32040..32046
FT                   /gene="gbs1590"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             32054..32701
FT                   /transl_table=11
FT                   /gene="gbs1590"
FT                   /product="Unknown"
FT                   /note="similar to metal-dependent transcriptional
FT                   regulator"
FT                   /db_xref="GOA:Q8E413"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E413"
FT                   /protein_id="CAD47249.1"
FT                   /translation="MTPNKADYLKCIHELGEKNNKISNKKIAEMMQVSAPAVSEMIKKM
FT                   ISEQLIVKDKDLGYYLTKQGLLVVSDLYRKHRLVEVFLVNHLHYTADDIHEEAEVLEHT
FT                   VSTTFVDQLEKLLDFPQFCPHGGTIPKKGEFLVEINQMTLDQISQLGTYVISRVHDDFQ
FT                   LLKYLEQHRLHINDTIELTQIDPYAKTYHITYNDENLTIPERIASQIYVSAT"
FT   regulatory      32710..32736
FT                   /gene="gbs1590"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(32712..32734)
FT                   /gene="gbs1591"
FT                   /regulatory_class="terminator"
FT   CDS             complement(32741..33430)
FT                   /transl_table=11
FT                   /gene="gbs1591"
FT                   /product="Unknown"
FT                   /note="Similar to 5'-methylthioadenosine
FT                   nucleosidase/S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="GOA:Q8E412"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E412"
FT                   /protein_id="CAD47250.1"
FT                   /translation="MKIGIIAAMEEELKLLVENLEDKSQETVLSNVYYSGRYGEHELVL
FT                   VQSGVGKVMSAMSVAILVESFKVDAIINTGSAGAVATGLNVGDVVVADTLVYHDVDLTA
FT                   FGYDYGQMSMQPLYFHSDKTFVSTFEAVLSKEEMTSKVGLIATGDSFIAGQEKIDVIKG
FT                   HFPQVLAVEMEGAAIAQAAQATGKPFVVVRAMSDTAAHDANITFDEFIIEAGKRSAQVL
FT                   MAFLKAL"
FT   regulatory      complement(33438..33443)
FT                   /gene="gbs1591"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(33440..33709)
FT                   /transl_table=11
FT                   /gene="gbs1592"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E411"
FT                   /protein_id="CAD47251.1"
FT                   /translation="MGKPLLTDDMIERSNRGEKVSGQTILDQETKIISTEDGMEQLTDE
FT                   NGKHIYKSRRIENAKRNEFQRKLNLVLFILLILLALLFYAIFKL"
FT   CDS             complement(33709..34263)
FT                   /transl_table=11
FT                   /gene="gbs1593"
FT                   /product="Unknown"
FT                   /note="Similar to ADP-ribose pyrophosphatase"
FT                   /db_xref="GOA:Q8E410"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E410"
FT                   /protein_id="CAD47252.1"
FT                   /translation="MDFEEKTINRQTVFDGQIIKVAVDDVELPNGLGQSKRELVFHGGA
FT                   VATLAVTPEHKIVLVKQYRKAIEGISYEIPAGKLETGESGSKEEAALRELEEETGYTGN
FT                   LEILYSFYTAIGFCNEKIVLYLATDLQKVENPRPQDDDEVLELLELSYEDCMQMVEKGM
FT                   IQDAKTIIALQYYGLKMGGHS"
FT   regulatory      complement(33719..33724)
FT                   /gene="gbs1592"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(34269..34274)
FT                   /gene="gbs1593"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(34284..35663)
FT                   /transl_table=11
FT                   /gene="gbs1594"
FT                   /product="Unknown"
FT                   /note="similar to UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /db_xref="GOA:Q8E409"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E409"
FT                   /protein_id="CAD47253.1"
FT                   /translation="MSNYAIILAAGKGTRMKSDLPKVMHKVSGITMLEHVFRSVQAIEP
FT                   SKIVTVIGHKAELVRDVLGDKSEFVMQTEQLGTGHAVMMAEEELATSKGHTLVIAGDTP
FT                   LITGESLKNLIGFHVNHKNVATILTADAANPFGYGRIIRNSDDEVTKIVEQKDANDFEQ
FT                   QVKEINTGTYVFDNQSLFEALKDINTNNAQGEYYLTDVIGIFKEAGKKVGAYKLRDFDE
FT                   SLGVNDRVALATAEKVMRHRIARQHMVNGVTVVNPDSAYIDIDVEIGEESVIEPNVTLK
FT                   GQTKIGKGTLLTNGSYLVDAQVGNDVTITNSMVEESIISDGVTVGPYAHIRPGTSLAKG
FT                   VHIGNFVEVKGSQIGENTKAGHLTYIGNAEVGCDVNFGAGTITVNYDGQNKFKTEIGSN
FT                   VFIGSNSTLIAPLEIGDNALTAAGSTITDNVPIDSIAIGRGRQVNKEGYANKKPHHPSQ
FT                   K"
FT   regulatory      complement(35671..35676)
FT                   /gene="gbs1594"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(35896..35913)
FT                   /gene="gbs1595"
FT                   /regulatory_class="terminator"
FT   CDS             complement(35907..36320)
FT                   /transl_table=11
FT                   /gene="gbs1595"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E408"
FT                   /protein_id="CAD47254.1"
FT                   /translation="MVKALETYIVTNGNGRQAVDFYKDVFQADLVNMMTWEEMDPNCLE
FT                   DRKDLIINAQLIFDGIRLQISDENPDFVYQAGKNVTAAIIVGSVEEAREIYEKLKKSAQ
FT                   EVQLELQETFWSPAYANLVDQFGVMWQISTELN"
FT   regulatory      complement(36325..36330)
FT                   /gene="gbs1595"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(36333..36710)
FT                   /transl_table=11
FT                   /gene="gbs1596"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E407"
FT                   /protein_id="CAD47255.1"
FT                   /translation="MISSIGQVMLYVSNVEASADFWKNKVGFERVEKQTQGDYVTYIVA
FT                   PKLDSEVSFVLHDKAIIAQMSPELDLATPSILFETTDIDSTYQELTANEVMTNPIVDMG
FT                   SMRVFNFSDNDNNYFAIREVK"
FT   regulatory      complement(36719..36726)
FT                   /gene="gbs1596"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(36778..36793)
FT                   /gene="gbs1597"
FT                   /regulatory_class="terminator"
FT   CDS             complement(36799..37755)
FT                   /transl_table=11
FT                   /gene="gbs1597"
FT                   /product="unknown"
FT                   /note="similar to oxidoreductase"
FT                   /db_xref="GOA:Q8E406"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E406"
FT                   /protein_id="CAD47256.1"
FT                   /translation="MKLAVLGTGMIVKEVLPVLQKIEGIDLVAILSTVRSLETAKDLAK
FT                   EYNMSLATSEYKAVLDNEEIDTVYIGLPNHLHFDYAKEALLAGKHVICEKPFTLEASQL
FT                   EELVSIANTRQLILLEAITNQYLPNFDLVKEHLSNLGDIKIVECNYSQYSSRYDAFKRG
FT                   EIAPAFNPEMGGGALRDLNIYNLHLVIGLFGEPITAQYLPNIERGIDTSGVLVLDYGHF
FT                   KTVCIGAKDCSAEVKSTIQGDKGSIAILGPTNTMPKISLTMNGQESHVYQLNGDRHRMH
FT                   DEFVIFEGIISNLDFKRAAQALEHSRTVMKVLDMVTK"
FT   CDS             complement(37752..38006)
FT                   /transl_table=11
FT                   /gene="gbs1598"
FT                   /product="Unknown"
FT                   /note="similar to unknown proteins C-terminal end"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E405"
FT                   /protein_id="CAD47257.1"
FT                   /translation="MDSNDEAICIIEITKVDIVPFKDVSADHAFKEGEGEGDKTLEWWR
FT                   KAHIDFFKPYFEEFGLMFSEDSRIVLEEFQVVYPKEINE"
FT   regulatory      complement(37763..37768)
FT                   /gene="gbs1597"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(37967..38209)
FT                   /transl_table=11
FT                   /gene="gbs1599"
FT                   /product="Unknown"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E404"
FT                   /protein_id="CAD47258.1"
FT                   /translation="MKAQELWNKFKSLNPSIGDEIDAWQFGAEPDLLAKLVVDGTKTAT
FT                   ASAYDLYELDEEGLHKLVHMILFWIAMMKLSVLLK"
FT   regulatory      complement(38214..38219)
FT                   /gene="gbs1599"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(38448..39146)
FT                   /transl_table=11
FT                   /gene="gbs1600"
FT                   /product="Unknown"
FT                   /note="similar to oxidoreductases"
FT                   /db_xref="GOA:Q8E403"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E403"
FT                   /protein_id="CAD47259.1"
FT                   /translation="MTKVVLVTGCASGIGYAQAQYFLKQGYQVYGVDKSDKPNLNGNFN
FT                   FIKLDLSSDLSPLFTMVPTVDILCNTAGILDAYKPLLEVSDEELEHLFDINFFVTVRLT
FT                   RHYLRRMVEKKSGIIINMCSIASFIAGGGGAAYTSSKHALAGFTRQLALDYAKDCIQIF
FT                   GIAPGAVQTAMTASDFEPGGLAEWVASETPIGRWTKPSEVAELTGFLASGKARSMQGEI
FT                   VKIDGGWSLK"
FT   CDS             complement(39139..39375)
FT                   /transl_table=11
FT                   /gene="gbs1601"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E402"
FT                   /protein_id="CAD47260.1"
FT                   /translation="MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTLEVNGKVLQATP
FT                   YFLINVTGEGEGFSMWAPTPCDVLAEDWIEVND"
FT   regulatory      complement(39381..39386)
FT                   /gene="gbs1601"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(39465..39713)
FT                   /transl_table=11
FT                   /gene="gbs1602"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E401"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E401"
FT                   /protein_id="CAD47261.1"
FT                   /translation="MEKITNDFEKVIAVLNQLSISYELVENGPVLLTEQADNFIVGIEG
FT                   VRTKIMFLTNKKKTKYYLLIMDDQKLFYPMKTIVAFR"
FT   CDS             complement(39911..40411)
FT                   /transl_table=11
FT                   /gene="gbs1603"
FT                   /product="Unknown"
FT                   /note="similar to other proteins"
FT                   /db_xref="GOA:Q8E400"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E400"
FT                   /protein_id="CAD47262.1"
FT                   /translation="MACIIRRARLGDEVNLAYIQTESWKAAFGKILPEDIIQKTTEIEP
FT                   AITMYQQLLHKEVGKGYILEVDSNPHCMAWWDKSREDGMLDYAELICIHSLKEGWGKGY
FT                   GSQMMNHVLSEIQQAGYNKVILWVFTENTRARKFYDRFGFSFKGKSKTYFEKEEMCYEK
FT                   ILH"
FT   regulatory      complement(40421..40426)
FT                   /gene="gbs1603"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(40651..41106)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbs1604"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins (C-terminal end)"
FT   CDS             complement(41107..42063)
FT                   /transl_table=11
FT                   /gene="gbs1605"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins (N-terminal part) "
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z9"
FT                   /protein_id="CAD47264.1"
FT                   /translation="MALFFTFLKVSQVIFLVLLIAYASFLVISLVIGGVHLYEKNERKK
FT                   SLTRNKEKIPISIIVPAYNESTTIVSSIDSLLHLDYEAYEIIVVDDGSSDNTSDVLKEE
FT                   FALMKISNTIDSIIATQTCKDVFQRQVGKVKLTLIVKENGGKGDALNMGINAANYDYFL
FT                   CLDADSMLQVDSLSQISKSIQVDPTVIAVGGLVQVAQGVKIEQGKVASYRLPWRIIPCA
FT                   QALEYDSSFLGARIFLDYLRANLIISGAFGLFKKDLVKAVGGYDTQTLGEDMELVMKLH
FT                   FFCRNNNIPYRICYETDAVCWSQAPTNLGDLRKQRRR"
FT   regulatory      complement(42070..42075)
FT                   /gene="gbs1605"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(42203..44362)
FT                   /transl_table=11
FT                   /gene="gbs1606"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z8"
FT                   /protein_id="CAD47265.1"
FT                   /translation="MKKYLSIVALLTILFSSIYYLYYFDGSLYLPKGLLKENTRTNFVV
FT                   KGDTVLHKPTNKPFVVKGVDVESSLAGYHHNDFPITQKTYREWFHLISNMGANTVRVKV
FT                   PMNVAFYDALYHHNKASKRPLYLLQGIRIDSYRNNASITAFNDNYRGYLKREAKGVVDI
FT                   LHGRKQVWNTDFGSRHYHYDLSPWVLGYVVGDDWNSGTVAYTNHQEKKTQYKGRYFKTS
FT                   VAANPFEVMLAQVMDELTHYETAKYGWQHLISFSNSPTTDPFHYRKPFEAQAPKYVQLN
FT                   VENIQANSNVKAGMFAAYKAIDFHPRYKDYLLFDKENISKEDRQKIKELSLSQGYVKLL
FT                   NAYHKIPVLVTGYGYSTARGIAQKEIDKRPLPINEKEQGQRLLEDYESFISSGSFGATI
FT                   NAWQDDWNARAWNTSFATNKHSQFLWGDAQVFNQGYGLLGFKNAKHHYQVDGKRGKGEW
FT                   KHPLMTSATGDDLYASSDESYLYLAIKTKPEKLKEKRLLPIDITPKSGSRKMNGSKVTF
FT                   SKSSDFVLSIDPNGKSELFVQERYNALKANYLRQLNGKDFYAFPPKKNSSNFEQINMVL
FT                   RNTKIVEDMEKVKATERFLPTHPTGLLKTGTTDRHQKTFDSQTDISFGKDFIEVRIPWQ
FT                   LLNFSDPSSQKIHDDYFKHYGVKELEIESIALGLGANSKENTLIKMADYRLKNWERPDT
FT                   KTFLKDSYYSIKKEWSKERERTYGT"
FT   CDS             complement(44369..45814)
FT                   /transl_table=11
FT                   /gene="gbs1607"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z7"
FT                   /protein_id="CAD47266.1"
FT                   /translation="MGRLMRGKVIYGTTLIGLFLFLFFYFWIPKHHIERIHHHRIKQVD
FT                   AKSDLTGFKTHLPIISIDTKQQVIPLVTKEGGKYVKARDNINVDIELRDSPSRSHHLSE
FT                   KPRIRTKGLISYRGNSSRYFDKKSLKVKFVTNKLKEKKHRLAGMPKESEWVLHGPFLDR
FT                   TLLRNYLSYNIAGEIMSYAPNVRYCELFVNGEYQGVYLAVENIEQGEQRVPIEKSDKKL
FT                   HKTPYIVAWDREHKAKQKLDNYVHYTHQSGISALDVKYPGKQRLTSKQLEFINKDINHI
FT                   EKVLYSYDFSQYPKYIDRESFANYFVINEFFRNVDAGKFSTYLYKDLRDRAKLVVWDFN
FT                   NAFDNQIEGRVDEADFTLTDAPWFNMLIKDKAFIDLVVHRYKELRKGVLATEYLSNYID
FT                   ETRHFLGPAIDRNYKKWGYVFDLKNTDPRNYLIPTERNVTSYHKSVEQLKDFIKKRGRW
FT                   MDRNIETLYQYSAPSKNTNTLLE"
FT   regulatory      complement(44371..44376)
FT                   /gene="gbs1606"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(45807..46484)
FT                   /transl_table=11
FT                   /gene="gbs1608"
FT                   /product="Unknown"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z6"
FT                   /protein_id="CAD47267.1"
FT                   /translation="MKDLLRNSLEQSGNLSFQDMILHILVAALLSVVIYVSYAYTHSGT
FT                   AYSKKFNVSLMTLTVLTATVMTVIGNNVALSLGMVGALSVVRFRTAIKDSRDTVYIFWT
FT                   IVVGICCGVGDYVVAALGSSVIFILLWVMGRVKNENRMLLIVKCDRTLEVDLEGIFFQY
FT                   FDGKAVQRVKNSTTNTIEMIFEISRKDYDKQLHVDNQLTEKVYQLGNIDYFNIVSQSDE
FT                   ING"
FT   regulatory      complement(46496..46501)
FT                   /gene="gbs1608"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(46536..47147)
FT                   /transl_table=11
FT                   /gene="gbs1609"
FT                   /product="Unknown"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z5"
FT                   /protein_id="CAD47268.1"
FT                   /translation="MTLDSHSSDDGYTIRSLYFDSLEDVDWQEKEDGVEIRRKIRLRNY
FT                   GSQSNFAKLEMKQKQGANQKKRSLKLSKTDAQALINGNNSVLLNYPDTFAAECYSRITT
FT                   QLYQPKTVIEYQRKAFVAKENNIRITFDHHIIGTEASYDIFSEDLNQNYLLDPYLVILE
FT                   VKYNGFLLSYIKELLDSVDRSELSASKYCLGRAVSKHYRF"
FT   CDS             complement(47595..48932)
FT                   /transl_table=11
FT                   /gene="gbs1610"
FT                   /product="Unknown"
FT                   /note="Similar to branched-chain amino acid transporter "
FT                   /db_xref="GOA:Q8E3Z4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z4"
FT                   /protein_id="CAD47269.1"
FT                   /translation="MVKKGFLTGLLLFGIFFGAGNLIFPPALGVASGQDFWPAILGFCL
FT                   SGVGLAIITLLLGTLTNGGYKTEMSEKFSPWFSLTFLVILYLTIGPLFAIPRTATVSFE
FT                   IGVAPIVGHSPIALLCFTACFFAAAYYLAIRPNGILDSVGKILTPVFAFLILSLVVVGA
FT                   IAYGNLESAKASADYAGKAFGSGVLAGYNTLDALAAVAFCLVATETLKKFGFKTKKEYL
FT                   STIWIVGIVTSLAFSILYIGLGFLGNKFPVPADILADPNVNKGAYVLSQASYKLFGNFG
FT                   RYFLSIMVTLTCFTTTVGLIVSVSEFFDKNFRFGNYKLFATVFTLIGFLIANLGLNAVI
FT                   TFSVPVLTLLYPIVIVIVLIILINKWLPLSKKGMSLTIGLVTLVSFVEVLAGQWQEKTL
FT                   TQLVGFLPFHTISMGWLVPMLIGIVFSLVLSDKQKGQAFDLEKFEG"
FT   regulatory      complement(49108..49120)
FT                   /gene="metS"
FT                   /regulatory_class="terminator"
FT   CDS             complement(49128..51125)
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="GOA:Q8E3Z3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z3"
FT                   /protein_id="CAD47270.1"
FT                   /translation="MTEKKSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDV
FT                   QYLTGLDEHGQKIQQKAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEE
FT                   AVAKIFEQLLAQGDIYLGEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEV
FT                   EKVSEESYFFRMSKYADRLKAYYAEHPEFIQPDGRMNEMLKNFIEPGLEDLAVSRTTYT
FT                   WGVQVPSNPKHVIYVWIDALMNYISALGYGWSDDLSQYHKFWPADIHMIGKDILRFHSI
FT                   YWPIMLMALDLPLPKRLVAHGWFVMQDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRS
FT                   LPVGSDGTFTPEDYVGRINYELANDLGNLLNRTIAMVNKYFDGEVPRFAVATDFDADLA
FT                   SVATDSIENYHKQMEAVDFPRALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLAAVM
FT                   SHLVASLRVVAHLIQPFMMETSDAIMEQLGLGATFDLEKLTFADLPEGVRVVAKGSPIF
FT                   PRLDMEDEITYIKEQMNAGKAPVEKEWVPEEVELTSSKGQIKFEDFDAVEIRVAEVIEV
FT                   EKVEGSDKLLRFRLDAGDEGHRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKYV
FT                   SQGMILSAEHDGKLTVLTVDSAVANGSIIG"
FT   regulatory      complement(51130..51135)
FT                   /gene="metS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             51268..52143
FT                   /transl_table=11
FT                   /gene="gbs1612"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="GOA:Q8E3Z2"
FT                   /db_xref="InterPro:IPR004537"
FT                   /db_xref="InterPro:IPR014431"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z2"
FT                   /protein_id="CAD47271.1"
FT                   /translation="MVNTKTLLPYKTMPVWTAQSIPKAFLEKHNTKEGTWAKLTILSGS
FT                   LVFYQLSPDGEEISRHIFDASSDIPFVDPQVWHKVSPNSPDLSCYLTFYCQKEDYFHKK
FT                   YGLTRTHSEVIASAPLLSEKSNILDLGCGQGRNSLYLSLLGHQVTSVDSNGQSLVALEN
FT                   MALEEELPYNIKRYDINTAAIEGHYDFILSTVVFIFLNPDCISDIILQMQSHTQIGGYN
FT                   LIVSAMDTAENPCPLPFPFTFKEGQLKSYYNDWEIIKYNENLGELHRVDENGNRLKLQF
FT                   ATLLARKLRS"
FT   regulatory      52146..52165
FT                   /gene="gbs1612"
FT                   /regulatory_class="terminator"
FT   CDS             complement(52301..52996)
FT                   /transl_table=11
FT                   /gene="gbs1613"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z1"
FT                   /protein_id="CAD47272.1"
FT                   /translation="MSKKSHRQYQIYEGLRCAVALCFISGYINAFTYVTQGKRFAGVQT
FT                   GNLLSFAIHLSNKHYSQALAFLLPIMVFMLGQSFTYFMNRWANKHQLHWYLLSSFALTQ
FT                   VAIVTIILTPFLPSSFTVAGLAFFASIQVDTFKSLRGAPYANMMMTGNIKNAAYLLTKG
FT                   LYEKNSDIFLIARNTIIIIGGFIFGVVCSTYFSSKLGEWSLSLILIPLLYVNLLLGHEF
FT                   YNLQVERHS"
FT   regulatory      complement(53002..53007)
FT                   /gene="gbs1613"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      53314..53319
FT                   /gene="gbs1614"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             53332..54549
FT                   /transl_table=11
FT                   /gene="gbs1614"
FT                   /product="Unknown"
FT                   /note="Similar to PTS enzyme IIC"
FT                   /db_xref="GOA:Q8E3Z0"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Z0"
FT                   /protein_id="CAD47273.1"
FT                   /translation="MHSTIYKCHHCRYLIYKSFKDIFPFALIFSWIEILQKLVISDDSF
FT                   LAQTTKSSIYKNEWLYTVSNTLYDLSHLLIYFMASYFVASLVWRGLSNQTKESFSASLL
FT                   GFATVWLLLTSVVPGTDYHYPSQPIWLMLALISYLFIFLTRLLQNRHHIFQYSMLAILL
FT                   LISSILSHILYRYPNIDLEYLIQNHFSQWLGDGPHQLIPIMLWSILAIFLTLSGLFVPD
FT                   ILFRPYSYFSVVSENLNAALSQHTDKIPYLYTFYTVKNSFAMFGGIGILLSLFLAVLYE
FT                   SRKLQSKNYYKLTLLTLTPLIFDQNLPFLVGLPVILQPILFIPMVLTTIFAEAFGALML
FT                   YLKFVDPAVYTVPSGTPSLLFGFLASNGDWRYLPVTAIILVVGFFIYRPFVKIAFAKEE
FT                   QYEKIT"
FT   regulatory      54521..54526
FT                   /gene="gbs1615"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             54533..55375
FT                   /transl_table=11
FT                   /gene="gbs1615"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y9"
FT                   /protein_id="CAD47274.1"
FT                   /translation="MKKLLRWLPPVLFIIILIGMTILGKSYINKVTAHKIKLYNSRMTP
FT                   TILIPGSSATQERFNSMLAQLNQMGEKHSVLKLTVKKDNSIIYNGQISGNDHKPYIVIG
FT                   FENNEDGYSNIKKQTKWLQIAMNDLQKKYKFKRFNAIGHSNGGLSWTIFLEDYYDSDEF
FT                   DMKSLLTMGTPFNFEESNTSNHTQMLKDLISNKGNIPSSLMVYNLAGTNSYDGDKIVPF
FT                   ASVETGKYIFQETAKHYTQLTVTGNNATHSDLPDNPEVIQYVAEKILKNEKGKLPKPH"
FT   regulatory      55438..55443
FT                   /gene="gbs1616"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             55452..56279
FT                   /transl_table=11
FT                   /gene="gbs1616"
FT                   /product="Unknown"
FT                   /note="Similar to 3'-exo-deoxyribonuclease"
FT                   /db_xref="GOA:Q8E3Y8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y8"
FT                   /protein_id="CAD47275.1"
FT                   /translation="MKLISWNIDSLNAALTSESTRALMSRQVIDTLVAEDADIIAIQET
FT                   KLSAKGPTKKHLEVLETYFPEYDLVWRSSVEPARKGYAGTMFLYRKGLNPIVSFPEIDA
FT                   PTTMDNEGRIITLELENCYITQVYTPNAGDGLKRLGDRQIWDIKYAEYLATLDSQKPVL
FT                   ATGDYNVAHKEIDLANPSSNRRSAGFTDEERQGFTNLLAKGFTDTFRYLHGDVPNVYSW
FT                   WAQRSRTSKINNTGWRIDYWLTSNRVADKITKSEMIHSGDRQDHTPIILEIEL"
FT   regulatory      56291..56316
FT                   /gene="gbs1616"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(56291..56316)
FT                   /gene="gbs1617"
FT                   /regulatory_class="terminator"
FT   CDS             complement(56320..56676)
FT                   /transl_table=11
FT                   /gene="gbs1617"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y7"
FT                   /protein_id="CAD47276.1"
FT                   /translation="MYTFYEYPKCTTCRSAKKELTELGLTFEAIDIKSNPPKASLLKEL
FT                   LENSPYDLKKFFNTSGNSYRELGLKDKFDDLTLDQALDLLASDGMLIKRPLLVKDNKIL
FT                   QIGYRTKYKDLNLV"
FT   CDS             complement(56678..57154)
FT                   /transl_table=11
FT                   /gene="gbs1618"
FT                   /product="Unknown"
FT                   /note="similar to O6-alkylguanine-DNA-alkyltransferase"
FT                   /db_xref="GOA:Q8E3Y6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y6"
FT                   /protein_id="CAD47277.1"
FT                   /translation="MLYQEFYQSPLGEIRLLADNLGLSGLYFVGQKYDMLAVNQEEIVN
FT                   MSNSYTLLGKKWLDAYFSQQNLPSIPLSLRGTAFQTRVWQELQKIPFGDTKTYGELAKE
FT                   LNCPSAQAVGGAIGKNPISLIIPCHRVLGRYGQLTGYAGGLERKSWLLEYEKEK"
FT   regulatory      complement(56683..56688)
FT                   /gene="gbs1617"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(57210..58391)
FT                   /transl_table=11
FT                   /gene="gbs1619"
FT                   /product="Unknown"
FT                   /note="similar to phosphoglycerate dehydrogenase "
FT                   /db_xref="GOA:Q8E3Y5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y5"
FT                   /protein_id="CAD47278.1"
FT                   /translation="MVFSVKTFNNINQIGLQELGNRFQIDGDMSENPDAYIIRSQNLHN
FT                   QDFPSNLKAIARAGAGTNNIPIEEASAQGIVVFNTPGANANAVKEAVIAALLLSARDYL
FT                   GANRWVNTLTGTDIPKQIEAGKKAFAGNEIAGKKLGVIGLGAIGARIANDARRLGMTVL
FT                   GYDPYVSIETAWNISSHVQRVKEIKDIFETCDYITIHVPLTNETKHTFDAEAFSIMKKG
FT                   TTIINFARAELVNNQELFKAIETGVVKRYITDFGDKELLNQKGITVFPHVGGSTDEAEL
FT                   NCAIMASQTIRCFMETGEITNSVNFPNVHQIQTAPFRITLINKNVPNIVAKISTAVSEL
FT                   GINIDNIINRSKGDYAYTLIDLDETDNNKISTLIEEFEGDENIVRVRLIAKQQ"
FT   CDS             complement(58453..59001)
FT                   /transl_table=11
FT                   /gene="gbs1620"
FT                   /product="Unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3Y4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y4"
FT                   /protein_id="CAD47279.1"
FT                   /translation="MQVRLAFPNEIDQIMLLIEEARAEIAKTGSDQWQKEDGYPNRNDI
FT                   IDDILNGYAWVGIEDGMLATYAAVIDGHEEVYDAIYEGKWLHDNHRYLTFHRIAISNQF
FT                   RGRGLAQTFLQGLIEGHKGPDFRCDTHEKNVTMQHILNKLGYQYCGKVPLDGVRLAYQK
FT                   IKEKGETSIYREIDERNPM"
FT   CDS             complement(59070..60161)
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /product="Unknown"
FT                   /note="similar to phosphoserine aminotransferase "
FT                   /db_xref="GOA:Q8E3Y3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3Y3"
FT                   /protein_id="CAD47280.1"
FT                   /translation="MTIYNFSAGPAVLPKPVLVKAQSELLNYQGSSMSVLEVSHRSKEF
FT                   DDIIKGAERYLRDLMGIPDNYKVIFLQGGASLQFSMIPLNIARGRKAYYHVAGSWGKKA
FT                   YTEAVKLSKTIPFEPILLASSEESVYDYIPEFDEKEIDPEAAYVHVTTNNTIEGTSLYD
FT                   IPKTNGVPVIADMSSNILAVKYKVEDFAMIYAGAQKNIGPAGVTVVIIREDMINEEPTL
FT                   SSMLDYKIQSDASSLYNTPPAYSIYIAKLVFEWVKSLGGVDAMEKANREKSGLLYDYID
FT                   SSEFYSNPVRDKKSRSLCNIPFITINKDLDEKFVKEATERGFKNIKGHRSVGGMRASLY
FT                   NAFPKQGVIELIDFMKTFEAENA"
FT   regulatory      complement(60168..60173)
FT                   /gene="serC"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      60283..60288
FT                   /gene="gbs1622"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             60294..60929
FT                   /transl_table=11
FT                   /gene="gbs1622"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="GOA:Q8E3Y2"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y2"
FT                   /protein_id="CAD47281.1"
FT                   /translation="MILREFCAENLTDLTRLDKAIISRVELCDNLAAGGTTPSYGVIKE
FT                   ANQYLHEKGISVAVMIRPRGGNFVYNDLELRIMEEDILRAVELESDALVLGILTSNNHI
FT                   DTEAIEQLLPATQGLPLVFHMAFDVIPKSDQKKAIDQLVALGFTRILLHGSSNGEPIIE
FT                   NIKHIKALVEYANNRIEIMVGGGVTAENYQYICQETGVRQAHGTRITQ"
FT   regulatory      complement(61158..61183)
FT                   /gene="gbs1623"
FT                   /regulatory_class="terminator"
FT   CDS             complement(61199..62062)
FT                   /transl_table=11
FT                   /gene="gbs1623"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3Y1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Y1"
FT                   /protein_id="CAD47282.1"
FT                   /translation="MQVQKSFKSNTHYGTLYLVPTPIGNLDDMTFRAIRILREVDFICA
FT                   EDTRNTGLLLKHFDITTKQISFHEHNAYDKISGLIDLLKEGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIEGGIPVVSIPGASAGITALIASGLAPQPHIFYGFLPRKKGQQITFFETKKD
FT                   YPETQIFYESPFRVSDTLKHMKEIYGDRQVVLVRELTKLYEEYQRGTISQLLGHIEKVP
FT                   LKGECLIIVDGKRDTERVKDSSQQDPLVLVKEYIANGDKTNQAIKKVAKELNLNRQELY
FT                   ASFHDL"
FT   CDS             complement(62068..62394)
FT                   /transl_table=11
FT                   /gene="gbs1624"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3Y0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3Y0"
FT                   /protein_id="CAD47283.1"
FT                   /translation="MDKKDLFDAFDDFSQNLLVGLSEIETMKKQIQKLLEENTVLRIEN
FT                   GKLRERLSVIEAETETAVKNSKQGRELLEGIYNDGFHICNTFYGQRRENDEECAFCIEL
FT                   LYRD"
FT   regulatory      complement(62403..62408)
FT                   /gene="gbs1624"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(62425..63288)
FT                   /transl_table=11
FT                   /gene="gbs1625"
FT                   /product="Unknown"
FT                   /note="similar to DNA polymerase III (delta' subunit) "
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X9"
FT                   /protein_id="CAD47284.1"
FT                   /translation="MDLKRTQPKLLEKFNTILQSDRMSHAYLFSGNFASLDMALYLAQS
FT                   QFCEKRQSGLPCQKCRACRLIANGEFSDVKIIEPQGQLIKTETIKELTKDFSRSGFEGK
FT                   SQVFIIKDCEKMHVNAANSLLKFIEEPQSSSYVILLTNDENNVLPTIKSRTQIFRFPKQ
FT                   LDMLVHQAEQAGLLKSQASLLAQVADDPKHLEILLANKKLLDYLNLSQQFVTTLAKDRQ
FT                   TAYLEVSRLTSQVVDKNDQAFVFQWLTIMLAKEGQLYDLENTYRAQQMWKSNVSFQNSL
FT                   EYMVLS"
FT   regulatory      complement(63299..63304)
FT                   /gene="gbs1625"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(63308..63943)
FT                   /transl_table=11
FT                   /gene="gbs1626"
FT                   /product="unknown"
FT                   /note="similar to thymidylate kinase "
FT                   /db_xref="GOA:Q8E3X8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3X8"
FT                   /protein_id="CAD47285.1"
FT                   /translation="MKKGLMISFEGPDGAGKTTVLEAVLPLLREKLSQDILTTREPGGV
FT                   TISEEIRHIILDVKHTQMDKKTELLLYMAARRQHLVEKVLPALEEGKIVLMDRFIDSSV
FT                   AYQGSGRGLDKSHIKWLNDYATDSHKPDLTLYFDVPSEVGLERIQKSVQREVNRLDLEQ
FT                   LDMHQRVRQGYLELADSEPNRIVTIDASQQLDEVIAETFSIILDRINQ"
FT   regulatory      complement(63997..64023)
FT                   /gene="gbs1627"
FT                   /regulatory_class="terminator"
FT   CDS             complement(64032..64691)
FT                   /transl_table=11
FT                   /gene="gbs1627"
FT                   /product="Unknown"
FT                   /note="Similar to acetoin dehydrogenase"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X7"
FT                   /protein_id="CAD47286.1"
FT                   /translation="MPVKDFMTKKLVYVSPDTTVAEAADLLREHHLRRLPVVENDQLLG
FT                   LVTEGTMAEAQPSKATSLSIYEMNYLLNKTKIRDIMIKDIVTVSQYASLEDAIYLMMSR
FT                   KIGVLPVVDNGQLYGIITDRDVFKAFLEIAGYGQEGYRLVILADEGIGVLSKVLNRLSS
FT                   ANLSVKRLVIIERKAGKKAVEIQLEGYADKDVLKQELVFDDVIVETLEKTVKKPLS"
FT   regulatory      complement(64700..64705)
FT                   /gene="gbs1627"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(64710..65420)
FT                   /transl_table=11
FT                   /gene="gbs1628"
FT                   /product="Unknown"
FT                   /note="similar to amino acid ABC transporter (ATP-binding
FT                   protein)"
FT                   /db_xref="GOA:Q8E3X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X6"
FT                   /protein_id="CAD47287.1"
FT                   /translation="MTMLKVENLSIHYGVIQAVNDVSFEVNQGEVVTLIGANGTGKTSI
FT                   LRTISGLVRPSQGSISFMGKPIHKLAARKIVGNGLAQVPEGRHVFSSLSVMENLEMGAF
FT                   LQKDREQNQKMLKKVFDRFPRLEERKNQDAATLSGGEQQMLAMGRALMSRPKLLLLDEP
FT                   SMGLAPIFIQEIFNIIEDIKKQGTTVLLVEQNANKALTIADKAYVLETGKVVLSGTGKE
FT                   LLVSDQVRKAYLGG"
FT   CDS             complement(65420..66184)
FT                   /transl_table=11
FT                   /gene="gbs1629"
FT                   /product="unknown"
FT                   /note="similar to amino acid ABC transporter (ATP-binding
FT                   protein) "
FT                   /db_xref="GOA:Q8E3X5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X5"
FT                   /protein_id="CAD47288.1"
FT                   /translation="MALLEVKNLSKHFGGLTAVGDVSMKLHKGELIGLIGPNGAGKTTL
FT                   FNLLTGVYLPSKGTISLDGKILNGRKPAKIASLGLGRTFQNIRLFKNMTVLDNVLVGLS
FT                   NHHLSHPIASFLRLPKYYHSEKALRKKALELLEIFGLKAYQDALAKNLPYGKQRRLEIV
FT                   RALATEPKILFLDEPAAGMNPQETAELTQLISQIKSDFDITIMLIEHDMNLVMQVTERI
FT                   YVLEYGRLIAHGTPEEIKNNKRVIEAYLGGEL"
FT   regulatory      complement(65431..65435)
FT                   /gene="gbs1628"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(66185..67138)
FT                   /transl_table=11
FT                   /gene="gbs1630"
FT                   /product="Unknown"
FT                   /note="similar to ABC transporter (permease) "
FT                   /db_xref="GOA:Q8E3X4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X4"
FT                   /protein_id="CAD47289.1"
FT                   /translation="MKENMKSILSWLAIVVLGYLLISVLISMGIFNLYHIQIIETIGIN
FT                   VILAVGLNLIVGCSGQFSLGHAGFMAIGAYAVAIIGVKMPTYVGFLIAILVGTLVAGGI
FT                   ALGVGIPTLRLKGDYLAIATLGVAEIIRILLVNGGDITNGAAGIMGIPPFTTWSLVYGV
FT                   AVVSLILAMNFLRSPLGRNTIAIREDEIAAESMGVDTTKVKVIVFVFGAILASIAGSLQ
FT                   AGYVGTVMPKDFSFMMSVNVLIIVVLGGLGSMTGTVLAAILLGLLNMLLQDYASVRMII
FT                   YALALILIMIFRPSGLLGTKELTLSHLFRKTSKGGN"
FT   regulatory      complement(66192..66197)
FT                   /gene="gbs1629"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(67141..68010)
FT                   /transl_table=11
FT                   /gene="gbs1631"
FT                   /product="unknown"
FT                   /note="similar to amino acid ABC transporter (permease) "
FT                   /db_xref="GOA:Q8E3X3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X3"
FT                   /protein_id="CAD47290.1"
FT                   /translation="MLQQLINGLILGSIYALLALGYTMVYGIIKLINFAHGDIYMMGAF
FT                   MGYYLINHLHLNFFLALLIAMLGSAFLGAVIEYLAYRPLRKSTRIAALITAIGVSFLLE
FT                   YGMVYLVGADTRAFPQAIHTVKYNLGPITITNVQLIILGIALLLMLTLQFIVQKTKMGK
FT                   AMRALSVDSDAAQLMGINVNRTISFTFALGSALAGAGGVLIGLYYNSVQPLMGVTPGLK
FT                   AFVAAVLGGIGIIPGAAIGGFVIGILETLATALGVSDFRDGIVYAILILIFLIRPAGIL
FT                   GKNIKEKV"
FT   regulatory      complement(67149..67154)
FT                   /gene="gbs1630"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(68116..69282)
FT                   /transl_table=11
FT                   /gene="gbs1632"
FT                   /product="unknown"
FT                   /note="similar to branched-chain amino acid ABC
FT                   transporter, amino acid-binding protein "
FT                   /db_xref="GOA:Q8E3X2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3X2"
FT                   /protein_id="CAD47291.1"
FT                   /translation="MEKRLSLGALVLASTVLLAACGNVGGGASSTGTKIGKDIKVGYNW
FT                   ELSGNVSSYGNSMKNGADLAVKEINAAGGVGGKKLKVLSQDNKSENAEAATVATNLVTK
FT                   GANVIIGPATSGAAASSTPKVNAAAVPMIAPAATQDNLVYGSDGKTLNQYFFRATFVDN
FT                   YQGKLLSQYATDNLKAKKVVLFYDNSSDYSKGVAKSFKESYSGKIVDSMTFSAGDTDFQ
FT                   ASLTKLKGKEYDAIVMPGYYTETGLIVKQARDLGISKPVLGPDGFDSPKFVQSATPVGA
FT                   SNVYYLTGFTTQGSTKAKAFHDHYVKAYGEEPSMFSALSYDAVYMAAKSAKGAKTSIDL
FT                   KKALAKLKDFKGVTGKMSIDKNHNVVKSAYVVKLDDGKTSSVNIISAK"
FT   regulatory      complement(69288..69293)
FT                   /gene="gbs1632"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(69391..69411)
FT                   /gene="gbs1633"
FT                   /regulatory_class="terminator"
FT   CDS             complement(69436..69681)
FT                   /transl_table=11
FT                   /gene="gbs1633"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3X1"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3X1"
FT                   /protein_id="CAD47292.1"
FT                   /translation="MNKQERLGMSVYLYYNRDARKLYKYGDVHYHSRRLRYLVIYVNKE
FT                   DIVSVSKEIKHLKFVKDVRLSAIDDIDQDFVGNLYR"
FT   regulatory      complement(69691..69697)
FT                   /gene="gbs1633"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(69751..69769)
FT                   /gene="clpP"
FT                   /regulatory_class="terminator"
FT   CDS             complement(69781..70371)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /product="ATP-dependent CLP protease proteolytic subunit"
FT                   /db_xref="GOA:Q8E3X0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3X0"
FT                   /protein_id="CAD47293.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGQVEDNMANSIIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKSDVQTIVMGMAASMGTIIASS
FT                   GAKGKRFMLPNAEYMIHQPMGGTGGGTQQSDMAIAAEHLLKTRHTLEKILADNSGQSIE
FT                   KVHDDAERDRWMSAQETLDYGFIDAIMENNNLQ"
FT   regulatory      complement(70377..70382)
FT                   /gene="clpP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(70496..71125)
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="GOA:P67398"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67398"
FT                   /protein_id="CAD47294.1"
FT                   /translation="MGKFQVISHPLIQHKLSILRRTTTSTKDFRELVDEIAMLMGYEVS
FT                   RDLPLEDVEIQTPVATTVQKQLAGKKLAIVPILRAGIGMVDGFLSLVPAAKVGHIGMYR
FT                   DEETFQPVEYLVKLPEDIDQRQIFVVDPMLATGGSAILAVDSLKKRGAASIKFVCLVAA
FT                   PEGVAALQEAHPDVDIYTAALDEKLNEHGYIVPGLGDAGDRLFGTK"
FT   regulatory      complement(71137..71142)
FT                   /gene="upp"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(71235..72404)
FT                   /transl_table=11
FT                   /gene="gbs1636"
FT                   /product="unknown"
FT                   /note="similar to aminotransferase "
FT                   /db_xref="GOA:Q8E3W8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W8"
FT                   /protein_id="CAD47295.1"
FT                   /translation="MITYDFTSLPERFSSNAIKWKAVQKDQEILPLWIADMDFPIFPEM
FT                   SEAIEDFSHQMVFGYDSPKDSLYQAISNWEVQEHGYQFDKKSLLLIDGVIPAISVAIQA
FT                   FTKEGDAVLINTPVYPPFARTIKYNNRHLVSNSLLNNNQYFEIDFKQLEKDIIENNVKL
FT                   YIFCSPHNPGGRVWTKGEIQKIGDICKRYNVILVSDEIHQDLVLFDNVHHSFNTVDSSF
FT                   KEFSVILSSATKTFNIAGTKNSFAIIENEKLRSDFKKRQIANNQQEISSLGLLATEVAF
FT                   TKGKKWLKALKMELEGSIEYLYEQLTQKTHIKVMKPEGTYLVWLDFSAYNLTHLEIQEK
FT                   LRYDAKLILNDGLTFGKEGKKHARINVAAPRSVIEEAVLRLVTNFRKND"
FT   CDS             complement(72540..73088)
FT                   /transl_table=11
FT                   /gene="gbs1637"
FT                   /product="Unknown"
FT                   /note="Similar to rRNA methylase"
FT                   /db_xref="GOA:Q8E3W7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W7"
FT                   /protein_id="CAD47296.1"
FT                   /translation="MNIETLTQKNHRSDSGRNHIVLFEPQIPANTGNIARTCAATNAPL
FT                   HIIRPMGFPIDDKKMKRAGLDYWDKLDVSFYDSLEEFMLSCRGKVHLISKFADKVYSDE
FT                   NYNDDQDHYFMFGREDKGLPETFMREHAEKALRIPMNDEHVRSLNVSNTVCMIVYEALR
FT                   QQSFPNLELSHTYENDKLK"
FT   regulatory      complement(73231..73267)
FT                   /gene="gbs1638"
FT                   /regulatory_class="terminator"
FT   CDS             complement(73261..74613)
FT                   /transl_table=11
FT                   /gene="gbs1638"
FT                   /product="Unknown"
FT                   /note="similar to amino acid permease "
FT                   /db_xref="GOA:Q8E3W6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W6"
FT                   /protein_id="CAD47297.1"
FT                   /translation="MENHNSIKQTYGLMTTIAMIVGVVIGSGIYFKVDDILKFTGGDVF
FT                   LGMVILVLGSFSIVFGSLSISELAIRTSESGGIFSYYEKYVSPALAATLGLFASFLYLP
FT                   TLTAIVSWVAAFYTLGESSSLESQIILAAVYILALSLMNIFAKRIAGGFQSLTTFVKMI
FT                   PLVLIALIGAFWSDKAPQLPQHLTAIQPSNVGWSWVSGLVPLYFAYDGWTIFVSIAPEV
FT                   KNPKKNLPLAFVIGPALILLSYLAFFYGLTQILGASFIMTTGNDAINYAANIIFGPSVG
FT                   RLLSFIVILSVLGVANGLLLGTMRLPQAFAERGWIKSERMANINLKYQMSLPASLTVTA
FT                   VAIFWLFVHFMVTKFNLLPGSDISEIAVVFNNTSLIILYVLVLSLYLKKDIKNKFTGLV
FT                   SPILAILGGLILFIGSLLSNFFTVLIFQCFCLLFCLICHYIYQKNNPKTHE"
FT   regulatory      complement(74618..74623)
FT                   /gene="gbs1638"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      74808..74813
FT                   /gene="gbs1639"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             74819..76168
FT                   /transl_table=11
FT                   /gene="gbs1639"
FT                   /product="Unknown"
FT                   /note="Similar to TRK potassium uptake system protein TrkA
FT                   "
FT                   /db_xref="GOA:Q8E3W5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W5"
FT                   /protein_id="CAD47298.1"
FT                   /translation="MRIIVVGGGKVGTALCRSLVAEKHDVVLIEKKENVLKRVTKQHDI
FT                   MGIVGNGANYKILEQAEVKNCDIFIAITDRDEVNMISAVLAKKMGAKETVVRMRNPEYS
FT                   NPYFKDKNFLGFSSVVNPELLAAQYIANTIEFPNATSVEHFANGRVMLMEFKILEGNKL
FT                   CHTSMSQIRKKFGNIVICAIERDGKLIIPDGDATIQVKDKIFVTGNRIEMILFHNYVKN
FT                   KVVKNLMVIGAGRIAYYLLNILKNTNTHVKLVELNQEQAEYFSQEFPNVPVVHGDGTAK
FT                   NILLEESVTSFDAVATLTGVDEENIITSMFLESIGIPKNITKVNRTSLLEIIDDKQLSS
FT                   IITPKRIAVDHVMHFVRGRVNAQDSNLEAMHHIANDRIETLQFEIKETSKLANRSLASL
FT                   KLKQNILIAAIIRNNKTIFPTGEDVLTVGDRIVVITLLKNITRTSDMLAR"
FT   regulatory      76160..76165
FT                   /gene="gbs1640"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             76173..77612
FT                   /transl_table=11
FT                   /gene="gbs1640"
FT                   /product="Unknown"
FT                   /note="Similar to TRK potassium uptake system protein TrkH"
FT                   /db_xref="GOA:Q8E3W4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W4"
FT                   /protein_id="CAD47299.1"
FT                   /translation="MNKSMIRFLLSKLLLIEAALLAIPLTVGLIYREPQSVMMSIVITM
FT                   IILIILGLLGSLFKPKNYHIYTKEGMLIVALCWILWSFFGALPFVISGQIPNIIDAFFE
FT                   VSSGFTTTGATILDDVSVLSPALLFWRSFTHLIGGMGVLVFALAIMENSKNSHLEVMRA
FT                   EVPGPVFGKVVSKLKKTAQILYLLYLLMFAVFAVILYFAGMPFFDSIIIAMGTAGTGGF
FT                   AVYNDSIAHYNSPLITNLVSIGMLIFGVNFNLYYLLLLRKIKAFFGDEELKNYLRIVAI
FT                   ATFMIALNVIGMYDNFRQGLEHIFFEVSAIITTTGFGVTDITRWPLFSQVILLFLMFIG
FT                   GSAGSTAGGFKVMRSLSLAKIARNQVLSTLYPNRVMSLHINKSVLDKNTQHGVLKYLTI
FT                   YLAIFMALVLVLTLDTNDFLVVVSAAASCFNNIGPLLGSNETFSFFSPFSKLLLSFAMI
FT                   AGRLEIYPVLLMFIPKTWSKL"
FT   CDS             complement(77636..77887)
FT                   /transl_table=11
FT                   /gene="gbs1641"
FT                   /product="Unknown"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="GOA:Q8E3W3"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3W3"
FT                   /protein_id="CAD47300.1"
FT                   /translation="MLKSFLIFLVRFYQKNISPAFPASCRYCPTCSTYMIEAIQKHGLK
FT                   GVLMGIARILRCHPLAHGGNDPVPDHFSLRRNKTDISD"
FT   CDS             complement(77887..78609)
FT                   /transl_table=11
FT                   /gene="gbs1642"
FT                   /product="Unknown"
FT                   /note="Similar to ribosomal large subunit pseudouridine
FT                   synthase B (hypothetical)"
FT                   /db_xref="GOA:Q8E3W2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W2"
FT                   /protein_id="CAD47301.1"
FT                   /translation="MRINKYIAHAGIASRRKAEELIKQGMVTINGQVVNELATKVKAGD
FT                   LVEIEGSPIYNEEKVYYLLNKPRGVISSVSDDKGRKTVIDLLPQVKERIYPVGRLDWDT
FT                   TGLLILTNDGDFTDKMIHPRNEIDKVYLARIKGIATKENLRPLTRGVVIDGKKTKPARY
FT                   NIIKVDHEKNRSVVELTIHEGRNHQVKKMFEQVGLLVDKLSRTQFGTLDLTGLRPGEAR
FT                   RLNKKEISQLHNAAINKS"
FT   CDS             complement(78599..79183)
FT                   /transl_table=11
FT                   /gene="gbs1643"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q7ZAL6"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7ZAL6"
FT                   /protein_id="CAD47302.1"
FT                   /translation="MTYLGSIEALLFVAGEDGLSLRQMAELLSLTPSALIQQLEKLAKR
FT                   YEEDDDSSLLLLETAQTYKLVTKDSYMTLLRDYAKAPINQSLSRASLEVLSIIAYKQPI
FT                   TRIEIDDIRGVNSSGAITRLIAFGLIKEAGKKEVLGRPNLYETTNYFLDYMGINQLDDL
FT                   IDASSIELVDEEVSLFSMDSINTEDKENNEN"
FT   regulatory      complement(78616..78621)
FT                   /gene="gbs1642"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(79180..79887)
FT                   /transl_table=11
FT                   /gene="gbs1644"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q7ZAL5"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7ZAL5"
FT                   /protein_id="CAD47303.1"
FT                   /translation="MDIKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATL
FT                   QAMRLEVAGEYMLMASQLMLIKSRNLLPKVVESTPIEDDPEMELLSQLEEYRRFKVLSE
FT                   ELANQHQERAKYFSKPKQEVIFEDAILLHDKSVMDLFLTFSQMMSQKQKELSNSQTVIE
FT                   KEDYRIEDMMIVIERHFNLKKKTTLQEVFADCQTKSEMITLFLAMLELIKLHQITVEQD
FT                   SNFSQVILRKEEK"
FT   regulatory      complement(79191..79198)
FT                   /gene="gbs1643"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(79887..80627)
FT                   /transl_table=11
FT                   /gene="gbs1645"
FT                   /product="Unknown"
FT                   /note="Similar to integrase"
FT                   /db_xref="GOA:Q8E3W1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3W1"
FT                   /protein_id="CAD47304.1"
FT                   /translation="MINDINNFIESKKLSLNSRKSYHYDLKQFYKIIGGHVNSEKLALY
FT                   QQSLSEFKLTARKRKLSAVNQFLFFLYNRGTLKEFYRLQETEKITLTQTKSQIMDLSNF
FT                   YQDTDYPSGRLIALLILSLGLTPAEIANLKKADFDTTFNILSIEKSQMKRILKLPENLL
FT                   PFLLESLEEDGDLVFEHNGKPYSRQWFFNQLTDFLNEKNEQQLTAQLLREQFILKQKEN
FT                   GKTMTELSRLLGLKTPITLERYYR"
FT   regulatory      complement(79900..79905)
FT                   /gene="gbs1644"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(80617..81090)
FT                   /transl_table=11
FT                   /gene="gbs1646"
FT                   /product="Unknown"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3W0"
FT                   /protein_id="CAD47305.1"
FT                   /translation="MIAKEFESFLLSHLDHYLIPAEDVAIFVDTHNADHVMLLLASNGF
FT                   SRVPVITKEKKYVGTISISDIMAYQSKGQLTDWEMAQTDIVEMVNTKIEPINEAATLTA
FT                   IMHKIVDYPFLPVISDQNDFRGIITRKSILKAINSLLHDFTDEYTITPKNNDK"
FT   CDS             complement(81087..81608)
FT                   /transl_table=11
FT                   /gene="gbs1647"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3V9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V9"
FT                   /protein_id="CAD47306.1"
FT                   /translation="MAIRKLVVMSDSHGDRDIVKDIKNHYLGKVDAIFHNGDSELPSSD
FT                   PIWEGIHVVTGNCDYDSGYPEVLVTKIDNTVIVQTHGHLHQINFTWDKLDLLAQQEDAD
FT                   ICLYGHLHRADAWKNGKTIFINPGSVLQPRGPINEKLYAVVTITDSKVLVEYYTRQHQP
FT                   YPNLTKEFSR"
FT   regulatory      complement(81098..81103)
FT                   /gene="gbs1646"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(81590..82564)
FT                   /transl_table=11
FT                   /gene="gbs1648"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3V8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3V8"
FT                   /protein_id="CAD47307.1"
FT                   /translation="MTKTIFESKTEGNWFLGSFQAFNYFTCFGNDESYEAIQDVFHRLL
FT                   STLKVEGLQLHVVQMTSDFQLLAFLVDMINQEYSRHIKVTQHKGAILVSEDDQLFLVHL
FT                   PKEGTSLEKFFDLKNDNNFGDTILIATHNEGKTKEFRELFGKLGLKVENLNDYPDLPEV
FT                   EETGMTFEENARLKAETISKLTGKMVISDDSGLKVDALGGLPGVWSARFSGPDATDARN
FT                   NAKLLHELAMVFDKERRSAQFHTTLVVSAPNKESLVVEAEWPGYIGTEPKGENGFGYDP
FT                   LFIVGEGSRTAAELSAQEKNNLSHRGQAVRKLMEVFPKWQLEN"
FT   regulatory      complement(81619..81624)
FT                   /gene="gbs1647"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(82561..83355)
FT                   /transl_table=11
FT                   /gene="gbs1649"
FT                   /product="Unknown"
FT                   /note="Similar to glutamate racemase "
FT                   /db_xref="GOA:Q8E3V7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3V7"
FT                   /protein_id="CAD47308.1"
FT                   /translation="MDSRPIGFLDSGVGGLTVVKEMFRQLPEEEVIFIGDQARAPYGPR
FT                   PAQQIREFTWQMVNFLLTKNVKMIVIACNTATAVAWQEIKEKLDIPVLGVILPGASAAI
FT                   KSTNSGKVGIIGTPMTVKSDAYRQKIQALSPNTAVVSLACPKFVPIVESNQMSSSLAKK
FT                   VVYETLSPLVGKLDTLILGCTHYPLLRPIIQNVMGAEVKLIDSGAETVRDISVLLNYFE
FT                   INHNWQNKHGGHHFYTTASPKGFKEIAEQWLSQEINVERIVL"
FT   regulatory      complement(82575..82580)
FT                   /gene="gbs1648"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(83363..83368)
FT                   /gene="gbs1649"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(83530..83769)
FT                   /transl_table=11
FT                   /gene="gbs1650"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3V6"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3V6"
FT                   /protein_id="CAD47309.1"
FT                   /translation="MSTTIWILLIIVALFGGLVGGIFIARKQIEKEIGEHPRLTPDAIR
FT                   EMMSQMGQKPSEAKVQQTYRNIVKHAKTAIKTKK"
FT   regulatory      complement(83778..83783)
FT                   /gene="gbs1650"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(83927..84469)
FT                   /transl_table=11
FT                   /gene="gbs1651"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V5"
FT                   /protein_id="CAD47310.1"
FT                   /translation="MSKKTTQMVSYTSILVAFAIMIPIIMPAKIIIGPASFTLASHVPL
FT                   FLSIFISVPVAILVALGTGLGFLLAGFPIVIVLRALSHIGFALIAAFLIKSKPSLLMSK
FT                   WQTLLFAVAINIIHGLLEFITVYIITMTSNSSSTYLWSLFSLIGLGSLLHGLVDFYIAL
FT                   FIWKWMTQKLGKTLRIR"
FT   regulatory      complement(84475..84480)
FT                   /gene="gbs1651"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(84503..84530)
FT                   /gene="gbs1652"
FT                   /regulatory_class="terminator"
FT   CDS             complement(84531..85052)
FT                   /transl_table=11
FT                   /gene="gbs1652"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3V4"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V4"
FT                   /protein_id="CAD47311.1"
FT                   /translation="MKAQERRENILTTLKGTKEAISASTLAKIFSVSRQVIVGDIALLR
FT                   AQQCDIISTPKGYLMSSALSTHQFTARLVCQHGIEQTEEELKIILRYQGIIMNVEVEHP
FT                   IYGMLTAPLNIQSQKDIDNFTAKLKVSNAELLSSLTDGLHTHMISCQDQSVFDQICEAL
FT                   KKAGILYIDK"
FT   regulatory      complement(85063..85068)
FT                   /gene="gbs1652"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(85120..85809)
FT                   /transl_table=11
FT                   /gene="gbs1653"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3V3"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V3"
FT                   /protein_id="CAD47312.1"
FT                   /translation="MNDNVIYTQSDSGLNQFFAKIYGLVGIGVGLSAAVSAIMLYMFPQ
FT                   NMIAIMQKMPGLYFGAIILELVLVFVASGAARRNTPAALPLFLIYSALNGFTLSFIIAR
FT                   YTQTTVLQAFITSAAVFFAMALIGAKTKKDLSGMRKALMAALIGILIASLVNLFIGSGG
FT                   MSYIISIVCVIIFSGLIAYDNQMIKYVYNSQGGQVADGWAVSMALSLYLDFINLFLNIL
FT                   RLFARND"
FT   regulatory      complement(85816..85821)
FT                   /gene="gbs1653"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(85832..86335)
FT                   /transl_table=11
FT                   /gene="gbs1654"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V2"
FT                   /protein_id="CAD47313.1"
FT                   /translation="MKKYQDDKDFMDLVGHLIDHPRFQKLEAIVQHHHSTRLEHSINVS
FT                   YTSYKIAKKFGWDASSTARGGLLHDFFYYDWRVTKFNKSHAWVHPRIAVRNARKLTDLN
FT                   AREEDIILKHMWGATIAPPRYKESYIVTMVDKYWAVREASRPLKRIFKKPIRFSRKFLG
FT                   SHNH"
FT   regulatory      complement(86345..86350)
FT                   /gene="gbs1654"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(86373..87116)
FT                   /transl_table=11
FT                   /gene="gbs1655"
FT                   /product="Unknown"
FT                   /note="Similar to hypothetical rRNA methylase"
FT                   /db_xref="GOA:Q8E3V1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V1"
FT                   /protein_id="CAD47314.1"
FT                   /translation="MTTIITSKSNNLIKKTKKLLQKKYRKSSYLIEGWHLFEEAEKYGA
FT                   QFLNIFVTETAIDRLRKPEEAIVVTDDVLKELTDSQTPQGIVAEIAFQETRWTDIKKGR
FT                   FLVLEDVQDPGNLGTMVRTADAANFDAVFLSQKSADLYNQKTLRSMQGSHFHLPVFRVE
FT                   IEQFVNFCKAEGITMIATTLSEQSVNYKNLPKYDHFALIMGNEGQGISKTMTEEADVLA
FT                   HIEMPGQAESLNVAVAAGVVIFSLI"
FT   regulatory      87135..87140
FT                   /gene="gbs1656"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             87148..87426
FT                   /transl_table=11
FT                   /gene="gbs1656"
FT                   /product="Unknown"
FT                   /note="similar to acylphosphatase"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3V0"
FT                   /protein_id="CAD47315.1"
FT                   /translation="MKKVHLIVSGRVQGVGFRYATYSLALEIGDIYGRVWNNDDGTVEI
FT                   LAQSTDSNKMTQFIQKIRKGPSKWSKVTYVDIKLDNFDDFNDFKMRN"
FT   regulatory      87494..87499
FT                   /gene="gbs1657"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             87511..88443
FT                   /transl_table=11
FT                   /gene="gbs1657"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3U9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3U9"
FT                   /protein_id="CAD47316.1"
FT                   /translation="MKKTLKRILFSSLSLSILLLLTGCVSVDKAGKPYGVIWNTLGVPM
FT                   ANLITYFAQHQGLGFGVAIIIVTIIVRVIILPLGLYQSWKASYQAEKMAYFKPLFEPIN
FT                   ERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPLLIQMPFFSAIFFAARYTPGV
FT                   SSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQRQQMKTMMYVMPIAMVFMS
FT                   ISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEYTKNPPKAYKSNNARKDVT
FT                   SSTKTTESNQAIITSKKTNRNAGKQKRRG"
FT   CDS             complement(88642..89307)
FT                   /transl_table=11
FT                   /gene="gbs1658"
FT                   /product="Unknown"
FT                   /note="similar to amino acid ABC transporter (permease)"
FT                   /db_xref="GOA:Q8E3U8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U8"
FT                   /protein_id="CAD47317.1"
FT                   /translation="MINWDAIFNLELAVKAFPSVIQGLPYTIGLSLVGFILGAIVGFFV
FT                   ALMKMSHLRLLRYLANIHISLMRGIPLMVLLFLIYFGLPFIGIQLDAVTASIVGFTMMS
FT                   SAYISEIIRAALLAVDHGQWEAARALGLKTPTIYRGIIIPQATRIALPSLSNVLLDMVK
FT                   GSSLTAMITVPDIFNNAKIVGGTYSDYMTAYILVALIYWVICTLYAIIQDWWEKRLLY"
FT   regulatory      complement(89317..89322)
FT                   /gene="gbs1658"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(89331..90188)
FT                   /transl_table=11
FT                   /gene="gbs1659"
FT                   /product="Unknown"
FT                   /note="Unknown"
FT                   /note="similar to amino acid ABC transporter (binding
FT                   protein)"
FT                   /db_xref="GOA:Q8E3U7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U7"
FT                   /protein_id="CAD47318.1"
FT                   /translation="MKKTILLGLVGLSAMTLAACSNGQSSKETTWDNIKKDGVLKVATP
FT                   ATLYPTSYYDDHKKLTGYEIDMMKAIAKKLKIKVKFVEVGVAESFTSVDSGKVDVAVNN
FT                   FDTTPERLKKYNFSQPYKYSVGGMIVRADGSSKITAKDLSDWKGKKAGGGAGTQYMKIA
FT                   KQQGAEPVIYDNVTNDVYLRDVSTGRTDFIPNDYYTQVIAVKYVTKQYPDIKVKMGDVK
FT                   YNPTEQGIVMSKKDKSLKTKIDAAIKDMKKDGSLKKISEKYYAGQDLTKEPAGTDKIPV
FT                   IKVK"
FT   regulatory      complement(90193..90198)
FT                   /gene="gbs1659"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(90349..91809)
FT                   /transl_table=11
FT                   /gene="gbs1660"
FT                   /product="Unknown"
FT                   /note="Similar to putative amidase"
FT                   /db_xref="GOA:Q8E3U6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U6"
FT                   /protein_id="CAD47319.1"
FT                   /translation="MVFKDATAMAQAIKQHKVSSQELVEQAIYKIEEQNVSVNAVVSKQ
FT                   YNEARQAAKYANASNAPFAGVPILLKDLGQNQKGQLSTSGSQLFKHYYAKQTDYLVQSF
FT                   EKLGFIILGRTNTPEFGFKNISDSQLHGNVNLPFDHSRNAGGSSGGAAAAVSSGMVPIA
FT                   GASDGGGSIRIPASFNGLIGLKPSRGRIPVGPSSYRGWQGASSHFALTKSVRDTKRLLY
FT                   YLQSYQVESPFPLKKLSKESLFEFSVSKPLKIAVLMDSPLKTKVSSEAKAAIKEAADFL
FT                   SQKGNHLELVEQPLDGIHSMKTYCMMNSVETAAMFDGIEKSLGRSMEFSDMELMTWAMY
FT                   QSGQRVLAKDYSKLLDSWDQFAATMARFHENYDLILTAATNQPAPFHGQFDLDETLQKQ
FT                   LRHMREFSVSEQQDLIWKMFEDSMAWTPFTHQPNLTGQPSLAIPTHLTKEGLPLGVQLT
FT                   AAKGREDLLLAVAELFEKEKQFKGPVCH"
FT   regulatory      complement(91817..91822)
FT                   /gene="gbs1660"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(91868..91900)
FT                   /gene="gbs1661"
FT                   /regulatory_class="terminator"
FT   CDS             complement(91913..92395)
FT                   /transl_table=11
FT                   /gene="gbs1661"
FT                   /product="Unknown"
FT                   /note="Similar to transcription elongation factor GreA"
FT                   /db_xref="GOA:Q8E3U5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3U5"
FT                   /protein_id="CAD47320.1"
FT                   /translation="MAEKTYPMTQVEKDQLEKELEELKLVRRPEVVERIKIARSYGDLS
FT                   ENSEYDAAKDEQAFVEGQIQILETKIRYAEIIDSDAVAKDEVAIGKTVLVQEVGTNDKD
FT                   TYHIVGAAGADIFSGKISNESPIAHALIGKKTGDLATIESPAGSYQVEIISVEKTN"
FT   regulatory      complement(92405..92411)
FT                   /gene="gbs1661"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(92468..94270)
FT                   /transl_table=11
FT                   /gene="gbs1662"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="GOA:Q8E3U4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U4"
FT                   /protein_id="CAD47321.1"
FT                   /translation="MTEFNDDQHSNHDQKSFKEQILAELEEANRLRKLREEELYQKEQE
FT                   AKEAARRTAQLMADYEAQRLKDEQEARAKALETKQRLEEQEKARIEAKLLAEAAREEER
FT                   RQAEQALASQEEQVINQGMEPSRELDSGSKSSEFRTTENVPDIDLKADKTDVATAVPNQ
FT                   ETEEIFLVRATDIPTEGENVKLGETSELEPVAKEPIRVEDLSKEEEDIALSAKNKHNKR
FT                   ERRQKADNVAKRIARILISIIILVLLLTAFVGYRFVDSAIKPVDSNSNKFVQVEIPIGS
FT                   GNKLIGQILEKAGVIKSATVFNYYSKFKNYSNFQSGYYNLKKSMTLDQIAAELEKGGTA
FT                   EPTKPALGKILITEGYTIKQIAKAIESNKIDTKTTSTPYKADDFLKLVQDETFIKKMVA
FT                   KYPNLLGSLPDKSKAIYQLEGYLFPATYNYYKDTTLEGLVEDMISTMNTKMAPYYNTIK
FT                   AKNMSVNDVLTLSSLVEKEGSTDEDRRKIASVFYNRLSAGQALQSNIAILYAMGKLGDK
FT                   TSLAEDAQINTSIKSPYNIYTNTGLMPGPVDSPSISAIEATIKPASTDYLYFVADVKTG
FT                   NVYYAKDFETHKANVEKYINSQIN"
FT   regulatory      complement(94279..94284)
FT                   /gene="gbs1662"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(94357..94860)
FT                   /transl_table=11
FT                   /gene="gbs1663"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3U3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U3"
FT                   /protein_id="CAD47322.1"
FT                   /translation="MIIRNGCLEDLQQVISIERINFSEAEAASKKAMQERLMIMTDTFL
FT                   VAEINGRLAGYIEGPVIKGRYLTDDLFHKVSEIPVREGGFIGITSLSIHPDFKGQGIGT
FT                   ALLAAMKDLVVSQERDGISLTCHDDLISFYEMNGFKDEGESDSQHGGSLWYNMIWNNPT
FT                   RSIC"
FT   regulatory      complement(94866..94871)
FT                   /gene="gbs1663"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(94946..96277)
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /product="Unknown"
FT                   /note="Similar to UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="GOA:Q8E3U2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3U2"
FT                   /protein_id="CAD47323.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHNVQGSDVDKYYFTQRGLE
FT                   QAGVTILPFSPNNISEDLEIIAGNAFRPDNNEELAYVIEKGYHFKRYHEFLGDFMRQFT
FT                   SLGVAGAHGKTSTTGLLAHVLKNITDTSFLIGDGTGRGSANANYFVFEADEYERHFMPY
FT                   HPEYSIITNIDFDHPDYFTGLEDVFNAFNDYAKQVQKGLFIYGEDSKLHEITSKAPIYY
FT                   YGFEDSNDFIAKDITRTVNGSDFKVFYNQEEIGQFHVPAYGKHNILNATAVIANLYIMG
FT                   IDMALVAEHLKTFSGVKRRFTEKIIDDTVIIDDFAHHPTEIIATLDAARQKYPSKEIVA
FT                   IFQPHTFTRTIALLDDFAHALSQADSVYLAQIYGSAREVDNGEVKVEDLAAKIVKHSDL
FT                   VTVENVSPLLNHDNAVYVFMGAGDIQLYERSFEELLANLTKNTQ"
FT   regulatory      complement(96282..96287)
FT                   /gene="murC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(96287..96904)
FT                   /transl_table=11
FT                   /gene="gbs1665"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U1"
FT                   /protein_id="CAD47324.1"
FT                   /translation="MNRGSRRFPLIADDEPVMSPLVKMNLYDNEDLINNIRGFYQEKTY
FT                   QSMVKSNYEHEEISHPKVIENDPVPPQSFVKKATELSKSRQEAKRSVREKRQAYYAKQE
FT                   FKAPSKEAFQQQLKATVPKKQTQRKVTELSHLSDRLQQESYILAEIPIIFQEPDNTPNP
FT                   KTKKNNFDFLKRSQVYNKQDNQFHKERAKAQELNLTRFKDIN"
FT   regulatory      complement(96912..96917)
FT                   /gene="gbs1665"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(97020..97039)
FT                   /gene="gbs1666"
FT                   /regulatory_class="terminator"
FT   CDS             complement(97069..100167)
FT                   /transl_table=11
FT                   /gene="gbs1666"
FT                   /product="Unknown"
FT                   /note="Similar to SWI/SNF family helicase"
FT                   /db_xref="GOA:Q8E3U0"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3U0"
FT                   /protein_id="CAD47325.1"
FT                   /translation="MSRMIPGRIRNQGIELYEQGLVSLISQEGNLLKAKVGDCQIEYSL
FT                   VTEETKCSCDFFARKGYCQHLAALEHFLKNDPEGKAILSKVQVQQESQQETKKKTSFGS
FT                   VFLDSLIINEDDTIKYQLSAQGEQNPYANDIWWTLKIRRLPDDRSYVIRDIKAFLNTVR
FT                   KEAYYQIGKQYFETLSLIQFDETSQELIEFLWRLIPSHSSKIDLEFILPNQGRHLSLTR
FT                   GFFEEGVTLMNALENFSFESDFHQFNHLYFKELEGEDHLYQFKVIVHRQSIELEIKEKD
FT                   LKPLFANSYLFYRDTFYHLNLKQEKMVTAIRSLPIEGDLAKHIHFDLDDQDKLAAHLLD
FT                   FKEIGLVDAPRSFSIHDFKVNFEFDINSQNEILLQMVFDYGNDLTVHNRQELEQLTFAS
FT                   HFKHEEKIFKLLERYGFAPHFSTSHPAYSAQELYDFYTYMLPQFKKMGTVSLSAKLESY
FT                   RLIERPQIDIEAKGSLLDISFDFSDLLENDVDQALVALFDNNPYFVNKSGQLVIFDEET
FT                   KKVSATLQGLRARRAKNGHIELDNIAAFQLSELFANQDNVSFSQHFYQLIEDLRHPEKF
FT                   KIPGLSVSASLRDYQLTGVRWLSMLDHYGFAGILADDMGLGKTLQTISFLSTKLTRDSR
FT                   VLILSPSSLIYNWQDEFHKFAPDVDVAVAYGSKIRRDEIIAERHQVIITSYSSFRQDFE
FT                   TYSEGNYDYLILDEAQVMKNAQTKIAHSLRSFEVKNCFALSGTPIENKLLEIWSIFQII
FT                   LPGLLPGKKEFLKLNPKQVARYIKPFVMRRRKEEVLPELPDLIEMNYPNEMTDSQKVIY
FT                   LAQLRQIQESIQHSSDADLNRRKIEILSGITRLRQICDTPRLFMDYDGESGKLESLHQL
FT                   LTQIKENGHRALIFSQFRGMLDIAEREMVAMGLTTYKITGSTPANERHEMTRAFNAGSK
FT                   DAFLISLKAGGVGLNLTGADTVVLIDLWWNPAVEMQAISRAHRLGQKENVEVYRLITRG
FT                   TIEEKILEMQETKKHLVTTVLDGNETHASMSVDDIREILGVSK"
FT   regulatory      complement(100178..100183)
FT                   /gene="gbs1666"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(100274..100295)
FT                   /gene="gbs1667"
FT                   /regulatory_class="terminator"
FT   CDS             complement(100323..101633)
FT                   /transl_table=11
FT                   /gene="gbs1667"
FT                   /product="Unknown"
FT                   /note="Similar to GTP binding protein"
FT                   /db_xref="GOA:Q8E3T9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3T9"
FT                   /protein_id="CAD47326.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYTT
FT                   GEWLNRKFSLIDTGGIDDVDAPFMEQIKHQADIAMTEADVIVFVVSGKEGVTDADEYVS
FT                   LILYKTNKPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPLSSVHGIGTGDILDAIVENL
FT                   PVEEENENPDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTNFVDSQG
FT                   QEYTMIDTAGMRKSGKVYENTEKYSVMRSMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGIIIVVNKWDTIEKDSHTVSQWEADIRDNFQFLSYAPIIFVSAETKQRLHKLP
FT                   DMIKRISESQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVAVKPPTFVVFV
FT                   NEEELMHFSYLRFLENQIREAFVFEGTPINLIARKRK"
FT   regulatory      complement(101640..101645)
FT                   /gene="gbs1667"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(101681..102583)
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /product="Unknown"
FT                   /note="Similar to primosome component (helicase loader)
FT                   DnaI"
FT                   /db_xref="GOA:Q8E3T8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3T8"
FT                   /protein_id="CAD47327.1"
FT                   /translation="MKSVGQALENQGRVPRNTNDELIQMILSDAQVAEFIKTHQLSQRE
FT                   INISMSKFNQFLIERQKFKNKDSQYIAKGYEPILVMNEGYADVSYLETRELIEAQKKQA
FT                   ISDRINLVNLPKSYRNIRMTDFDINNESRMKAMSQLLDFVETYPSYNHKGLYLYGDMGV
FT                   GKSYLMAAMARELSERKGVSTTLLHFPSFAIDVKNAISSGTVKDEIDAVKSVPILILDD
FT                   IGAEQATSWVRDEILQVILQHRMLEELPTFFTSNYSFNDLERKWANIKGSDETWQAKRV
FT                   MERVRYLAIEFHLEGPNRR"
FT   CDS             complement(102580..103755)
FT                   /transl_table=11
FT                   /gene="gbs1669"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3T7"
FT                   /protein_id="CAD47328.1"
FT                   /translation="MSPIDEFTYIKQNKIVYDSNSLIQLYFPIMGSDAMALYDYFVHFF
FT                   DDGIRRHKFSEVLNHLQYGMPRFQDALVMLTALDLLTVYQATGTYLVKLNQAMSNELFL
FT                   SNPIYRRLLEKRIGEVAVAELDMKIPKNARDISKKFTDVFSDLGQPKQEVNRSKNVFDL
FT                   ESFKRLMMRDGLRFNNEKDDVLGIYSVSELYHLNWYDTYQLAKQTAINGMIAPQRMKVQ
FT                   QNEGQHIKDNQSFTNNEKVILRESKNDSALVFLEKIKRSRKAVTTSGEKTLLEDLAKMN
FT                   FLDEVINVMVLYTLNKTKSANLNKAYIMKVANDFAFQNVMTAEDAVLKIRDFSDQKVRT
FT                   KTETKKKQSNVPEWSNPDYKDEVSPEKEIELEQFKTDALKRLERLGKDGES"
FT   regulatory      complement(102591..102596)
FT                   /gene="dnaI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(103755..104234)
FT                   /transl_table=11
FT                   /gene="gbs1670"
FT                   /product="Unknown"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="GOA:Q8E3T6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3T6"
FT                   /protein_id="CAD47329.1"
FT                   /translation="MRCPKCGYNKSSVVDSRQAEEGTTIRRRRECEKCGNRFTTFERLE
FT                   ELPLLVIKKDGTREQFSRDKILNGIIQSAQKRPVSSEDIENCILRIERKIRSEYEDEVS
FT                   SITIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITKRVRSKKSGSV"
FT   regulatory      complement(103766..103772)
FT                   /gene="gbs1669"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(104241..104246)
FT                   /gene="gbs1670"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(104383..105888)
FT                   /transl_table=11
FT                   /gene="gbs1671"
FT                   /product="Unknown"
FT                   /note="Similar to two-component sensor histidine kinase"
FT                   /db_xref="GOA:Q8E3T5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3T5"
FT                   /protein_id="CAD47330.1"
FT                   /translation="MKNKKDQFIGVKQPLSKKLSQLVFILFFSLFTVFSVLVYTSATRY
FT                   VLHREKINVGRSLEKTRVRLSQANSSLTSDDILEILYNQVFADDIYPHKRQNGIVRTGE
FT                   SIDSILYANQEMTLYDVNRKPVFSTLRTGMPTIGKSMGKVIISKVADMEGFVGTKAIYS
FT                   QKTGQLLGYVQIFYNLGRYYSMRQNIIVFLIMMEVLGTVLALVVINSATKRIVRPVKNL
FT                   HDLMHQISENPSNLEIRSKVRSEDEIGELSRIFDGMLDQLEDYTRRQSQFISDVSHELR
FT                   TPVAVVKGHIGLLQRWGKDDPEILEESLAAAYHEADRMSLMINDMLNMIRVQGSLELHQ
FT                   DEVTDLSSSISVVIENFRILREDFQFIFENNISDIVWGKIYKIHFEQALMILIDNAIKY
FT                   SPSYKEVSVVLSVDNDFATVVVKDKGEGISDEDIEFIFDRFYRTDKSRNRESTQAGLGI
FT                   GLSVFKQIMDAYHLKVDIKSELNQGTEFIVRIPIKKFEETKEI"
FT   CDS             complement(105878..106567)
FT                   /transl_table=11
FT                   /gene="gbs1672"
FT                   /product="Unknown"
FT                   /note="Similar to two-component response regulator"
FT                   /db_xref="GOA:Q8E3T4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3T4"
FT                   /protein_id="CAD47331.1"
FT                   /translation="MGKKILIIEDEKNLARFVSLELLHEGYDVVVETNGREGLDTALEK
FT                   DFDLILLDLMLPEMDGFEITRRLQAEKTTYIMMMTARDSVMDIVAGLDRGADDYIVKPF
FT                   AIEELLARVRAIFRRQEIETKTKEKGDSGSFRDLSLNTHNRSAMRGDEEISLTKREFDL
FT                   LNVLMTNMNRVMTREELLEHVWKYDVAAETNVVDVYIRYLRGKIDIPGRESYIQTVRGM
FT                   GYVIREK"
FT   regulatory      complement(106577..106582)
FT                   /gene="gbs1672"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(106802..107335)
FT                   /transl_table=11
FT                   /gene="gbs1673"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3T3"
FT                   /protein_id="CAD47332.1"
FT                   /translation="MLLTEIKKSPEGLYFDKKIDIKESLMERHSEIMDISDIQVSGHVV
FT                   YEDGLYLLDYNMAYDITLPSSRSMKPVVLSEKQTINEVFIEAENVSTKKELVDQDLVLI
FT                   LEEDDINLEESVIDNILLNIPLRVLAADEVGVEADLSGKNWSLMTEKQYEEKQAKEKEK
FT                   SNPFAALEGMFDSD"
FT   regulatory      complement(107343..107348)
FT                   /gene="gbs1673"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(107406..107427)
FT                   /gene="gbs1674"
FT                   /regulatory_class="terminator"
FT   CDS             complement(107440..108330)
FT                   /transl_table=11
FT                   /gene="gbs1674"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="GOA:Q8E3T2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3T2"
FT                   /protein_id="CAD47333.1"
FT                   /translation="MLYQQIASNKRKTVVLLIVFFCLLAAIGAAVGYLVLGSYQFGLVL
FT                   ALIIGVIYAVSMIFQSTNVVMSMNNAREVTEDEAPNYFHIVEDMAMVAQIPMPRVFIVE
FT                   DDSLNAFATGSKPENAAVAATTGLLAVMNREELEGVIGHEVSHIRNYDIRISTIAVALA
FT                   SAVTLISSIGSRMLFYGGGRRRDDDREDGGNILVLIFSILSLILAPLAASLVQLAISRQ
FT                   REYLADASSVELTRNPQGMISALEKLDRSEPMGHPVDDASAALYINDPTKKEGLKSLFY
FT                   THPPIADRIERLRHM"
FT   regulatory      complement(108342..108347)
FT                   /gene="gbs1674"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(108351..108905)
FT                   /transl_table=11
FT                   /gene="gbs1675"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3T1"
FT                   /protein_id="CAD47334.1"
FT                   /translation="MGTMILIAIIALFVIWLIVAYNSLVRSRMHTKESWSQIDVQLKRR
FT                   NDLIPNLIETVKGYAAYEGKTLEKIAELRAQVAKANTPAEAMTASNELTRQLSSILAVA
FT                   ENYPDLKANNSFVKLQEELTNTENKISYSRQLYNTTTSNYNVKLETFPSNIVGKLFGFK
FT                   PSQFLETPEEEKEVPKVSFDF"
FT   regulatory      complement(108913..108918)
FT                   /gene="gbs1675"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      109021..109026
FT                   /gene="gidB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             109033..109746
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /product="Unknown"
FT                   /note="Similar to glucose-inhibited division protein GidB"
FT                   /db_xref="GOA:Q8E3T0"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3T0"
FT                   /protein_id="CAD47335.1"
FT                   /translation="MTPQAFYQVLIEHGITLTDKQKKQFETYFRLLVEWNEKINLTAIT
FT                   DKEEVYLKHFYDSIAPILQGYIDNSPLSILDIGAGAGFPSIPMKILYPEIDITIIDSLN
FT                   KRINFLNILANELELSGVHFFHGRAEDFGQDKVFRAKFDIVTARAVARMQVLAELTIPF
FT                   LKVNGRLIALKAAAAEEELISAEKALKTLFSQVTVNKNYKLPNGDDRNITIVSKKKETP
FT                   NKYPRKAGTPNKKPL"
FT   regulatory      109751..109756
FT                   /gene="gbs1677"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             109761..111140
FT                   /transl_table=11
FT                   /gene="gbs1677"
FT                   /product="Unknown"
FT                   /note="similar to Na+-transporting ATP synthase"
FT                   /db_xref="GOA:Q8E3S9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3S9"
FT                   /protein_id="CAD47336.1"
FT                   /translation="MKHFFDYKTMSVARKLSISFIAVILLGSILLSLPIFQYANAPKTH
FT                   YIDHLFTTVSMVCVTGLSVFPISKVYNGWGQIVAILLMQTGGLGLVTLMSLSYYTLRRK
FT                   MSLNDQTLLQSAITYNSSTDLKKYLYMIFKVTLTLEVLAASILAIDFIPRFGLGHGIFN
FT                   SIFLAVSAFCNAGFDNLGATSLAQFKLNPLVNIIVCFLIISGGLGFAVWKDLIEATIQT
FT                   SHKGPKLIKTFPKRLSNHSKLVLKTTTIILLTGTLLSWLLEFGNFRTIANLSLPKQLMV
FT                   SFFQTVTMRTAGFSTIDYTQTDFATNLVYIIQMLIGGAPGGTAGGFKVTVIAILLLLFK
FT                   AELSGQSQVTFHYRTIPSSIIKQTLSILTFFFIILISGYLLLLELNPHIDPFSLFFEAS
FT                   SALATVGVTMNTTNQLSLGGRIVIMFLMFIGRVGPITVLLSILQKKEKEIHYAETEIIL
FT                   G"
FT   regulatory      111141..111146
FT                   /gene="gbs1678"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             111153..111824
FT                   /transl_table=11
FT                   /gene="gbs1678"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3S8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3S8"
FT                   /protein_id="CAD47337.1"
FT                   /translation="MKTKIIGVLGLGIFGQTLAQELSNFEQDVIAIDSNPENVQAVAEV
FT                   VTKAAIGDITDLAFLKHIGISDCDTVIIATGNSLESSVLAVMHCKKLGVPQVIAKARNL
FT                   VYEEVLYEIGADLVISPERESGQNVAANLMRNKITDVFQIESDISVIEFKIPKSWVGKT
FT                   VEQLNIRHKFDLNLIGIRKAKNKPIDTEVPINSPLEEGIILVAIANSDAFQRYDYLGYF
FT                   N"
FT   regulatory      complement(111837..111855)
FT                   /gene="gbs1679"
FT                   /regulatory_class="terminator"
FT   regulatory      111838..111854
FT                   /gene="gbs1678"
FT                   /regulatory_class="terminator"
FT   CDS             complement(111859..112689)
FT                   /transl_table=11
FT                   /gene="gbs1679"
FT                   /product="Unknown"
FT                   /note="Similar to hypothetical ABC transporter (permease)"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3S7"
FT                   /protein_id="CAD47338.1"
FT                   /translation="MANQLIGYQEGYGFLYRLSGASKLLFFILVSVACMTTYDTRFLIL
FT                   VSLGSLVLFRLAKIKWQQVSFVMTLVVVFAVLNIIMVYLFAPHYGDKIYGSSSLLLKGI
FT                   GPYDVTSQELFYLFNLILKYFCTVPLALLFLMTTNPSQFASSLNQLGLSYKIAYAVSLT
FT                   LRYIPDVQEEFYTIRRAQEARGIELSKKSNLVARIKGNLQIVTPLIFSSLERIDTVATA
FT                   MELRRFGKNKRRTWYSKQSLEKSDIVLIILALASLFVSLYLIHLNHGRFYNPWQ"
FT   CDS             complement(112682..114358)
FT                   /transl_table=11
FT                   /gene="gbs1680"
FT                   /product="Unknown"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8E3S6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3S6"
FT                   /protein_id="CAD47339.1"
FT                   /translation="MKDFIEWKDFTFQYDVQSEPTLKGINLSIPKGEKVLILGPSGSGK
FT                   STLGHCLNGIIPNTHKGQYSGIFTINHKNAFDLSIYDKSHLVSTVLQDPDGQFIGLTVA
FT                   EDIAFALENDVVAQEEMTSIVEMWAKRLEIAPLLSKRPQDLSGGQKQRVSLAGVLVDDS
FT                   PILLFDEPLANLDPQSGQDIMALVDRIHQEQDATTIIIEHRLEDVLYERVDRVVLFSDG
FT                   QIIYNGEPDQLLKTNFLSEYGIREPLYISALKNLGYDFEKQNTMTSIDDFDFSELLIPK
FT                   MRALDLDKHTDKLLSVQHLSVSYDLENNTLDDVSFDLYKGQRLAIVGKNGAGKSTLAKA
FT                   LCQFIPNNATLIYNNEDVSQDSIKERAERIGYVLQNPNQMISQAMVFDEVALGLRLRGF
FT                   SDNDIESRVYDILKVCGLYQFRNWPISALSFGQKKRVTIASILILNPEVIILDEPTAGQ
FT                   DMKHYTEMMSFLDKLSCDGHSIVMITHDMQLMLEYTDRAIVIDNGLIAADDHPINILSN
FT                   TELLKKTHLKKTSLFALADRLGISPQKLTQWYIDNQGGKNG"
FT   regulatory      complement(112695..112700)
FT                   /gene="gbs1679"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(114365..114371)
FT                   /gene="gbs1680"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(114375..114923)
FT                   /transl_table=11
FT                   /gene="gbs1681"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3S5"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR022914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3S5"
FT                   /protein_id="CAD47340.1"
FT                   /translation="MNTNTIKKVVATGIGAALFIIIGMLVNIPTPIPNTNIQLQYAVLA
FT                   LFAVIYGPGVGFFTGFIGHALKDSIQYGSPWWTWVLVSGLLGLMIGFFAKKLAIQLSGM
FT                   TKKDLLLFNVVQVIANLIGWSVVAPYGDIFFYSEPASKVFAQGFLSSLVNSITIGVGGT
FT                   LLLLAYAKSRPQKGSLSKD"
FT   regulatory      complement(114929..114934)
FT                   /gene="gbs1681"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(115092..116300)
FT                   /transl_table=11
FT                   /gene="gbs1682"
FT                   /product="Unknown"
FT                   /note="Similar to transport proteins"
FT                   /db_xref="GOA:Q8E3S4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3S4"
FT                   /protein_id="CAD47341.1"
FT                   /translation="MKRFLKAWRKTSLIKKITIGVVIGLFLGILVPKASAIGLLGQLFV
FT                   GGLKAIAPLLVFTLVISALSQHREGGKTNMSTIIGLYITATFAAALIAVVVNYIFPLTL
FT                   ILKTPAKTDLLPPKGISEVFQSLLLKIVDNPIHAITEANYMSILFWAVIFGLAMRSSNQ
FT                   RTKDLMQTFADATSQVVKWIINLAPIGIMGLVFTSISENGIAILGDYGLLILVLVGTML
FT                   FVALVVNPIIAFVMMRKNPYPLVLRCLKDSGITAFFTRSSAANIPVNMRLCEDLGLDKD
FT                   TYSVSIPLGAAINMAGAAITINILTLAAVNTLGITVDFPTAFLLSVVAAVSACGASGVT
FT                   GGSLLLIPVACSLFGISNDVAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAVAEKSVF
FT                   GKK"
FT   regulatory      complement(116306..116311)
FT                   /gene="gbs1682"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      116464..116470
FT                   /gene="gbs1683"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             116478..117845
FT                   /transl_table=11
FT                   /gene="gbs1683"
FT                   /product="Unknown"
FT                   /note="Similar to branched-chain amino acid transporter"
FT                   /db_xref="GOA:Q8E3S3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3S3"
FT                   /protein_id="CAD47342.1"
FT                   /translation="MKLKNTYIIIGLMLFALFFGAGNLIYPAYLGIYSGSNWAWAIIGF
FT                   CLTGVTLPLLGVAAVAYSGSTDVESFTKPVSKTYAIFFAVALYLSIGPFFAIPRTGATS
FT                   FSVGIQPILGDSSLVKIIYGLIFFGISYFLAIRPSQIVDRIGKYLTPFLLTVISILIIA
FT                   SLIHPAAIVGTPHNASTNVSDAFKDLPFLAGLIQGYGTMDALASIAFAIIVIQASKQYG
FT                   AITKKEITSMALKSGAIATFLLAFIYIFVGRIGATSQSLFKFANGSFLLHNTPIDGGHV
FT                   LSQSANFYLGIVGQAILGTAIFLACLTTATGLITACAEYFHKLLPKISHITWATIFTLI
FT                   AITFYFGGLSEIIRWSLPVLYLLYPLTIVLIFLVFFDQKFESSCIVYQTSIAATAVAAL
FT                   YDALSKLGEMTGLFTIPSALTTFFTKVVPLGEYSMGWISFAICGVLVGLILKKVKA"
FT   regulatory      117944..117949
FT                   /gene="gbs1684"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             117959..119014
FT                   /transl_table=11
FT                   /gene="gbs1684"
FT                   /product="Unknown"
FT                   /note="similar to NAD alcohol dehydrogenase"
FT                   /db_xref="GOA:Q8E3S2"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3S2"
FT                   /protein_id="CAD47343.1"
FT                   /translation="MRAATYLSANELSLTDKAKPQVIKPTDAVVRLVKTTICGTDLHIL
FT                   GGDVPACKPGTTLGHEGIGIVEEVGSAVNHFKVGDKVIISCVTACNTCYYCKHQLPSHC
FT                   EDGGWILGHLIEGTQAEYVHIPHADGSLYHAPEGVCDDALVMLSDILPTSYEIGVLPSH
FT                   IKPGDTVCIVGAGAIGLSALLTAQFYSPAKIIMVDLSQKRLEASKKFGATHTILSTSTQ
FT                   EVKEEIDKITKGRGVDVVLECVGYPATFDICQNVVSIGGHIANVGVHGKPVEFNLQDLW
FT                   IKNITLNTGLVNANTTEMLLEVLETGKIDATQLVTHHFKLSEIEEAYKVFKAAEENNTL
FT                   KVIIENDITPA"
FT   regulatory      119036..119059
FT                   /gene="gbs1684"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(119036..119059)
FT                   /gene="gbs1685"
FT                   /regulatory_class="terminator"
FT   CDS             complement(119063..119755)
FT                   /transl_table=11
FT                   /gene="gbs1685"
FT                   /product="Unknown"
FT                   /note="similar to ABC transporter (permease)"
FT                   /db_xref="GOA:Q8E3S1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3S1"
FT                   /protein_id="CAD47344.1"
FT                   /translation="MIEWIQTHLPNVYQMGWEGAYGWQTAIVQTLYMTFWSFLIGGLMG
FT                   LLGGLFLVLTSPRGVIANKLVFGVLDKVVSVFRALPFIILLALIAPVTRVIVGTTLGSP
FT                   AALVPLSLAVFPFFARQVQVVLAELDGGVIEAAQASGGTLWDIIVVYLREGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGSVAITKGYNYSRDDITLVATILILLLIFFIQFLGDF
FT                   LTRRLSHK"
FT   CDS             complement(119752..120822)
FT                   /transl_table=11
FT                   /gene="gbs1686"
FT                   /product="Unknown"
FT                   /note="similar to ABC transporter (ATP-binding protein)"
FT                   /db_xref="GOA:Q8E3S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3S0"
FT                   /protein_id="CAD47345.1"
FT                   /translation="MSKEPIIKLDNIDVTFHQKKREINAVKDVTIHINQGDIYGIVGYS
FT                   GAGKSTLVRVINLLQEPSAGKITIDNQVIYDNKVTLTSTQLREQRREIGMIFQHFNLMS
FT                   QLTAEQNVAFALKHSGLSKEAKAAKVAKLLELVGLSDRAQNYPSQLSGGQKQRVAIARA
FT                   LANDPKILISDESTSALDPKTTKQILALLQDLNKKLGLTIVLITHEMQIVKDIANRVAV
FT                   MQNGKLIEEGSVLDIFSHPRESLTQDFIKIATGIDEAMLKIEQQEVVKNLPVGSKLVQL
FT                   KYAGHSTDEPLLNQIYKEFEVTANILYGNIEILDGIPVGEMVVILSGDEEKLRQACQAI
FT                   TDSQVQLTLLKEGGKA"
FT   regulatory      complement(119765..119770)
FT                   /gene="gbs1685"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(120815..122191)
FT                   /transl_table=11
FT                   /gene="gbs1687"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3R9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R9"
FT                   /protein_id="CAD47346.1"
FT                   /translation="MTLTKEENQIQKFLSDTIVQDDINILRDLIAIKSIFAQKVGLNDL
FT                   ASYLGEVFRKAGAEVIIDDSYSAPFIVANFKSSKVDAKRIIFYNHYDTVPADEVEQWTE
FT                   DPFTLSLRYGKMYGRGVDDDKGHITARLSAVKKYLSRHKGELPLDITFIVEGAEESASV
FT                   GLDYYLEKYQEQLQGADLIVWEDGPKNPKGQLEIAGGNKGIVTFDLSVSSADVDIHSSF
FT                   GGVVDSSTWYLIQALNTLRDNKGHILVEGIYDKVIPPTKRELELVEKYSYRSAKALEDA
FT                   YQLVLPSLADSHKTFLRKLYFEPSIAIEGITSGYQGEGVKTILPAYAKCKAEVRLVPGL
FT                   TPKGVLDSIQNHLKENGFNDIELTYTLGEMSYRSDMSAPSILKVVDLAEQFYPEGVSLL
FT                   PTSPGTGPMYLVHQALRAPIAAFGIGHANSRDHGVDENVSIADYYTHIELVEALIESYE
FT                   "
FT   regulatory      complement(122202..122207)
FT                   /gene="gbs1687"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(122325..123149)
FT                   /transl_table=11
FT                   /gene="gbs1688"
FT                   /product="Unknown"
FT                   /note="Similar to unknown protein"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R8"
FT                   /protein_id="CAD47347.1"
FT                   /translation="MKLKHIVLGLALTTLLGVTFSNQEVSASSTSSKVVKVGVMTFSDT
FT                   EKARWDKIEKLVGDKAKIKFTEFTDYTQPNQATANKDVDINAFQHYNFLENWNKENKKN
FT                   LIPLEKTYLAPIRIYSEKVKSLKKLKKGATIAIPNDATNGSRALYVLQSAGLIKLNVSG
FT                   KKVATVANITSNKKDINIQELDASQTPRALKDVDAAIINNTYIEQANLKPSDAIFVEKS
FT                   DKNSKQWINIIAGRKNWKKQKNAKAIQAILDAYHTDEVKKVIKDTSADIPQW"
FT   regulatory      complement(123159..123164)
FT                   /gene="gbs1688"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(123290..124123)
FT                   /transl_table=11
FT                   /gene="gbs1689"
FT                   /product="Unknown"
FT                   /note="similar to (amino acid ?) ABC transporter (binding
FT                   protein)"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R7"
FT                   /protein_id="CAD47348.1"
FT                   /translation="MTIKKVLSVTGIILVTVASLAACSSKSHTTKTGKKEVNFATVGTT
FT                   APFSYVKDGKLTGFDIEVAKAVFKGSDNYKVTFKKTEWSSVFTGIDSGKFQMGGNNISY
FT                   SSERSQKYLFSYPIGSTPSVLAVPKNSNIKAYNDITGHKTQVVQGTTTAKQLENFNKKH
FT                   QKNPVTLKYTNENITQILTNLSDGKADFKLFDGLTVNAIIKNQGLTNLKTIPLTMRDQP
FT                   YIYFIFGQDQKDLQKYVNNCLKQLRKDGTLSKIAKEYLGGDYVPNEKDLVTPKEK"
FT   regulatory      complement(124133..124138)
FT                   /gene="gbs1689"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(124225..124914)
FT                   /transl_table=11
FT                   /gene="gbs1690"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="GOA:Q8E3R6"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R6"
FT                   /protein_id="CAD47349.1"
FT                   /translation="MLTKPIIGITGNEREMSDIPGYYYDSVSRHISEGVKNAGGLPVIL
FT                   PISEAESAKAYVEMIDKLIISGGQNVLPSYYGEEKIIESDDYSLARDIFEFALVDEALK
FT                   QNKPIFAICRGMQLVNVALGGTLNQSIDNHYQEPYIGFAHYLNVEKGSFLEGFISGDFR
FT                   INSLHRQSVKLLAEGLIVSARDPRDGTVEAYESRTEQCIIGVQWHPELMLHQIENQTLF
FT                   GYFVNET"
FT   regulatory      complement(124922..124927)
FT                   /gene="gbs1690"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(125040..125059)
FT                   /gene="gbs1691"
FT                   /regulatory_class="terminator"
FT   CDS             complement(125069..125785)
FT                   /transl_table=11
FT                   /gene="gbs1691"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:P67184"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67184"
FT                   /protein_id="CAD47350.1"
FT                   /translation="MGRKWANIVAKKTAKDGANSKVYAKFGVEIYVAAKQGEPDPESNS
FT                   ALKFVLDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGASGSVSYLFDKKGVIVFAGDDADTVFEQLLEADVDVDDVEA
FT                   EEGTITVYTAPTDLHKGIQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDAL
FT                   ESDDDVQKVYHNVADF"
FT   regulatory      complement(125793..125798)
FT                   /gene="gbs1691"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(125903..126889)
FT                   /transl_table=11
FT                   /gene="gbs1692"
FT                   /product="Unknown"
FT                   /note="Similar to putative dihydroxyacetone kinase"
FT                   /db_xref="GOA:Q8E3R4"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012735"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R4"
FT                   /protein_id="CAD47351.1"
FT                   /translation="MRKTEHHKMEYVFETIKAITKTNPKVEQIKDLPAIHYLGQSEQVI
FT                   PILSGGGSGHEPAHFGYVGEGMLSAAISGPIFVPPCASDILETIRFINRGKGVFVIIKN
FT                   FEADLEEFSQAIEQARQEGIPIKYIVSHDDISVETSNFKIRNRGVAGTVLLHKIIGQAA
FT                   LEGASLDELEQLGLSLTTSMATLGVASKSATILGQHQPVFDLEEGYISFGIGIHGEPGY
FT                   RTMPFVSMEHLANELVNKLKMKLRWQDGEAFILLINNLGGSSKMEELLFTNAVMEFLAL
FT                   DDLQLPFIKTGHLITSLDMAGLSVTLCRVKDSRWIDYLKHKTDARAW"
FT   regulatory      complement(126898..126903)
FT                   /gene="gbs1692"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(126899..127435)
FT                   /transl_table=11
FT                   /gene="gbs1693"
FT                   /product="Unknown"
FT                   /note="Similar to putative transcription regulator"
FT                   /db_xref="GOA:Q8E3R3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012738"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R3"
FT                   /protein_id="CAD47352.1"
FT                   /translation="MASSLITKKKIAKSFKRLFISQAFDKISVSDIMEDAGIRRQTFYN
FT                   HFVDKYALLEWIFQTELSEQVTDNLDYISGFQLLSELLTFFKMNQEFYIKLFQIEDQND
FT                   FSSYFESYCEQLVDKLLSDYSKSNFSQKERVTFINYHSKALSYFIKYELINNSKEELFN
FT                   RKVIEKIIRTSIENY"
FT   regulatory      complement(127440..127445)
FT                   /gene="gbs1693"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      127597..127602
FT                   /gene="gbs1694"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             127609..128598
FT                   /transl_table=11
FT                   /gene="gbs1694"
FT                   /product="Unknown"
FT                   /note="Similar to hypothetical dihydroxyacetone kinase"
FT                   /db_xref="GOA:Q8E3R2"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R2"
FT                   /protein_id="CAD47353.1"
FT                   /translation="MKKILNQPTDVVTEMLDGLAYVHNDLVHRVEGFDIIARNEEKSGK
FT                   VALISGGGSGHEPSHAGFVGEGMLSAAVCGAVFTSPTPDQVLEAIKEADEGAGVFMVIK
FT                   NYSGDIMNFEMAQDMAEMEGIDVASVVVDDDIAVEDSLYTQGKRGVAGTILVHKILGHA
FT                   ARHGKSLQEIKAIADELVPNIHTVGLALSGATVPEVGKPGFVLAEDEIEFGIGIHGEPG
FT                   YRKEKMQPSKALATELVDKLIESFDAKSGEKYGVLINGMGATPLMEQYVFANDVAKLLE
FT                   DKGIEVNYKKLGNYMTSIDMAGLSLTLIKLENQEWLEALNSDVTTIAW"
FT   regulatory      128626..128631
FT                   /gene="gbs1695"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             128636..129214
FT                   /transl_table=11
FT                   /gene="gbs1695"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3R1"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R1"
FT                   /protein_id="CAD47354.1"
FT                   /translation="MEVKTAIEWMHTFNQKIQSNKDYLSELDTPIGDGDHGGNMARGMT
FT                   AVIENLDNNEFSSAADVFKTVSMQLLSKVGGASGPLYGSAFMGITKAEQSESTISEALG
FT                   AGLEMIQKRGKAELNEKTMVDVWHGVIEAIEKNELTEDRIDSLVDATKGMKATKGRASY
FT                   VGERSLGHIDPGSFSSGLLFKALLEVGGV"
FT   regulatory      129202..129207
FT                   /gene="gbs1696"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             129214..129588
FT                   /transl_table=11
FT                   /gene="gbs1696"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3R0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3R0"
FT                   /protein_id="CAD47355.1"
FT                   /translation="MSDIGIIVVSHSKNIAQGVVDLISEVAKDVSITYVGGTEDGEIGT
FT                   SFDQVQQIVEQNDKKTLLAFFDLGSAKMNLELVADFSEKNIIINSVPVVEGAYTAAALL
FT                   QAGADLDSIQSQLAELTINK"
FT   regulatory      129588..129593
FT                   /gene="gbs1697"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             129598..130311
FT                   /transl_table=11
FT                   /gene="gbs1697"
FT                   /product="Unknown"
FT                   /note="Similar to glycerol uptake facilitator "
FT                   /db_xref="GOA:Q8E3Q9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q9"
FT                   /protein_id="CAD47356.1"
FT                   /translation="MTQFLGEFLGTFILVLLGDGVVAGNVLSKTKEEGTGWTAIVFGWG
FT                   IACTVAVYVSGLFSPAHLNPAVTLAMASIGAISWGQVIPFIIAQMLGAMVAATILWLHY
FT                   YPHWKETKDSGLILASFSTGPAIRHTPSNLLGEIIGTAILVITIMAIGPSKVAAGLGPI
FT                   IVGIVIFAVGFSLGPTTGYAINPARDLGPRLMHAILPIENKGDSDWSYAWIPVVGPIIG
FT                   GVLGAILYNIALTLI"
FT   regulatory      130320..130341
FT                   /gene="gbs1697"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(130545..130562)
FT                   /gene="gbs1698"
FT                   /regulatory_class="terminator"
FT   CDS             complement(130577..130981)
FT                   /transl_table=11
FT                   /gene="gbs1698"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q8"
FT                   /protein_id="CAD47357.1"
FT                   /translation="MKGFHGNIEKLTLGNTNFRQVLYTAEHCQLVLMTLPVGGEIGSEI
FT                   HAENDQFFRFEAGHGKVVIDGNEYEVADGDAIIVPAGAEHNVINTSETEMLKLYTIYSP
FT                   AHHKDGIIRATREEAEENEEDFDGVTSETK"
FT   regulatory      complement(130990..130995)
FT                   /gene="gbs1698"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(131120..131833)
FT                   /transl_table=11
FT                   /gene="gbs1699"
FT                   /product="Unknown"
FT                   /note="Similar to transcriptional regulator "
FT                   /db_xref="GOA:Q8E3Q7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q7"
FT                   /protein_id="CAD47358.1"
FT                   /translation="MKTVKEISHISGISVRTLHYYDEIDLLPPSFVGENGYRYYDDESL
FT                   IKLQEILLFKELEFPLKKIKEIMDSPNYDRNQALLDQIRWLELKKQRLEEVIEHAKSIQ
FT                   RGKNMSDFTAYNQEELEAFQEEARTRWGDTDSYKEFENSYSKNDFSMISQAMSQIFKDF
FT                   GQLKELSPTDEKVQKQVQILQDYITAQFYNCTNDLLASLGIMYIQDERFQRSIDNWGGQ
FT                   GTALFVSKAIDSYCQ"
FT   regulatory      complement(131839..131844)
FT                   /gene="gbs1699"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(131926..133035)
FT                   /transl_table=11
FT                   /gene="gbs1700"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3Q6"
FT                   /protein_id="CAD47359.1"
FT                   /translation="MTVTGIVAEFNPFHNGHKYLLEQAQGIKVIAMSGNFMQRGEPAIV
FT                   DKWTRAQMALENGADLVIELPFLVSVQSADYFASGAVSILARLGVDNLCFGTEEMLDYD
FT                   RIGDIYVNKKEEMEAFLKKQSDSLSYPQKTQAMWQEFAGIAFSGQTPNHILGLAYTKAA
FT                   SQNGIRLNPIQRQGAGYHSSEKTEIFASATSLRKHQSDRFFVEKGMPNSDLFLNSPQVV
FT                   WQDYFSLLKYQIMTHSDLTQIYQVNEEIANRIKSQIRYVETVDELVDKVATKRYTKARI
FT                   RRLLTYILINAVESPIPNAIHVLGFTQKGQQHLKSVKKSVDIVTRIGSQTWDSLTQRAD
FT                   SVYQMGNANIAEQTWGRIPFHQSVSQSDL"
FT   CDS             complement(133032..133283)
FT                   /transl_table=11
FT                   /gene="gbs1701"
FT                   /product="Unknown"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q5"
FT                   /protein_id="CAD47360.1"
FT                   /translation="MIIFLYACLMIFGILYIIERRVSQKKSKVILGLLMNPKLHLDLLS
FT                   ALKPFEKETDRLIYLRKTYHLDIIDAVTLNNQLKEKEV"
FT   regulatory      complement(133045..133050)
FT                   /gene="gbs1700"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(133291..133296)
FT                   /gene="gbs1701"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(133306..134040)
FT                   /transl_table=11
FT                   /gene="gbs1702"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q4"
FT                   /protein_id="CAD47361.1"
FT                   /translation="MATYETFAAVYDAVMDDTLYDKWTDFSLRHFPKGKKKLLELACGT
FT                   GIQSVRFSQAGYAVTGLDLSGDMLKLAKKRATSAHQSIQFIEGNMLDLSNVGKYDLITC
FT                   YSDSICYMQDEVEVGDVFIEVYKALEENGVFIFDVHSTYQTDKVFPGYSYHENADDFAM
FT                   VWDTYEDDAPHSIVHELTFFVQEEDGRFTRHDEVHEERTYDILTYDILLEQAGFKDVKV
FT                   YADFEDKKPTATSARWFFVAHK"
FT   regulatory      complement(134048..134052)
FT                   /gene="gbs1702"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(134106..134462)
FT                   /transl_table=11
FT                   /gene="gbs1703"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3Q3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="InterPro:IPR025656"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q3"
FT                   /protein_id="CAD47362.1"
FT                   /translation="MTEKDLLQLVVKAADEKRAEDIVILDLQPVTSVADYFVIMSASNS
FT                   RQLEAIADNIREQVKGNGGDASHLEGDSKAGWVLLDLNSVVVHIFSEDERQHYNLEKLW
FT                   HEAPLLDAEDFMTE"
FT   CDS             complement(134464..134985)
FT                   /transl_table=11
FT                   /gene="gbs1704"
FT                   /product="unknown"
FT                   /note="similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3Q2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q2"
FT                   /protein_id="CAD47363.1"
FT                   /translation="MTCALLLIDIQQGIMDKKPKHLTNFAELLDDLLLSAKGSNCEVIW
FT                   IRHHDEELPQGSPQWEIWERRHLVTHHKIIDKTYNSCFKDTHLHDYLQSKHISQLIMMG
FT                   LQTEYCFDTSVKVAFEYGYDIFIPQGGHLTFDTPTLSGDSIKKHYENIWHHRFATMVAK
FT                   DNLLKLINEE"
FT   regulatory      complement(134469..134474)
FT                   /gene="gbs1703"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(134991..134996)
FT                   /gene="gbs1704"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(135049..135636)
FT                   /transl_table=11
FT                   /gene="gbs1705"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q1"
FT                   /protein_id="CAD47364.1"
FT                   /translation="MTYKDYTGLDRTELLSKVRHMMSDKRFNHVLGVERAAIELAERYG
FT                   YDKEKAGLAALLHDYAKELSDDEFLRLIDKYQLDPDLKKWGNNIWHGLVGIYKIQEDLA
FT                   IKDQDILAAIAKHTVGSAQMSTLDKIVYVADYIEHNRDFPGVEEARELAKVDLNKAVAY
FT                   ETARTVSFLASKAQPIYPKTIETYNAYIPYLD"
FT   CDS             complement(135633..136265)
FT                   /transl_table=11
FT                   /gene="gbs1706"
FT                   /product="Unknown"
FT                   /note="Similar to probable nicotinate-nucleotide
FT                   adenylyltransferase"
FT                   /db_xref="GOA:Q8E3Q0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3Q0"
FT                   /protein_id="CAD47365.1"
FT                   /translation="MALELLTPFTKVELEEKKRDTNRKQIGIMGGNFNPVHNAHLVVAD
FT                   QVRQQLCLDQVLLMPEFQPPHIDKKETIDEQHRLKMLELAIEGIDGLSIEPIEIERKGI
FT                   SYTYDTMKLLIEKNPDVDYYFIIGADMVEYLPKWHRIDELVKMVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRQFIKSNRQPNYLLPKEVLDYIRKEGLYK"
FT   regulatory      complement(135646..135651)
FT                   /gene="gbs1705"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(136270..136275)
FT                   /gene="gbs1706"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(136395..136712)
FT                   /transl_table=11
FT                   /gene="gbs1707"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3P9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3P9"
FT                   /protein_id="CAD47366.1"
FT                   /translation="MLTSKQRAFLKSEAHSMKPIIQIGKNGLNDQIKTSVRNALDAREL
FT                   IKVTLLQNTDEDIHDVAEVLEDEIGCDTVLKIGRILILYKESARKENRKISVKVKAVKS
FT                   N"
FT   regulatory      complement(136721..136726)
FT                   /gene="gbs1707"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(136805..137923)
FT                   /transl_table=11
FT                   /gene="gbs1708"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3P8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3P8"
FT                   /protein_id="CAD47367.1"
FT                   /translation="MEELFCIGCGARIQTENKDAAGYTPRAALEKGLETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLKLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFVAGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPVDVILTSAQNHHAIKDLIDTIEKYRHG
FT                   RDVYVVGVTNVGKSTLINAIIREITGSRDVITTSRFPGTTLDKIEIPLDDGSYIFDTPG
FT                   IIHRHQMAHYLTAKNLKYVSPKKEIKPKTYQLNSEQTLFLAGLARFDFISGQKQGFTAY
FT                   FDNNLNLHRTKLVGADEFYTKHVGKLLTPPTGKEVSDFPKLVRHEFTIKNKMDIVYSGL
FT                   GWIRVKSEAENPVVVAAWAPEGVAVVLRKALI"
FT   CDS             complement(137923..138483)
FT                   /transl_table=11
FT                   /gene="gbs1709"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3P7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3P7"
FT                   /protein_id="CAD47368.1"
FT                   /translation="MNSKIYFLEMKLSIDDYRPTFVVEAVYDLRAEDLLRHGIRAVLVD
FT                   LDNTLIAWNNPDGTAEVRAWLDEMTTADISVVVVSNNNHARVERAVSRFGVDFVSRAMK
FT                   PFTRGINMAIERYGFDRDEVIMVGDQLMTDIRASHRAGIKSVLVKPIVKSDAWNTKFNR
FT                   LRERRVWKKIEENYGKIVYQKGI"
FT   regulatory      complement(137930..137935)
FT                   /gene="gbs1708"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(138523..138536)
FT                   /gene="gbs1710"
FT                   /regulatory_class="terminator"
FT   CDS             complement(138567..139481)
FT                   /transl_table=11
FT                   /gene="gbs1710"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3P6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3P6"
FT                   /protein_id="CAD47369.1"
FT                   /translation="MTKKEKGTMMTLAAGLAWGISGISGQYLMSHGVHVNLLTSLRLLI
FT                   TGIFLLSLARSKQKEHLVAAWKQPKFLKQVLLFSIFGLVLNQYAFLRAIHLTNAGTATV
FT                   LQYMAPILILSIVCILNRQRPTSFEIIAIAMAILGTYMIATHGKLGSLAITPKGLMWGL
FT                   GSAITYSIYILLPVKLIHEWGSTIVIGSGMFIGGILFSLVTKAWQYPLQINVMSILAYI
FT                   GIIGIGTIFAYTFFLKGVSIVGAVKGSLLASVEPVSSVFLTVLVLGEIFYPIDLLGMLF
FT                   IFLAVTLISYKDLIALKKMKRVK"
FT   regulatory      complement(139488..139493)
FT                   /gene="gbs1710"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(139592..139607)
FT                   /gene="gbs1711"
FT                   /regulatory_class="terminator"
FT   CDS             complement(139611..141053)
FT                   /transl_table=11
FT                   /gene="gbs1711"
FT                   /product="Unknown"
FT                   /note="Similar to Glu-tRNA amidotransferase subunit B"
FT                   /db_xref="GOA:Q8E3P5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3P5"
FT                   /protein_id="CAD47370.1"
FT                   /translation="MNFETVIGLEVHVELNTNSKIFSPSSAHFGQEQNANTNVIDWSFP
FT                   GVLPVMNKGVVDAGIKAALALNMDIHQNMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEIELEDGTRKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYAYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEEFGTKAELKNLNSFNNV
FT                   RKGLIHEEKRQAQVLRSGGQIQQETRRFDETTGETILMRVKEGSSDYRYFPEPDLPLFD
FT                   ISDEWIDQVRLELPEFPQERRAKYVSSFGLSSYDASQLTATKATSDFFEKAVAIGGDAK
FT                   QVSNWLQGEVAQFLNSESKSIEEIGLTPENLVEMISLIADGTISSKIAKKVFVHLAKNG
FT                   GSAEEFVKKAGLVQISDPEVLIPIIHQVFADNEAAVIDFKSGKRNADKAFTGYLMKATK
FT                   GQANPQVALKLLAQELAKLKEE"
FT   CDS             complement(141053..142519)
FT                   /transl_table=11
FT                   /gene="gbs1712"
FT                   /product="Unknown"
FT                   /note="Similar to Glutamyl-tRNA Gln amidotransferase
FT                   subunit A"
FT                   /db_xref="GOA:Q8E3P4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3P4"
FT                   /protein_id="CAD47371.1"
FT                   /translation="MSFNNQSIDQLHDLLVKKEISATELTKATLEDIHAREQAVGSFIT
FT                   ISDDMAIAQAKEIDDKGIDADNVMSGIPLAVKDNISTKGILTTAASKMLYNYEPIFDAT
FT                   AVEKLYAKDMIVIGKANMDEFAMGGSTETSYFKKTNNAWDHSKVPGGSSGGSAAAVASG
FT                   QVRLSLGSDTGGSIRQPASFNGIVGMKPTYGRVSRFGLFAFGSSLDQIGPMSQTVKENA
FT                   QLLTVISGHDVRDSTSSERTVGDFTAKIGQDIQGMKIALPKEYLGEGIAPGVKETIIKA
FT                   AKHLEKLGAVIEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRTENYKNLDDI
FT                   YVNTRSEGFGDEVKRRIMLGTFSLSSGYYDAYYKKAGQVRSLIIQDFEKVFADYDLILG
FT                   PTAPTTAFDLDSLNHDPVAMYLADILTIPVNLAGLPGISIPAGFDKGLPVGMQLIGPKF
FT                   SEETIYQVAAAFEATTDYHKQQPKIFGGEN"
FT   regulatory      complement(141063..141068)
FT                   /gene="gbs1711"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(142519..142821)
FT                   /transl_table=11
FT                   /gene="gbs1713"
FT                   /product="Unknown"
FT                   /note="Similar to Glu-tRNA Gln amidotransferase subunit C"
FT                   /db_xref="GOA:Q8E3P3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3P3"
FT                   /protein_id="CAD47372.1"
FT                   /translation="MKISEEEVRHVANLSKLRFSDQETKEFASSLSKIVDMIELLNEVD
FT                   TEGVPVTTTMADRKTVMREDIAQPGNNRDDLFKNVPQHQDYYIKVPAILEDGGDA"
FT   regulatory      complement(142529..142534)
FT                   /gene="gbs1712"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(142826..142831)
FT                   /gene="gbs1713"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(142959..145604)
FT                   /transl_table=11
FT                   /gene="gbs1714"
FT                   /product="Unknown"
FT                   /note="Similar to Pyruvate Phosphate Dikinase"
FT                   /db_xref="GOA:Q8E3P2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3P2"
FT                   /protein_id="CAD47373.1"
FT                   /translation="METKFVYHFDEGCKEMKELLGGKGANLAEMTSIGLPVPQGFTITT
FT                   QACNDYYDNACHIRESILSQIDQAMAQLEVEQNKQLGSVDDPLLVSVRSGAVFSMPGMM
FT                   DTVLNLGLNDRSVQGLVKKTEDERFAYDSYRRFIQMFADVVTGIPKYKFDTILDRLKTD
FT                   KCYQDDTELTGSDLQRLVEFYKELYQKEAGEKFPQDPKRQLLLAIEAVFKSWNNPRAKI
FT                   YRKLNDISETLGTAVNIQAMVFGNMGNNSGTGVAFTRNPSTGAANLFGEYLINAQGEDV
FT                   VAGIRTPQSISKLAEQMPIIYQEFVSVTQKLEAHYRDMQDMEFTIENGNLYMLQTRSGK
FT                   RTAKAAIKIAVDQVNEGLISKEEAILRIEPKQLDQLLHPSFDLESLKKAILLTTGLPAS
FT                   PGAAYGKVYFHAEDVVQEMKKGNPVLLVRQETSPEDIEGMVSANGIITARGGMTSHAAV
FT                   VARGMGKPCVAGCSQLLVDEVRREISIGHQTIKEGEMLSIDGATGNVYIGQVPMAETSV
FT                   DCDFEIFMKWVDENRDMMVCSNADNPRDAQKALDFGAEGIGLCRTEHMFFDDERIPVVR
FT                   EMILADDVLSRRKALERLLSFQRDDFYQIFKVLKGKTCTIRLLDPPLHEFLPHDKESIE
FT                   SMARQMGISTLAIEKRIQTLEEFNPMLGHRGCRLAITYPEIYQMQMRALVQGAILAMKE
FT                   GYEAKPEIMIPLVSAHEEISIIRDLIEETIIEESKSKKINLSFPIGTMIETPRACMIAD
FT                   DIAKFADFFSFGTNDLTQMSFGFSRDDAGKFLGEYVDKGLLKKDPFQALDQKGIGRFIE
FT                   QAVRLGKEVKPNLKIGICGEHGGEPSSIEFCYQQGLHYVSCSPFRIPIAKLAAAQAKIK
FT                   QSRNDITIDK"
FT   regulatory      complement(145610..145615)
FT                   /gene="gbs1714"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(145617..146447)
FT                   /transl_table=11
FT                   /gene="gbs1715"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3P1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3P1"
FT                   /protein_id="CAD47374.1"
FT                   /translation="MEDQLTIFIISDSLGETAKAIAKACLSQFPGHDDWHFQCFSYINS
FT                   QERLEQVFEEASQKTVFMMFSLVDVALASYAQKRCESEHYAYVDLLTNVIQGISRISGI
FT                   DPLGEPGILRRLDNDYFKRVESIEFAVKYDDGRDPRGILQADLVIIGISRTSKTPLSMF
FT                   LADKNIKVINIPLVPEVPVPKELRMIDSRRIIGLTNSVDHLNQVRKVRLKSLGLSSTAN
FT                   YASLERILEETRYAEEVMKNLGCPIINVSDKAIEETATIILEILKTNGQVAKNL"
FT   regulatory      complement(146454..146459)
FT                   /gene="gbs1715"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(146458..147087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbs1716"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016842"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3P0"
FT                   /protein_id="CAD47375.1"
FT                   /translation="MQLNQRQERIIDIIKQFQPITGELIAEKLGVTRAALRSDLAVLSM
FT                   LGIIDAKPKVGYFYLGQYHASIGTSHFEKMTVSEIMGIPLTVHQKDSVYDVIVHIFMED
FT                   AGCAFILDDDDFLCGVVSRKDLLKTSIGGGDLSKMPIGMVMTRMPHVTTVLENESLFAA
FT                   ADKLVSRKVDSLPVVRHDKQYPEKFKVIGKLSKTILASLFLEIRDY"
FT   regulatory      147263..147268
FT                   /gene="gbs1717"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             147276..148241
FT                   /transl_table=11
FT                   /gene="gbs1717"
FT                   /product="Unknown"
FT                   /note="Similar to 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="GOA:Q8E3N9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N9"
FT                   /protein_id="CAD47376.1"
FT                   /translation="MTIKNLTVAGSGVLGSQIAFQAAYKGMSVTIYDINDEALNKGKER
FT                   IKKLAKVYQSEIETAKEAYSDKAKSIKYNKNLLPSLDHIFLSKVADSLDLIADLPNQIT
FT                   FSKNLDQAVSDADLVIEAVPETVSIKEDFYKQLAKVAPSKTIFATNSSTLVPSQFADIT
FT                   GRPDKFLAMHFANNIWQNNIVEIMGHKGTDDEVVKEALAFSKDIGMVPLHIHKEQPGYI
FT                   LNSILVPFLESALALYYNKVSDSETIDKTWKLGTGAPMGPLEILDIIGIDTAYNIMKNY
FT                   SDTNSDPNSLHAHLAKMLKEEFIDKGRTGKAAGHGFYDYD"
FT   regulatory      148251..148274
FT                   /gene="gbs1717"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(148251..148274)
FT                   /gene="gbs1718"
FT                   /regulatory_class="terminator"
FT   CDS             complement(148288..148836)
FT                   /transl_table=11
FT                   /gene="gbs1718"
FT                   /product="Unknown"
FT                   /note="Similar to other proteins"
FT                   /db_xref="GOA:Q8E3N8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N8"
FT                   /protein_id="CAD47377.1"
FT                   /translation="MTKALISIDYTYDFVADDGKLTAGKPAQSIASAIADVTEKAYRSG
FT                   DYIFFAIDNHDIGDVFHPETNLFPEHNIKGTSGRNLYGPLGTLYETIKEDSRVFWIDKR
FT                   HYSAFSGTDLDIRLRERRIDTLILTGVLTDICVLHTAIDAYNLGYKIEVPAAAVASLND
FT                   SNHQWALNHFKTVLGATIL"
FT   regulatory      complement(148848..148853)
FT                   /gene="gbs1718"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(148903..149688)
FT                   /transl_table=11
FT                   /gene="gbs1719"
FT                   /product="Unknown"
FT                   /note="Similar to transcriptional regulator (CodY family)"
FT                   /db_xref="GOA:P63846"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63846"
FT                   /protein_id="CAD47378.1"
FT                   /translation="MPNLLEKTRKITSILQRSVDSLDAELPYNTMAAQLADIIDCNACI
FT                   INGGGNLLGYAMKYKTNTDRVEEFFETKQFPDYYVKSASRVYDTEANLSVDNDLSIFPV
FT                   ETKENFQDGITTIAPIYGGGMRLGTFIIWRNDKEFSDDDLILVEIASTVVGIQLLNLQT
FT                   ENLEENIRKQTAVTMAINTLSYSEMKAVAAILGELDGLEGRLTASVIADRIGITRSVIV
FT                   NALRKLESAGIIESRSLGMKGTYLKVINEGIFDKLKEYN"
FT   regulatory      complement(149695..149700)
FT                   /gene="gbs1719"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(149814..151025)
FT                   /transl_table=11
FT                   /gene="gbs1720"
FT                   /product="Unknown"
FT                   /note="Similar to putative aminotransferase"
FT                   /db_xref="GOA:Q8E3N7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N7"
FT                   /protein_id="CAD47379.1"
FT                   /translation="MKIFDKSMKLEHVAYDIRGPVLEEADRMRANGEKILRLNTGNPAA
FT                   FGFEAPDEVIRDLITNARESEGYSDSKGIFSARKAVMQYYQLQNIHVDMDDIYIVNGVS
FT                   EGISMSMQALLDNDDEVLVPMPDYPLWTACVSLAGGNAVHYICDEEANWYPDIDDIKSK
FT                   ITSKTKAIVLINPNNPTGAVYPREILQEIVDIARQNDLIIFSDEVYDRLVMDGMEHIPI
FT                   ASIAEDIFTVTLSGLSKSHRICGFRVGWMVLSGPRQHVKGYIEGLNMLANMRLCSNVLA
FT                   QQVIQTSLGGQQSIDSMLLPGGRIYEQRNYIHKAINEIPGLSAVKPNAGLYLFPKIDTD
FT                   MYRIDNDEEFVLNFLKQEKVLLTHGRGFNMNTADHFRIVYLPRVDELTELQEKMARFLS
FT                   QYKR"
FT   regulatory      complement(151033..151038)
FT                   /gene="gbs1720"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      151279..151284
FT                   /gene="gbs1721"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             151293..151745
FT                   /transl_table=11
FT                   /gene="gbs1721"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3N6"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N6"
FT                   /protein_id="CAD47380.1"
FT                   /translation="MSQKYERILVAIDGSTESELAFEKAVNVALRNDSELILTHVIDTR
FT                   ALQSFATFDTYIYEKLEKEAKDVLEEYEKQAREKGADKVRQVIEFGNPKTLLAHDIPEK
FT                   EKVDLIMVGATGLNTFERFLIGSSSEYILRHAKVDLLIVRDPNKTM"
FT   regulatory      151773..151795
FT                   /gene="gbs1721"
FT                   /regulatory_class="terminator"
FT   CDS             complement(151801..153183)
FT                   /transl_table=11
FT                   /gene="gbs1722"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="GOA:Q8E3N5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR017223"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N5"
FT                   /protein_id="CAD47381.1"
FT                   /translation="MAIKAVFFDIDGTLLNDRKNVQKSTIKAIRNLKDQGILVGLATGR
FT                   GPSFVQPFLENLGLDFAVTYNGQYIYSRSEIIYTNQLSKTTVYRLIRYAGARRREISLG
FT                   TASGLLGSGIIGLGTSRLGQIVSSLVPRKWAKAIERSFKHFIRRIKPQNIDSLMIILRE
FT                   PIYQVVLVATEGESERIQKQFPRVKLTRSSPYSMDVISEEQSKVKGIERVGQRYGFDLS
FT                   EVIAFGDSDNDIEMLSQVGIGVAMGNASQQVKENARYTTADNNDDGISKALAHYGLIQF
FT                   EIEKTFSSRDENFNKVKSFHLLMDGETIETPRLYDSKEAGFRSDFKVEEIVEFLYAASQ
FT                   GNQKVFDQSIRNLHLAIDKARDKVISKDHPETPLVGEVDALTDLLYLTYGSFVLMGVDP
FT                   KPLFDTVHEANMGKIFPDGKAHFDPVTHKILKPDDWEEHFAPEPSIRRELDSQIQKSLN
FT                   RK"
FT   regulatory      complement(153194..153199)
FT                   /gene="gbs1722"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      153236..153241
FT                   /gene="gbs1723"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             153252..154214
FT                   /transl_table=11
FT                   /gene="gbs1723"
FT                   /product="Unknown"
FT                   /note="Similar to L-asparaginase "
FT                   /db_xref="GOA:Q8E3N4"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N4"
FT                   /protein_id="CAD47382.1"
FT                   /translation="MKKILVLHTGGTISMNANEKGQVMSSADNPMKYVDLSLDDLDLTV
FT                   VDFLNLPSPQITPHHMLDIYHYLKQHASNFDGVVITHGTDTLEETAYFLDTMILPKIPI
FT                   IITGAMRSTNELGSDGVYNYLSALRVANSTKAADKGVLVVMNDEIHAAKYVTKTHTTNV
FT                   STFQTPTHGPLGIIMKQDLLFFKATEERVRFDLDKITGTVPIVKAYAGMGDSGIISFLN
FT                   SQNISGLVIEALGAGNMPPKAAQEIEELIEQGVPVVLVSRCFNGIAEPVYGYEGGGARL
FT                   QESGVMFVKELNAPKARLKLLIALNAGLTGQNLKDYIEG"
FT   regulatory      154222..154241
FT                   /gene="gbs1723"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(154222..154241)
FT                   /gene="gbs1724"
FT                   /regulatory_class="terminator"
FT   CDS             complement(154249..155127)
FT                   /transl_table=11
FT                   /gene="gbs1724"
FT                   /product="Unknown"
FT                   /note="Similar to shikimate 5-dehydrogenase"
FT                   /db_xref="GOA:Q8E3N3"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N3"
FT                   /protein_id="CAD47383.1"
FT                   /translation="MNSLNGETLLTGLIANPARHSLSPLMWNTSFQEKNMNYAYLTFEV
FT                   EEGKLTEAVRGVRALGIRGVNVSMPFKQSVIPLLDDLSPQAKLVGAVNTIVNQGGTGRL
FT                   VGHMTDGIGCFKALAAQGFSAKNKIVTIAGIGGSGKAVAVQAAMEGVAEIRLFNRNSSN
FT                   YDKVIDLSDKIKKQFQIKVVVDYLENKTAFKDAIRTSHFYIDATSLGMRPLDNYSLIND
FT                   PEILTPNLVVVDLVYKPKETALLRFVRQNGVKHAYNGLGMLIYQGAEAFQLITNQEMPI
FT                   SSVERVLQTEN"
FT   regulatory      complement(155135..155140)
FT                   /gene="gbs1724"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(155225..156139)
FT                   /transl_table=11
FT                   /gene="gbs1725"
FT                   /product="Unknown"
FT                   /note="Similar to oxidoreductase"
FT                   /db_xref="GOA:Q8E3N2"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N2"
FT                   /protein_id="CAD47384.1"
FT                   /translation="MLQNIGQTGIQATRIALGCMRMSDLEGKQAEEVVGTALDLGINFF
FT                   DHADIYGGGLSELRFRDAIKHLNVNRDKMIIQSKCGIREGYFDFSKEYILSSVDGILER
FT                   LGTEYLDFLILHRPDVLVEPEEVAEAFTKLRAEGKVKHFGVSNQNRFQMELLQSYLDEP
FT                   LAVNQLQLSPAHTPMFDAGLNVNMLNKASIEHDDGIVDYCRLKRVTIQAWSPFQIDLSR
FT                   GLFVNHPDYKELNETIAKLAKNYNVSSEAIVIAWILRHPAQIQAIVGSMNPSRLKAIDK
FT                   ANDIALTREEWYDIYRSAGNILP"
FT   CDS             complement(156430..158445)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /product="Unknown"
FT                   /note="Similar to ATP-dependent DNA helicase RecG"
FT                   /db_xref="GOA:Q8E3N1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N1"
FT                   /protein_id="CAD47385.1"
FT                   /translation="MLLQSPISNLKGFGPKSAEKFQKLDIYTVEDLLLYYPFRYEDFKS
FT                   KSVFDLVDGEKAVITGLVVTPANVQYYGFKRNRLSFKLRQGEAVLNVSFFNQPYLADKI
FT                   ELGQEVAVFGKWDATKSAITGMKVLAQVEDDMQPVYRVAQGISQSTLIKAIKSAFEISA
FT                   HLELKENLPATLLEKYRLMGRSQACLAMHFPKDITEYKQALRRIKFEELFYFQMNLQVL
FT                   KSENKSETNGLPILYSKHAMETKISSLPFILTNAQKRSLDEILSDMSSGAHMNRLLQGD
FT                   VGSGKTVIAGLSMYAAYTAGFQSALMVPTEILAEQHYISLQELFPDLSIAILTSGMKAA
FT                   VKRTVLAAIANGSVDMIVGTHALIQDSVQYHKLGLVITDEQHRFGVKQRRIFREKGENP
FT                   DVLMMTATPIPRTLAITAFGEMDVSIIDELPAGRKPIITRWVKHEQLGTVLEWVKGELQ
FT                   KDAQVYVISPLIEESEALDLKNAVALHAELSTYFEGIAKVALVHGRMKNDEKDAIMQDF
FT                   KDKKSHILVSTTVIEVGVNVPNATIMIIMDADRFGLSQLHQLRGRVGRGYKQSYAVLVA
FT                   NPKTDSGKKRMTIMTETTDGFVLAESDLKMRGSGEIFGTRQSGIPEFQVADIVEDYPIL
FT                   EEARRVASDIVKDNNWKENTEWALILDNLRQHSDFD"
FT   regulatory      complement(158454..158459)
FT                   /gene="recG"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(158494..158510)
FT                   /gene="gbs1727"
FT                   /regulatory_class="terminator"
FT   CDS             complement(158525..160063)
FT                   /transl_table=11
FT                   /gene="gbs1727"
FT                   /product="Unknown"
FT                   /note="Similar to immunogenic secreted protein "
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3N0"
FT                   /protein_id="CAD47386.1"
FT                   /translation="MSKQKVMATLLLSTLVLSLSSPLVTLAETINPETSLTMATASTES
FT                   SSEAEKQEKTQPTDSETASPSAEGSISTEKTEIGTTETSSSNESSSSSSHQSSSNEDAK
FT                   TSDSASTASTPSTNTTNSSQADSKPGQSTKTELKPEPTLPLVEPKITPAPSQIESVQTN
FT                   QNASVPALSFDDNLLSTPISPVTATPFYVEHWSGQDAYSHYLLSHRYGIKAEQLDGYLK
FT                   SLGIQYDSNRINGAKLLQWEKDSGLDVRAIVAIAVLESSLGTQGVAKMPGANMFGYGAF
FT                   DHDSSHASAYNDEEAIMLLTKNTIIKNNNSSFEIQDLKAQKLSSGQLNTVTEGGVYYTD
FT                   NSGTGKRRAQIMEDLDRWIDQHGGTPEIPAALKALSTASLADLPSGFSLSTAVNTASYI
FT                   ASTYPWGECTWYVFNRAKELGYTFDPFMGNGGDWQHKAGFETTHSPKVGYAVSFSPGQA
FT                   GADGTYGHVAIVEEVKKDGSVLISESNAMGRGIVSYRTFSSAQAAQLTYVIGHK"
FT   regulatory      complement(160074..160079)
FT                   /gene="gbs1727"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(160156..161256)
FT                   /transl_table=11
FT                   /gene="gbs1728"
FT                   /product="unknown"
FT                   /note="similar to alanine racemase "
FT                   /db_xref="GOA:Q8E3M9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3M9"
FT                   /protein_id="CAD47387.1"
FT                   /translation="MISSYHRPTRALIDLEAIANNVKSVQEHIPSDKKTFAVVKANAYG
FT                   HGAVEVSKYIESIVDGFCVSNLDEAIELRQAGIVKMILVLGVVMPEQVILAKNENITLT
FT                   VASLEWLRLCQTSAVDLSGLEVHIKVDSGMGRIGVRQLDEGNKLISELGESGASVKGIF
FT                   THFATADEADNCKFNQQLTFFKDFISGLDNCPDLVHASNSATSLWHSETIFNAVRLGVV
FT                   MYGLNPSGTDLDLPYPINPALSLESELVHVKQLHDGSQVGYGATYQVTGDEFVGTVPIG
FT                   YADGWTRDMQGFSVIVNGELCEIIGRVSMDQMTIRLPQKYTIGTKVTLIGQQGSCNITT
FT                   TDVAQKRQTINYEVLCLLSDRIPRYY"
FT   CDS             complement(161253..161612)
FT                   /transl_table=11
FT                   /gene="gbs1729"
FT                   /product="unknown"
FT                   /note="similar to holo-acyl-carrier protein synthase"
FT                   /db_xref="GOA:P63471"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63471"
FT                   /protein_id="CAD47388.1"
FT                   /translation="MIVGHGIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPK
FT                   RQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISH
FT                   SGNYAQASVILEEEK"
FT   regulatory      complement(161264..161269)
FT                   /gene="gbs1728"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(161618..161623)
FT                   /gene="gbs1729"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(161637..162644)
FT                   /transl_table=11
FT                   /gene="gbs1730"
FT                   /product="unknown"
FT                   /note="similar to 2-dehydro-3-deoxyphosphoheptonate
FT                   aldolase "
FT                   /db_xref="GOA:Q8E3M7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3M7"
FT                   /protein_id="CAD47389.1"
FT                   /translation="MGFHQLSDKINIEILKQKTSLDLEVSQKKLAKEEELKNIIKGEDQ
FT                   RFLVIVGPCSADNPKAVLTYAKRLAKLEAAFKDKMFLVMRVYTAKPRTNGDGYKGLVHH
FT                   SDKLGVFFQARKMHYDIIRETGLLTADELLYPEMLSVMDDLVSYYAIGARSVEDQGHRF
FT                   ISSGIDAPVGMKNPTSGNLRVMLNAVYAAQNQQELFYQNKQVRTDGNLLSHVILRGYHN
FT                   ADYRSIPNYHYENLLETITHYEETDLQNPFIVVDTNHDNSGKQFLEQIRIVKSVLADRQ
FT                   WHTKIRNYVRGFLIESYLEDGRQDKPDVFGKSITDPCLGWDKTEMLIRDIYNSL"
FT   regulatory      complement(162652..162657)
FT                   /gene="gbs1730"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(162770..165298)
FT                   /transl_table=11
FT                   /gene="gbs1731"
FT                   /product="Unknown"
FT                   /note="Similar to preprotein translocase SecA subunit"
FT                   /db_xref="GOA:Q8E3M6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8E3M6"
FT                   /protein_id="CAD47390.1"
FT                   /translation="MANILRTVIENDKGELKKLDKIAKKVDSYADHMAALSDEALQAKT
FT                   PEFKERYQNGETLDQLLPEAFAVVREASKRVLGLYPYHVQIMGGIVLHHGDIPEMRTGE
FT                   GKTLTATMPVYLNAISGLGVHVITVNEYLSTRDATEMGEVYSWLGLSVGINLAAKSPFE
FT                   KREAYNCDITYSTNAEVGFDYLRDNMVVRQEDMVQRPLNYALVDEVDSVLIDEARTPLI
FT                   VSGPVSSEMNQLYTRADMFVKTLNSDDYIIDVPTKTIGLSDTGIDKAENYFHLNNLYDL
FT                   ENVALTHYIDNALRANYIMLLNIDYVVSEEQEILIVDQFTGRTMEGRRFSDGLHQAIEA
FT                   KESVPIQEESKTSASITYQNMFRMYHKLAGMTGTGKTEEEEFREIYNMRVIPIPTNRPV
FT                   QRIDHSDLLYPTLDSKFRAVVADVKERYEQGQPVLVGTVAVETSDLISRKLVAAGVPHE
FT                   VLNAKNHFKEAQIIMNAGQRGAVTIATNMAGRGTDIKLGEGVRELGGLCVIGTERHESR
FT                   RIDNQLRGRSGRQGDPGESQFYLSLEDDLMRRFGTDRIKVVLERMNLAEDDTVIKSKML
FT                   TRQVESAQRRVEGNNYDTRKQVLQYDDVMREQREIIYANRREVITAERDLGPELKGMIK
FT                   RTIKRAVDAHSRSDKNTAAEAIVNFARSALLDEEAITVSELRGLKEAEIKELLYERALA
FT                   VYEQQIAKLKDPEAIIEFQKVLILMVVDNQWTEHIDALDQLRNSVGLRGYAQNNPIVEY
FT                   QSEGFRMFQDMIGSIEFDVTRTLMKAQIHEQERERASQHATTTAEQNISAQHVPMNNES
FT                   PEYQGIKRNDKCPCGSGMKFKNCHGLRCLQ"
FT   regulatory      complement(165303..165308)
FT                   /gene="gbs1731"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(165407..166354)
FT                   /transl_table=11
FT                   /gene="gbs1732"
FT                   /product="Unknown"
FT                   /note="Similar to mannose-6-phosphate isomerase"
FT                   /db_xref="GOA:Q8E3M5"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3M5"
FT                   /protein_id="CAD47391.1"
FT                   /translation="MSEPLFLEASMHDKIWGGTKLRDEFGYDIPSETTGEYWAISAHPN
FT                   GVSRVKNGRFKGCFLDKLYQGEKSLFGNPDDTVFPLLTKILDANDWLSVQVHPDDAYAL
FT                   KHEGELGKTECWYIISADEGSEIIYGHNAKTKEELRQMIESGDWEHLLTRIPVKSGDFY
FT                   YVPSGTMHAIGKGILILETQQSSDTTYRVYDFDRPDASGKLRDLHIEQSIDVLTIGKPA
FT                   NTVPANMKLKHLSSTLLVSNDFFTVYKWEISGVTNFKQFAPYLLVSVLDGAGHITVDNK
FT                   VYTLKKGDHFILPNDVVKWDIDGQLEIIASHVKK"
FT   regulatory      complement(166360..166365)
FT                   /gene="gbs1732"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(166472..167353)
FT                   /transl_table=11
FT                   /gene="gbs1733"
FT                   /product="Unknown"
FT                   /note="Similar to fructokinase"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3M4"
FT                   /protein_id="CAD47392.1"
FT                   /translation="MTKLYGSIEAGGTKFVCAVGDEELKVVEKIQFPTTTPQETIKKTV
FT                   DFFKRFEKKLEAVAIGSFGPIDIDKKSKTYGYITTTPKLHWANVNLLGLISKDFNVPFY
FT                   FTTDVNSSAYGEVIARNNIDSLVYYTIGTGIGAGAIQKGEFIGGTGHTEAGHTYMAMHP
FT                   QDQANDFKGICPFHNSCLEGLASGPTLEARTGIRGELIEENSMVWDVQAYYIAQAAIQA
FT                   TVLYRPQVIVFGGGVMAQKHMLRRVRQTFATLLNGYLPVPNLSDYIVTPAVEENGSATL
FT                   GNFALAKKISKG"
FT   regulatory      complement(167358..167363)
FT                   /gene="gbs1733"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(167391..167412)
FT                   /gene="gbs1734"
FT                   /regulatory_class="terminator"
FT   CDS             complement(167421..169340)
FT                   /transl_table=11
FT                   /gene="gbs1734"
FT                   /product="Unknown"
FT                   /note="Similar to sucrose-specific PTS enzyme IIABC"
FT                   /db_xref="GOA:Q8E3M3"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3M3"
FT                   /protein_id="CAD47393.1"
FT                   /translation="MASNTEIAKQVINAIGGASNVRSVAHCATRLRVMVKDETVIDKNT
FT                   VENIEKVQGAFFNSGQYQIIFGTGTVNKIYDEVVAQGLPTSSTSDQKAEAAKQGNAFQR
FT                   AIRTFGDVFVPLLPAIVATGLFMGIRGAINNDTVLALFGTTSKAFSSSNFYTYTVVLTD
FT                   TAFAFFPALISWSAFRVFGGNPVIGLVLGLMMVNSALPNAWAVASGDAHPIKFFGFIPV
FT                   VGYQNSVLPAFFVGLLGAKLEKWLHKKIPDVLDLLLVPFLTFTVMSILALFVIGPIFHS
FT                   VENYVLAGTKFVLNLPLGLSGLILGGVHQIIVVTGVHHIFNLLEAQLIAADGKDPFNAI
FT                   ITAAMTAQAGATLAVGVKTKNKKLKALAFPAALSAGLGITEPAIFGVNLRFGKPFIMGL
FT                   IAGAAGGWLASILKLAGTGFGITIIPGTLLYLNGQIVKYLIMVIGTTALAFVLTYMFGY
FT                   EDKDEKVVAEVSPLVEETDDNPTITQTSQLRAETIVSPLDGQVIALDTVSDPVFSSGIM
FT                   GDGLAIKPSGNTIYSPVDGFVQIVFETGHAYGIKSDKGAEILIHIGIDTVTMNGTGFTS
FT                   KVKADQKVKKGDILGTFDSAKIAEAGLDNTAMIIVTNTADFADVIPLVKEGVVTTGDMI
FT                   IDVK"
FT   regulatory      complement(169348..169353)
FT                   /gene="gbs1734"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      169514..169519
FT                   /gene="gbs1735"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             169525..170964
FT                   /transl_table=11
FT                   /gene="gbs1735"
FT                   /product="Unknown"
FT                   /note="Similar to sucrose-6-phosphate hydrolase"
FT                   /db_xref="GOA:Q8E3M2"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3M2"
FT                   /protein_id="CAD47394.1"
FT                   /translation="MNLPTEIRYRPYDEWTEEDKENIVKNVSKSPWRATYHLEAKTGLL
FT                   NDPNGFSYFNGKFHLFYQNWPFGAAHGLKQWVHTESDDLVHFKETGIKLKPDHVNDSHG
FT                   AYSGSALAIDDKLFLFYTGNVRDMKWNRDPRQIGAWMTSDGKITKFDKVLISQPNDVTE
FT                   HFRDPQIFNYDNQFYAVIGAQNSKKCGFIKLYKALNNDIHHWEFVGDLDFGGTGSEYMI
FT                   ECPNIIFVKGKPVLLYSPQGLDKNELDYQNIYPNTYKIGQYFDANSSKIVEPSPIYNLD
FT                   YGFEAYATQGFNTSDGRAFIVSWIGLPDIDYPSDQFDYQGAMSLVKELSIKNGNLYQYP
FT                   VPAMKNLRQHQAEFKTQLQTNNTYELELLVPRNDLSSFVLFANPKGQGLSITIDTAKGK
FT                   VIVDRSQAGQQYATEFGTSRQCNIPKDATSVNVFIDKSIFEIFINKGEKVFTGRVFPDA
FT                   EQSGIQLKEGHVHGKYFELKY"
FT   CDS             170966..171928
FT                   /transl_table=11
FT                   /gene="gbs1736"
FT                   /product="Unknown"
FT                   /note="Similar to transcriptional regulator (LacI family)"
FT                   /db_xref="GOA:Q8E3M1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3M1"
FT                   /protein_id="CAD47395.1"
FT                   /translation="MVAKLTDVAALAGVSPTTVSRVINKKGYLSQKTVTKVNEAMRTLG
FT                   YKPNNLARSLQGKSAKLIGLIFPNIRNIFYAELIEHLEIELFKHGYKTILCNSEKDPIK
FT                   EKEYLEMLGANQVDGIISSSHNLGIDDYEKVEAPIVAFDRNLAPHIPIVSSDNFFGGKM
FT                   AAQTLKKHGCQKMIMITGNDNSDSPTGLRRLGFSYESKESKVITVTNGLSNMRREMELK
FT                   SIISTHKPDGIFTSDDLTALLVIKLISQLGLSIPEDIKVIGYDGTSFIQDYVPHLTTIK
FT                   QPIREIAQLMVEILLAKIEGQKTNKDYILPVSLIPGSSV"
FT   regulatory      171990..172011
FT                   /gene="gbs1736"
FT                   /regulatory_class="terminator"
FT   regulatory      complement(171990..172011)
FT                   /gene="gbs1737"
FT                   /regulatory_class="terminator"
FT   CDS             complement(172015..172449)
FT                   /transl_table=11
FT                   /gene="gbs1737"
FT                   /product="Unknown"
FT                   /note="Similar to transcription termination protein NusB"
FT                   /db_xref="GOA:P65580"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65580"
FT                   /protein_id="CAD47396.1"
FT                   /translation="MTSVFKDSRRDLRERAFQTLFSLETGGEFIDAAHFAYGYDKTVSE
FT                   DKVLEVPIFLLNLVNGVVDHKDELDTLISSHLKSGWSLERLTLVDKSLLRLGLYEIKYF
FT                   DETPDRVALNEIIEIAKKYSDETSAKFVNGLLSQFITNEN"
FT   CDS             complement(172442..172831)
FT                   /transl_table=11
FT                   /gene="gbs1738"
FT                   /product="Unknown"
FT                   /note="Similar to unknown proteins"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q8E3L9"
FT                   /protein_id="CAD47397.1"
FT                   /translation="MTTENLGEIVISPRVLEVITGIAATKVDGVHSLRNKAVTDSLSKK
FT                   SLGRGVYLKNEEDDTVAADIYVYLQYGVNVPAVSIAIQQAVKTAVYDMAEVKISSVNIH
FT                   VEGIVPEKTPKPDLKSLFDEDFLDD"
FT   regulatory      complement(172459..172464)
FT                   /gene="gbs1737"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(172836..172841)
FT                   /gene="gbs1738"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS             complement(172920..173480)
FT                   /transl_table=11
FT                   /gene="gbs1739"
FT                   /product="Unknown"
FT                   /note="Similar to translation elongation factor EF-P"
FT                   /db_xref="GOA:P64040"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64040"
FT                   /protein_id="CAD47398.1"
FT                   /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRDV
FT                   RTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNNETYDQYEIPTVNIENELL
FT                   YILENSEVKIQFYGTEVIGVQIPTTVELTVAETQPSIKGATVTGSGKPATMETGLVVNV
FT                   PDFIEAGQKLVINTAEGTYVSRA"
FT   regulatory      complement(173490..173495)
FT                   /gene="gbs1739"
FT                   /regulatory_class="ribosome_binding_site"
XX
SQ   Sequence 174050 BP; 55636 A; 34452 C; 26660 G; 57302 T; 0 other;
     tgaatctgtt gcaacagaaa aacaatccct actactagaa taatagcacc tctaactaat        60
     aaatgactca ttccaacatt aacatctttt aacatcatgt tcctttcatt attttttatt       120
     taggaattcg tcatactata ttttctcata tttatctaac aaaaaactcg taattctata       180
     taaatcatat aaagttacga actttattta gttaacaata aaataataac attttattca       240
     ttaaaaaaac gaataacaaa agagccaaaa agctctttta aactgacaaa aatgtcttag       300
     taatgattag tctctcaatc ttattactta gagtaaatca agcaaaaatg ctagaaaata       360
     aaaaatatat gacaaactat tccaaacaat atgctcgcca atcgaataat gaatggattt       420
     tgtatagtgg tgcaaactag cgaaaatcaa acccatacca aaatagacaa caaagtcgac       480
     gacagataga ccatgtaagt gagaccagct aaatagtata gaagataaga tcacaaccaa       540
     gggaccactc agggagttcc caaatgttct catgacaaac aacctgaacg ttatctcttc       600
     ttaaattggg gcaataagac agatagtcaa taataagaca actcgaaagt agtgattgac       660
     ctgattcata tcagctatta atccctcctg gttttgcctt attgggaaaa atgtttttac       720
     tagtagtgcc cagcaaaata aaacgctaaa agcacctatt gcaaatagcc attttttgag       780
     gttagatgat gactcttggt agttactgat tggctcagtt tttgttagca cataactcaa       840
     cagaatcatc attataagat taatgccaat ccatatactc caactccact ctaaccctat       900
     tgatagtaaa ctaatcaccc aatgcccaag caattgttat tattgtgttg ttgcaacttt       960
     ggcaaagatg aatatagcag gatggaaaac agattttttc tgaaacttca aaggtatctt      1020
     cttatcacaa gctattattt ggttatctcc ataattaatc taaatggagc aatatatcgt      1080
     ttttctacta actgttgaca aataaaaaac tcccctttaa agtctggtaa cttttcgatt      1140
     tttaccaaaa acttaaggag agtgaggcaa gaactaatag aatcttattt aaagttttat      1200
     gattgggaga acagaacaac tatcataatt actgaaaaat tatgaaaggc atggcaaaca      1260
     acagatggtc aaatccgctc tgttgaaaac aaattttaaa tataattcat ttcactttct      1320
     aagtttatta aacatagagt gttcaggaga aatgatacga cctaatgata aaatcattcc      1380
     tatcgtataa taaacaacga caaggtgtaa ataaaagtaa attaatatat ctgatatact      1440
     tgtcaaacat cctttcatta taataaaagc aactaagata ggaataagaa tagtacactt      1500
     aataaataac caaaattgct taacaacttg ataccatgtg agtacttctg tcgtttgtct      1560
     ttgtttgaag acaaaaacca atagatcaaa gagaaaactc caacagataa gtagtatatt      1620
     tttcattaat gataaatcgt agaaactacc tatactaaat agaatcactg cagaaataat      1680
     aacaatgcct aaaaatctta atatattatg catatcctca cctcctctac tttataggta      1740
     gcaaatataa tcttgagtca tgtgctctcc tttatttaag aaggggccaa caagcatgtt      1800
     tggctccctt taattaattt gtgaatataa tctcaaaatt atgactagtt ggttttatcc      1860
     tcgtgaattg ctttttctgt gcgaatcaag tctcacggtg aacttatcta actcttcccc      1920
     actaacttgc ggatctcaaa ataaactcat taatactctt tttcattata gccaaaatca      1980
     gctaaatcaa gctttttatc acgccagttt ttcttgactt ttacccaagt ctctaggtaa      2040
     actttatcac ctaacataag ttcaatatca cggcgcgcca tttttcctat tttcttgagc      2100
     atagcacctt gttttccaat gataatgcct ttttgactat cacgttcaac catgatagtt      2160
     gcacgaatat gcactttatc agtttcttca tcacgtttca tggattcgac aacaacagct      2220
     actgagtgag gaacctcttg ttgcgttaaa tgaagtacct tctcacgaac catttctgat      2280
     actaaaaatc gttccggatg atcagtaatc tgatcttctg ggaaatattg gaaaccttct      2340
     tcaagattat cagtcaataa cttgattagg gttggcacat tatttccttg aagggcagaa      2400
     attggcacta cttctttaaa atccatttga ctacggaagt catcaatctg ttccaaaagt      2460
     tggtctggat gaaccttatc aattttgttg attactaaaa taacaggaat cttggcagcc      2520
     ttaagacgtt caataatcat atcatcgcct ttgcctcgct tttcatcggc aggaaccatg      2580
     aaaagaactg tttcaacttc acgtaaagta ctataagcag attcaaccat aaaatcacca      2640
     agggcggtct ttggtttatg aattcctggg gtatcaatga aaacaatttg ctcagtttct      2700
     gttgtataaa tccccataat tttattacgt gttgtttgag ctttatcact catgatagca      2760
     attttttgtc ccataacatg gtttaggaag gttgattttc caacatttgg acgacctaaa      2820
     attgctacaa atcctgactt aaatgtcatt tcttttcttt ctccattcaa tttattcgta      2880
     atacttctca tcataaaagt aaagcaagta tcttgggtat aaaaataatc aatcccacca      2940
     atacggcaaa taaggaaaca actaaaaccg ctcctgctgc catatcttta gcatttttag      3000
     ccagcatcga gaaatggtaa ttacttgcca aatcaactac attttcaata gctgaattga      3060
     taatttcaaa agtaattacc aaaaaaatac tcaataaaag aaataaccac tccaccatag      3120
     atacttgaaa agtaagacca gcaagtatta ctaaaatggc agaaaccaaa tgcttacgca      3180
     tatttctttc ttctttaaaa gctgtaaaaa tccctgtaac agcaaattcc atgcttgatg      3240
     ttaaggtgcg atttttccat tttttttgat tattgtcgtt taagtccata agcagttaaa      3300
     atttcttcct gtaagctgaa catctctttt tcttcttcgg gtgtataatg atcataaccg      3360
     ttaatatgca aaaaaccatg tacagctaaa aaacccattt cacgttcata agagtgaccg      3420
     tactcttctg cttgttcttt agctttatca atagaaataa aaagttcacc aatataagaa      3480
     tcaaaatctt ctagcatctc agcaagttca ggattttcag ccagatcttc ttcatcaaaa      3540
     gaaatatcaa cctcaggctt atattctaaa ctgataacat cagtcggacg atcggtatct      3600
     cgatactcta aattcaattc atggctacgt tcattagtga caaacgttac agccatttct      3660
     ttattctctt tacctgtttt ttgtgctgca aactctaaca aatcaagagt ttgctttttg      3720
     atatcttctg aaacttgtcc agtttcatca atcatttcaa cgtacatctt atatagtaag      3780
     aacgacccaa aacgtttaga aaagataaag tgtaatgcat aattctaaat aatcgacaca      3840
     tctactttcc taagtttttc acttttatct aaaactagtt ctcaaaataa aagtgcgttc      3900
     tcttccttcc ttcaagctat tctttcacat cattatacca taagagtatt aaaaaaggga      3960
     gagaaagcta ataatcacta ttacacactt ataatccatt tcaataaaat tctgacttat      4020
     gaattagtat ttacttcaaa atacaaactt tagagcgcct aacttacgta aaactaattc      4080
     ctaaataaac aaagctacaa atgctataac gattatgaca aatttacatt tagaatgtct      4140
     ctttatataa atagattttt gttacttttt ctcagatgct ttatattcgt acacacctaa      4200
     acaattatta aatttacgaa ttgttggaag taaagagcga agtgtgccta actcaaattt      4260
     gctcatctca tctgtaaagt taatcagatt tatttgcttt aatttagggt ctaaatccac      4320
     aatctcatga ccatctgtga taccaaactg aaattctgta tccatatact ttactgtatc      4380
     atgttgcttt cctttattaa tcatttcctt atgacacaaa tcaaattgtg ccataaattg      4440
     gctaaatgaa tttgtcagga tatgaagaaa agtctctacg tcatcttctt ttagaaacat      4500
     taaaacacct tctgacacga ttagaaaagg ggcattttgg ggatttacct cccgtgtcca      4560
     agtttcatct atggctgatt ttgctatatt agtaactctt tcatgctctt caaaaaataa      4620
     ttttcttatc tccataacct ctggcaaatc aaggttatac cacctaattt gtccattatc      4680
     gactctttca aaccttgtat caagtccaca accaattgaa aggatttgac tatttggatt      4740
     ttctctaata aattttttga tttctctatc cataacgcga attctagcta atgttgcata      4800
     aaaagaagct tctgaattat cgaatttatc aaaatcatat tctatctgtt caacaattgc      4860
     taaggatttt tgatcattaa gtatcggatg tttagccatc gcatctttag ccctaatata      4920
     taaggtgatt aataacgttt cagcaacgcc gtgtaatgtt atcttcattc atctactctc      4980
     ctttatgcta ttttacttag aaatttggat ttctaaaact ggatttcttt aagtatatca      5040
     ttccaatacc gtaagtaaag catatcccca ccatccaata ttccataatt ttctttttct      5100
     gtacttctta tgctttctaa aaaaacagtc actaaattat tgcaagctac tgtttttctt      5160
     tttaataatt ataaaatata caaatgagaa ctccttattt tcttaacatt tgtttctaca      5220
     agaatgccta acaacatatc aataaaagtt agaagttctt taaagtcaca cctagtattt      5280
     cccatccttt taacgcccca tttggaatgt ttgtgaaaaa tattcatcta aaattaattg      5340
     gtgttgttca tttacgatcg taatattttt gacgtcttct ttagaaaaat agtccaattg      5400
     caatgtttcc tcattatgaa aaccttctat attaactggt tttggacagc ttacttcata      5460
     aataaaaccg acggtttgtg ctttatcgcc attgggataa gagtcttgaa agttagtata      5520
     aacatttaac agtctgattg gttccactct caatccagtt tcttcgaaaa attctctttt      5580
     caatgtatct actgatgact cacctaactc catacatcca ccaataattc cccaagaatt      5640
     cttatcagct cttaattgga gtaagacacg tcccttacca tctgtcaaaa taccaccaga      5700
     atatgttaaa aagatagtct catgtccaac ttttgaccta atgtaggaaa tataatcttg      5760
     tttcattcta tcaccttgtt taaactaata tgtacgtatt gtagcataaa atatctcctt      5820
     ttcaaatcac tcatatacac ttcttgaata ttagaaccgt tacctctttt attaacttac      5880
     tattaattat tgactaaaaa gagatagccc tgtagaatgg agacacatca atattttaca      5940
     tttttaggag agcatttatg gaccatttca caaaactctg gcaagatttc tctaaacttc      6000
     caaatgttgt tgctatagca ctcggaggct cacgctctgg tgacagtttt gaccaatctt      6060
     ccgattatga tttgtatgtt tattgtgcag caactcctga tatcactagt cgtaaacgta      6120
     tccttaacaa gcactgtcat tacattgaac ttaacaatca ttactgggag cttgaagata      6180
     atggtacttt aaacgacgga actgatattg atattctcta tcgtaacata gataactttt      6240
     tatcagactt agaagatgtc gttgaacacc acaattctcg aattggatac actacttgtt      6300
     tttggcataa cctcatcaat tgccaaatac tctatgatcc tgaaaatcaa ttacaatcac      6360
     tcaaagagag attcgaagtt tcttatccca gtcagttaca aaaacaaatt atcattcaaa      6420
     atcgtaactt attaactggc aagcttccct cttacgataa acaaattata aaagccctta      6480
     aacgccaaga ctttgttagt actcaccata gaactactgc tttcttagat tcctactttg      6540
     atattatttt tgcacttaat aagttgacac atcctggcga aaaaagaatg atttcctatg      6600
     ctaagaagaa tgctacattg cttcctaaac atttcgaaga aaatatcatt aaactatgtc      6660
     atcacaactc caacgaacac actgttaaag aaacattaaa cgatataata atgcatctcg      6720
     acgtcatgct taaagaaaat tttcaacact ttataggtta agttgaagta caccatcata      6780
     aaaacgccta aagcattagg cgttttttac atattgacac actctctaac aacgtctcct      6840
     agtggcaaac atcagtcctt atcagattgt agcttgtgac tactttctga atctgaataa      6900
     gcatttatta tttcagcaac gacagggtgt cttacaacat cctttgctga taaatgaata      6960
     aagtcaatct ttttgatatt tcgtaatttc tcaacagcat caatcaaacc agatttaaca      7020
     ttctttggta agtcaatttg gctaacatcg ccatttacaa tcattttaga attgaagcca      7080
     agacgtgtta ggaacatttt catttgcatt atagtggtgt tttgcgcttc atctaatatg      7140
     acaaatgcat catctaaagt acgaccacgc atgtaagcca atggagcaat ttcgatgatt      7200
     tcacgctcca ttaagcgact tgtttgctct ttacctaaaa tttgatatag ggcatcataa      7260
     actggtctca aataaggatc aactttctct ttgagatctc caggcaagaa accaaggctt      7320
     tcaccagctt caaccgctgg tctcgttaag attattcgtt taacttgacc acgctttagt      7380
     gccgttactg ctagagtgac tgctaaaaaa gtttttcccg ttccagcagg cccaatacca      7440
     aaaacaacat catgattttt aacgctatca acgtatattt tttgccctaa agtcttaaca      7500
     cggataggct taccatagct atccttaata atttcttcct cataaagggc aacgaattta      7560
     tcaattgaac cattttgtgc catggataag gctgttacaa catctgaagt attcacagtc      7620
     atcccgcggt taacaagcac taataatgct tcaatggtta accgagcggt ttctactgct      7680
     tcttcagagt cacctaatac ctgaacacgt tcagttctag catgaatgat aacatctaaa      7740
     ttttcttcaa ttaattttaa atggcgctca ttgctgccaa agagtgacat catatcatct      7800
     ggatgttgta aagtaatttc gatagagtat tcttgcaaat tattcttcct tttcgtacag      7860
     taagtgacta cattataaca aaatttcatt ttctttggtg attttagtcg ttgtaaaact      7920
     aaaaaatcga gaaaaacaag ttttctcgat tttattttac attataaaag atgagcttct      7980
     cgaagtaatt cttctaaata agttcctcta atttttttca tgcctacttt acgcattaag      8040
     gcaggtattg gtaaatccat atcttcaaca gatttcttat cattgagata gtataaagat      8100
     tgcaacaaga cacgaatatc aaatgctgaa ttaaagactt ctggaacacc acgttcaata      8160
     tttaagaaag tataaacagc ttccatagca gttctaatag aatattccgt tgtaaatact      8220
     gtatctctgg atggagattc tgcaaaatta ccaatgaagg ctaggttaac agaaccttgc      8280
     gggataacat ctggtcggtc acctttaact cgaggcatga aataactagt aatgtaaggc      8340
     atataaacag gaactgtact tacatattgt ttatcagata aatcatgaat cttcatttca      8400
     ggaacaccta agtgatacaa ccactcttct gtgatttctc gaccagtaca ttcttcaatt      8460
     ggttttttaa tataattacc ttccacattt gaatagagtc cataaatcca aacaattgtt      8520
     tcattttcct tttgctcttt gaaatgcggt tggcgatgga tagcaaagct catcatccaa      8580
     ttagaatctg taactgtaac aatgcctcct gtatttactt taccatcatg gaggtcacga      8640
     tgtgttaaac gctctatata aggttcgata gctggatctt ttattgttgc agtagcagaa      8700
     acaaaccatg actcttttgg aatatctttg tagaagactt taggatgtcc aaattcatca      8760
     gattgagcag ctaagttttc ccaaagattc caagaacctc ccaaatcggt attaggttta      8820
     gctacagtat catgactacc atagttcgta ctttcagtga tagatccatt cgttacaaaa      8880
     acaaaatcat ctggagtaag atcaattgtt tttgcttcac cgccaactgt gagatgaata      8940
     gcttttgcaa gcttctgacc gttcttaaag tctacggaga tattagttac cttgctatca      9000
     aattgaacat ctacattatg agactccaaa taactaatga ttggtttcac catagaatca      9060
     tattgattat atttattaaa ttttaatgaa gtgaaatcag gcagaccacc aatatgatgg      9120
     ataaagcgca tagcatatcg acgcatttca atcgctgaat gccatttctc aaaggcaaac      9180
     atagtagccc aataagtcca aaaattactt tcaaaaaatt cttttgaaaa gacttcttca      9240
     atcgttttag cacctaaaga ctcttcagtc tccatgacta gcttaactaa ctctttggaa      9300
     tgtgttccga gtgtaaaatc cccatcagat tctaagcgat ttccctgttt atgaatgagg      9360
     cgacagttag atgaattggg atcatccttg tcaagccaat aaaattcatc tagataagaa      9420
     gcatctggaa cttcgagaga ggggatggaa cggtacatat cccacataca ttcgaagtga      9480
     ttttccattt cacgaccacc acgcgttaca aaaccgatat caggtcgttt gacaccgtca      9540
     agtgatcctc cagaaagagg tagttcttca aaaatatgaa tacgttgacc atccatttga      9600
     ccatcacgta ttaaaaagac agcggcagct aatcctgcta aaccagaacc aacaatataa      9660
     gcggattttt tatccacacc ttcaggtttt cgaggtcttg caaaggcttc aaaatttcca      9720
     tttgtatatc tcataaacaa cctccctagg gctatatttt agatgactat attctactcc      9780
     tttgtgaaaa cgattgccat taaaaaacct gcttttcaga cagtcttaga caatgtgtcc      9840
     aatttctata acctaaaaaa agagattgaa aatacaatct ctatattatt gttaatgatt      9900
     gagataatct tcccaaatat catcaaaatc tgttaaatta aaggaaaaac tggcctcatc      9960
     ttctaaataa cgactaactg tttcaaaatc cgaactatgt tttggaaaag tggtttcatc     10020
     aaaagcgtaa tctgctagga ttgctactgg ttcatttgat tttggatttc tttgtgtcat     10080
     caaccaactg taaaatgatt ttctcaatgc cagttctcct ctagaaatgc atgtcttctg     10140
     gcactactca aggcgtaacg agcagggtta gtccgataga atgcttgatg atagtcttct     10200
     gctgggtaaa aagtatcagc aggctcaatg ctggttacaa ttggtctatc aaatctaccc     10260
     gaagcttgta gcttatcttt tgatttttga gcaatctgac gttgctcttc attctcataa     10320
     aagatgacag gacgataatt atccccacga tcttcaaact gaccaaaagc gtctgttgga     10380
     tctgtttgtg cccaatataa ctcaactaaa tttgcataag agattttttc aggattaaaa     10440
     ataatttcaa cagcttctgt atgtccagta gttttactac aaacttcttt ataagttgga     10500
     ttctcaacat gtcctccagt gtatccagat aaaacagatt caataccatc taattcttca     10560
     aatggttgta ccatacacca aaaacaacct ccagcaaaaa tcgcacgttc catatcgttc     10620
     tccattcttt ttaatagata cattataaca aaaaaagcca aaatttcctc tcagcttttt     10680
     tctataatta gccattaatt ctagctataa ctaaaacgac ctcgtgagaa aactttaaaa     10740
     gttcaaaagt ttataataat tctgtaccta gctgatcttg tttgatcttt ttagctttca     10800
     tgagtcctcc aagtgctttt ttaaactgac ctttggaaat tccaaaagta gctttaattt     10860
     cctctggaga agatttatca tttaaagtca tgaatcctcc gttactttct aaatacgtta     10920
     aaatcatttg tgcgtcattt tctaacattt caaaagaacg aggctttaat gataaattta     10980
     aggttctatc aacttctctg aagccaataa ctcgtgcatc cagcacttgc cctaaacgag     11040
     gttcactgta acgttcacta gggtgaataa agccgagcat attattttct ggtagataaa     11100
     caaaagttcc tgacaatttt aagcgataaa cgattgctgg ccaattttga ttttgcatat     11160
     tgttatatgc aggggttgcc attcgttgaa acacttcagg atctgcaggg agagcccaga     11220
     gacgatcttt tttatcaaca tctaagcaaa cgtagaggcg atcacctttt ttaggccaaa     11280
     gttctttcaa ttcaggaaga acatccaaag aaacaaccac ttgcttatct ggaagaccag     11340
     tatcaagaaa tactcccaag tctttacgta cctcagtaac tgtcccccaa ccataatgat     11400
     ctcgagtcgc aaatgtttct ttagttgtaa gacgtgcttt ttgttgcata tctgtatagg     11460
     cgaatccttt aaccatttca ccaatgtgat gctctccttc tgactttgat aatgcaaagg     11520
     taaagccatc tttttggata aagtaaaaat ctttgttttc atcagttact aagcctgtta     11580
     tgactgtcgc taataatgta ttcatttttc tccttttaaa aaggtaaccg acaaaccaaa     11640
     tccatctggt tttgattcta tcagttacct ccataatcat tttattactt gccaatcata     11700
     ataaagatag caaacgttac tattaaactt ccaacaattc tttttcttta ttagcagtca     11760
     tctcatcaat atgttttaca gcatcatcag tagccttttg aatatctttt tcaagagatt     11820
     tcaagtcatc ttctgtaatt tctttattct tttcttgctt cttagcttca tccatagcat     11880
     cacggcgaat attacggata gcaatcttag cattttctcc gacttttttc acttctttag     11940
     ctaaatcacg acgtgtttct tctgtcaaag ctggaataac aagacgaata actgaaccat     12000
     catttgcagg attaatacct aaatctgatt cgttaatagc acgctcaata tctttgattg     12060
     atgatttatc aaatggtgaa attaaaagga cacgagcttc tggtacagta atagaggcta     12120
     attggttaag tggggttggc gctccataat actcaacttg aatacgatca agcaagctag     12180
     cattagcacg tcctgcacga atccctgcaa attctcttga taaactttgg tgtgattgct     12240
     caaaacgctc ttgagctttt gtaacgattt ccttagtcat attttttata cactcctatt     12300
     cagatgcttt gtttgaaaca gttgttccga tttgttctcc aagaacaaca cgcttaatat     12360
     taccagtctc attcatattg aaaacaacaa ggtcaatatc attatccatt gaaatagttg     12420
     atgcggttgc atccatgatt tttaaccctc gttttattac ttcaacgtga gttaattcat     12480
     caaatttgac agcattggca tctttctttg gatcagcatt ataaacacca tctactccat     12540
     ttttagccat taaaattgct tctgcctcaa tctcagcagc acgaagcgct gctgttgtat     12600
     cagttgagaa ataaggcgaa ccaatacccg ctccaaagac aacaatacga tccttctcta     12660
     gatgacgtaa agcacgacca cgtacgtaag gctcagcaac agtttgcatt ggaatagctg     12720
     tttgaactct agtatctacc ccatattgtt gaaggctatc agccattaca agagcattca     12780
     ttactgtccc taacatccct gtataatcag cttgaacacg atccatccct gcttctgctg     12840
     caggttctcc acgccaaagg ttacctccac caatgacaag tgctatttga acacctgaat     12900
     tgtgtacttc ggcaatttct tttgcaatag attgaacggt aggaatgtca ataccgacac     12960
     ccttatctcc cgccaatgct tcaccagata acttaattaa tatacgttga tatttaggtt     13020
     ccactactat gttctcctta ttttgtcttt attattttac cataaaaggc aaaattttaa     13080
     tagagcaatg acactagtaa gttgatttct ttatcaactc ctaaaataag aaaaacataa     13140
     taattcagag attggtcaaa cagttagtag aacacgctct cttcaagaat tcattatctt     13200
     ctactaaata accatttttt atcagaaaga cccggttaca gatagcttga caaattttag     13260
     ggtcatgaga aatcattata aaacttaatt cataacggcg ttttattttt tgtaataaat     13320
     gtagcatttt aatttgagtt actgggtcta atccacttaa ggattcatca aaaataataa     13380
     ttttaggctt taagagtaaa gctctagcga tacaaactct ctgtagctga ccaccactaa     13440
     gttgtctagc tttatatttt agataagttc catctaaacc caccgcttct aatatttggc     13500
     atagttcaaa agttgttttt tttccataaa aagcttcatt caaaatttcc tcaatactaa     13560
     aatatggatt gaccgaacta agcgcatctt gaaaaacaag gataatctgc gccctaccat     13620
     ctttaggtgt gtaatttttt ccttgaaaat gtatcgaacc acaagtagga ctatctagtc     13680
     ctataatgag tcgggcaagg ctacttttac cactgccact tttacccatt ataccaatta     13740
     tttctcctct cttaagatga aaatgacagt cctttaaaac ctcttgtcgt ccaaaggttt     13800
     ttccgacatg attacaaacc aacattaaga atatctcctt catactccat ttgcactgtc     13860
     agtgctttcg tatagttatg ttgaggattg cttaaaatag tttgggtttg tccctgttca     13920
     acaacttctc cctcacttat aactagtaat tgccccccca ggtctctagc taactgataa     13980
     tcatgcgtta cagtaatcaa ggtttttcca ttattttgca attcctgcaa aatagctgat     14040
     atagtagagc aattatgaca atcaaccgct gaggtcggct catctaatat gattacctga     14100
     ggatcaagag ataatatagt ggctaacata attctttgta gcattcctcc actaagctca     14160
     aaggggtatt tttttaacag ggatatcgca tcatctaaat ttaaacgttt catccattct     14220
     aacgctttag ataaggctac tctctttgaa catttctcat gactaaggat tgtttccaaa     14280
     atatgcgctt caattttttg aaaaggatta aacatagaca tgggattttg tactaaatag     14340
     gcaatatctc gtccccttaa tttctgccac tgctttacag ttagtttacc taaatcaact     14400
     cccttaaaaa atatgtttcc tctaactgtc ataccttgtg gaatatgacc aaccaataat     14460
     tttgccaaga gggttttccc tgaaccactc tcaccaataa tagttaacga ttctcccata     14520
     cctattttac aactaaaatc tcttagtaca gggacctctc ctatctgtaa tgacaatttc     14580
     cttatttcta actgttccat tgtcgtttcc aatctttttt atctatggca tcgcctaaag     14640
     tattaaagga aaatactgtt aaaaaaatcg caattccagg agataacatc atccaagtag     14700
     ctgtcctaaa atatcctcta gcatcgtgca acatcattcc ccattctgtg atattaggtt     14760
     gcacaccaat ccctaagaaa gaaaagccag aaatcattaa aataatattt cctatattca     14820
     taaggaccat aacgaggatt ggctgatata caaaaggaaa aatatgtttt cttaaaatat     14880
     gccagaccga aagtcccata atttgcgcat ttatcacata aggctctttt tttgcactct     14940
     taactaaatt ggtcattaat ttagcatagt aaacccattc cacaaagaca attgcaaaaa     15000
     ttaaattccc tagaccatga cctaagatcc ccacggttgc aagagagagc aaaaagctcg     15060
     gaaaagctaa aataatatta gctatccata aaaagaggtt ttctaacttt ccttgatacc     15120
     aaccaacaat aagacccaca aacataccaa tcgttaattc caataagcta ataataatag     15180
     ctaaaaacag tgaatatcta gcaccataaa gcaagcgaga taacacatct ctacccaatt     15240
     ggtcagttcc taacaaatga acattattgg gagccaataa tttttgtgat aaatctacgt     15300
     attgtggatc aaagctagat agaatagggg caaaaatggc actaatcact aacaatacca     15360
     gtaagctact cgaaaaataa attctttttg acattatttc tcccttgact ttcgtaaccg     15420
     aggatcaacc caattcataa gacactgtgt cataaaatta ttagctaaaa ataaggttcc     15480
     aaaaattagc atacaagctt gtattactgg aagatctgaa gtccttagac tggtcacaaa     15540
     taaacgtcct attccattcc atgaaaaaat ttcttcaaca ataattgatc ctgttaataa     15600
     gtaaacccaa gtcaagctaa gtgccgtcat tatcgcaggt aaggcatttc taaggaggtg     15660
     atgtgtgaca atataacgtt cttttactcc tcttaatcga gcattttcca catttaaact     15720
     tctattttct tgactaatag cttttcgaat aagggctata tattgaccta cggtagaaaa     15780
     acttaaggta atacttggca aaattaaact ttgtaaatcg ttacctcctg aaacaggcag     15840
     aagatttaat tttgccgaaa atagcagcat caacaagtaa gcaacccaaa aacttggcat     15900
     agacacacta gaaaaactca aaaatcgaat caagtaatca ctccgagaag attcatgtaa     15960
     gccagcccac acacctaacg gggtagaaat ggtaacaatt agcaagaagg cactcgtgcc     16020
     tagaaataaa gtagccaaaa accgttgtaa aaccaaatct aataccggca acctgagcac     16080
     ataagaatat ccaaaatctc ctgttaatgc tttttggaac cacagccagt actgcttcca     16140
     taatggctta tctaaaccta gatagtgctc tgcttctttt agtgcttctg gactaacact     16200
     tatttttgat aaacgaaggt aattttctgc tggattaact gttgatagtt tgataagaat     16260
     aaatgttaga agtgatatga aaaacaatgc caaaaaagct gacaatattt ttttgatgat     16320
     cgaactactt agatacattg tttttttcta tatagcgtaa tgggaatgaa ttttcttctg     16380
     gcgcaaaacg catggtttta aaatcaccct tcctataaac agaaatcacc gattgataag     16440
     ttaatgggat atatacagcc tcatcatgca ataattcaag aaccttctta tagtctctat     16500
     cgacattttc ttccttagga tctactagag ctgacttaat aagtctatcc atttcagttt     16560
     tagttgctag attttctaaa gctatatttt ctggatgtcc atgatctgcc ttggcagtta     16620
     atgccgacat ccaagcatga gggtcccatg gtgctcccca agaataggtt aacatcatat     16680
     caaaattacc ctttttagca ttagcccaat aatcatcttc ttccatagca ataagagaaa     16740
     cattaatacc gattttacgc cattctcctt ggaaataagt taccaggtct ttatcagttg     16800
     ccttagtggc gatataagga agacgtaagg ttagagcttt accatctttt tcacgaacct     16860
     tattttttcc catcttccaa ccagcttgat ccaatagctg atttgcttta tcaacattat     16920
     agctataagg atttaactta gcatctgagt gaggtgttga ttttgaaaaa atagtgtctg     16980
     ctggcttttc tgttcctcta aaagtgttct tagcaataga aaccttgtca atagcatgat     17040
     tcattgcctg acgaactttt ttatcttgga aaatagtttc cttagcattt agcaacaaaa     17100
     gtcttgttga cataggttga gaaatagctg tgacatattt cttgtccttc gtatattggg     17160
     caaaagtgtc taaaccaata atgccattcc catagatcaa atcaacgtca cctgattcaa     17220
     atgctaaagc acgcgtctga gcatcgggta taacttttac ggttacttct tttaattttg     17280
     gtttctttcc ccagtaattc tcattacgtt tgaaggtaat atattcattt tgctttttac     17340
     ttttcacaac ccattgaccc gttccaattg gtttttttac attcttctta gttgtatcat     17400
     cacctttagg gaaagcgcta tcagataaaa agcgaattgg tcgaatcata gagagatcat     17460
     ataaagtagc actataagct tgtttcagtt taatttcaaa agtactttga ttcaaggcac     17520
     gataattttc caattgattc gttaaattaa accaattatg attacctcta ttagacttcg     17580
     aaaaaatact atcaaaatta cgtttgacat tcgcagcatt aaagttactg ccatcagaat     17640
     atttagcatt tctcaattta aaagtgtagg tttttccatc ttgactaatg ctccagcttt     17700
     ccgctaaagc tggttcaatt ttcccattgt caccatatcg taccaacccc tcataaacca     17760
     tatcctggat aacaaactga tcagggttat agcgatgcgg attaacatca ccaaagtctt     17820
     ctccccaagc aagcgtaagt ttatcactgt ttagtttatg acttttgcta tcctgtgaat     17880
     ggcatgcagt cagagtcacc atcaataaac aagtaatgct caataatatg ttacgtctca     17940
     tttttaccaa ctttctttta agtttaatta attatttttt taagcaaact taattaaatc     18000
     attttagtaa tgtcttgtca agaatcttaa aataaaaaat ctacaacgat acaaaattta     18060
     cttattccct gcgaactcat tttaatagat tattgctaaa gaataatcat aatagtcaca     18120
     taccatatcg ccaatttcat ttttcctttt tctcatctat tacttaaaac acatcacaca     18180
     ttcattagtc tttaagaagg ttaatacata taaaaagcta tttttcaaaa gaaacacata     18240
     taatatcctt tgattattaa aatatatact taaccagtta agtatataga ataaataaaa     18300
     ctaggaagga attcctagtt tttttattga ttaaagtgag ttaggatcaa ctttgatacc     18360
     aacaccttgt gttgttgtaa ttgaaaggtt tgtgatgtaa gttccttttg cagtagctgg     18420
     tttagcttta acaataacat cattaaatgc tttgaagtta tcaactaatt tagcatcatc     18480
     aaatgaaact ttaccaataa gggcttggac gttacctgct ttatcagcac ggtaagtaat     18540
     tttaccacct ttagactctt caactgcttt agcaacgtcc atagttactg taccagtttt     18600
     aggatttggc atcaagttac gaggtccaag gacacgtcca agacgtccaa caagtgccat     18660
     catatctggt gttgcgataa caacatcaaa gtcaagccat ccaccttgga ttttagcaac     18720
     taagtcatct tcaccgacaa agtctgcacc tgctgcttta gcttcttcag ctttagcacc     18780
     acgagcaaaa acaagaacac gtgaagtttt accagtacct gctggtaaaa ccatagcacc     18840
     acggatttgt tggtcagctt ttttaacgtc aatgttaagg ttataagaaa cttcaacagt     18900
     tgcatcaaat ttagcaaagt tagtttcttt tgcaagagct acagcttctt ctacgctgta     18960
     tgctttagtg ctgtcaattt tctcaagagc agcacgtaag tttttacttt ttttagccat     19020
     tttaaaattc tccttgtaat gtggtcaatc gatttgattt aaaatctccc acgtcactca     19080
     tcaaactacg atgaagtctt gcgggttatg tgggtgtttc tgattagtca gtaacagtga     19140
     atcccataga acgagcagta ccttcgatca tacgcattgc agactcaagg tttgcagcgt     19200
     ttaaatctgg cattttagtt tcagcaattt cttgtacttg cgcacgagta actgttgcaa     19260
     ctttagtttt gttaggttca cctgatcctt tttcaacacc tgcagctttt ttcaaaagaa     19320
     cagcagctgg tggtgtttta gtgatgaaat caaatgattt gtcttcatat actgagataa     19380
     caactggaat aatcatacca gcttgatcag ctgtacgagc gttaaactct ttagtgaatc     19440
     ccatgatgtt gattcctgct tgaccaagtg ctggtccaac tggtggagct ggagttgctt     19500
     taccagcagg aatttgaagt tttacaagtt tttcaacttt tttagccatt tttaaaaatc     19560
     ctcctgttgt ggttttggcg gtaattagaa atttttacct cccacaggta tgtttataac     19620
     ataccttacc attatactat aatcataaat aaaagcaata gtttgaagcc attaatttca     19680
     ttatatttta aatttctttc ccaattcctt ttacattatt acaacaatac ttgagatttt     19740
     gaatctcaag tattgttatt tatttatcct caattttctt agggataaca aaaagaattg     19800
     ataagatcga tagactacaa aaaactaggt ttaaaattaa tccacacaaa gctgctttgt     19860
     gaaaatctgc attcccagaa aaagcatgat aaatcgcaat tgaagttgct acaccaattg     19920
     caccacctag tgaacttgcc attttgtaaa ttccagatgc agaacctact ttttcattag     19980
     gaatactaga aatagctgta tccgttgatg gtgtcgcata gatccccaag cctgtcccaa     20040
     ataaagcata accaacaaag actaacacaa gatacaaagg gccttgaata ttgaccaaag     20100
     tcattaaaaa tatcccaaca aatgtactca tagctcccaa aagcattggc ttacgggcac     20160
     caaagcgttg taaaattttc tcaccaactc gaatagcaat tagtacacaa accaaatagc     20220
     ctaaagacat ttcacctgca acctttggtg ttagctggcg accttgttgc atgtaagtat     20280
     taataacaat cagagttcct gcaactgcat tcagtaagaa atttgatatt gtcgcaccta     20340
     agtaaaatcg attttcaaac agatgaaagt caataaaact attagattta cgtgtttcaa     20400
     cataataaaa cagaacaaat ccaataagca tcactgtaaa aagactcaat ggaataacgt     20460
     tcatcaatcc atgttcttga gccatagata tcccaatatt taacgataac attgaaataa     20520
     taaaaataat taaaccaagg taatcaaagt gagttttttg tccaacattt ttactttctg     20580
     gggttcctaa aattaataga aaactaacta ctgatgcgat gattgaaaag ataaagacat     20640
     aacgccaacc tagagtactt gccaccgctc caccaaaata agaacataga cctgagccac     20700
     cccatgatcc gattgaccag aaactaactg cacgttgtct atctttacca tcatagtacg     20760
     ttttaaccaa ggccattgtt gatggcataa taaaagctgc tgccaatcct tgaaaaatac     20820
     gtcccataat aaatagcact gctccattag ctaaaacaat tagtagagaa ccaataatat     20880
     ttaagcaaag accaataaaa gtaaatttaa ctcgaccaag tttatctgct aaaccaccag     20940
     ttacaacaat aaataaacct gaaaacaatg ccgtacttga gacaccaata tccattgcac     21000
     cagatgaaat acctaatgat gactgaacat ctggtcccat gtttaaaata gactgtgcaa     21060
     ataaccaaaa tgatagtaca gcgagtacaa ttcccaccaa taatttgtta tttcctttga     21120
     aattttcctt tgtcgttaac atatgttatc tattctcctt cttcaagcat agcaagcgct     21180
     gcagttgcca ttgatttagc agataccatc aatgatgatt ctgcaatttg gaattttgga     21240
     tgatgatgtg ggtaatatgg ttgcccctct tcgtgtgctc caacatagaa gaagcaagct     21300
     gggattgttt gagcataata ggcaaaatct tcagacggcg tttgaggatc gcaatcaatg     21360
     acgtctaaaa tttcctttat agcaacagat tttaaactat ttgcaacttt ctgtgtcact     21420
     tcactgttat taactaaaac aggataatca ttctgatagt ctaactgata actaacacca     21480
     taagtttgtg ctattccatc tagaatacgc ttaaattcct cctcaacaac acctcgtgtc     21540
     tcttcagaca tcacgcgcac atcaccttct aaggttacac tatctttgat cacattagca     21600
     gaacctttac catcaaaaga tccgatagta actactgctg tgtcaaatgg attaactcga     21660
     cgactgacaa tcgtttgcgc tgctataaca aaactagaag ctgcaacaat tgtatcattt     21720
     gcacgatgtg gcatggaacc atgtccaccc ttaccttgca aaataacttt aaaagtggca     21780
     cgccctgttt gaatgggacc tgcgtgatat tgtaccgtcc cctcttccat cgttgacata     21840
     acatggatac caagaacagc atcaatgcca tctaaacatc ctgcttcaat cattgctttt     21900
     gctccgcccg gtggcacctc ttcagccggt tgatgtaaga tacggatatg acctgaaaat     21960
     tctgatttta attcaatcaa gctctcagcc aaaatcaata aataagctgt atgggcatca     22020
     tgtccacaag catgcatgac gcccgctgtt tttgaagcaa aagaaagccc tgtctcttcc     22080
     tgaattggaa gagcatcaaa gtcggctctc aaagcaatgt gtttgatggg cttatctgtc     22140
     gctttatcac catagatatc aactacgacg ccattcatac caccaaattg tgtctgaaca     22200
     tgacagtcct tacctttata aaaatctgaa atataagctg ctgtttttgt ctctttaaat     22260
     gataattcgg gattttcatg taaatagcga cgaatagcaa ccatttgatc acatttttgg     22320
     tcaagttttt caaataattg atgtcgcaaa gatgcattgg ccatttgctt tcctccttaa     22380
     aatatgaaca gttaaaataa ggctattatt ctaacaatct gctcttatat agtctacttt     22440
     tgaaaataat tttttacaaa taaatttttt tagatatttc tataactaaa tagttatgaa     22500
     tatatcatgt tatactacta aattaaaata gattgatttt agctcaaaat gatagtaaac     22560
     ttatagccat aacgtatcat aacttattat taatctaagg atatcaaact ggttataaag     22620
     tcttgaaaaa tcaacaaaaa ttaatgtatc tagagagtat cgaactatac tcaaacatca     22680
     ctaaagccgc tgcacacctt tttatttctc aaccttacct aagcaaagtg atcaagcaat     22740
     tagaaaatga gttaaaaata aaactcatcc agagccaagg gcaccaaacc tttttaactt     22800
     atgctggaca gagatatcta ttctacctaa aagaaattga tatgattgag cgtcaaatgg     22860
     ccaaagaact atatctcatc cgttctgata aaaaaggaga aatcacactt gggattaact     22920
     ctggcttagc aagttctatt ctggcaaatg tacttccaaa atttaacttg gagcacccag     22980
     aaatttctgt caaattactc gaaaacaatc aaaatatttc tgaacaattg gtagcgagtg     23040
     gtgatattga cctagctgtt gggatggctc ctatcgttta taaagatgga attgcatcaa     23100
     ccactattta ccgcgacgaa ttgtttttaa tgatacctac caccagccaa ctctacaacg     23160
     ctgaaaaacg tggacagatt attccttttg aatatcctat ttcagttcta gacaatgaac     23220
     ctcttatcct aacaccatta gagtacggaa ttggcaaaac aattgcacaa ttctatgagc     23280
     ttcatcacat gtcattaaat cagatgatta caactagtac cgttcctaca gcagctagcc     23340
     tatctttgtc agggatggga gcaacatttg ttccacaaac tctcattcat cgctatttgg     23400
     ataaagagtg caatgtctac cattttcata aaaataagtt attttcagag tacattatga     23460
     tttataaaaa agatgttgaa ttatctggaa ttgctctcct actttataaa gcttttttaa     23520
     ccaagtagtt tcgctaattc tattgaaaat cagtttacat cttaccaaaa tcggtataaa     23580
     atagacctat gatatacaaa attattgctt ctttatttct tgttttaatc cctatatttt     23640
     cacaggttct tgtcaaaata tttaaactta aaaaatttaa cattatgttt ccagatgttg     23700
     cttttcctat ttttgttttt ttaattccat taatatcatc tagtctgtta aaacaaaatc     23760
     ttttacctta ctatctgatt ctcatttcat tactggcaat cggaattaca ataaagcttc     23820
     tacgaacaaa gactcttttt tcttataaac gttttttaaa attattttgg agatctggct     23880
     ttattctaac tttccttttt tacctaggat tattggttat catctttatc aaagtacaat     23940
     aaaaagagtt ggataaattt ccagctcttt ttactttagg tttagaggat aaagccctct     24000
     aacagcatta caggcgtata cagcatcggc tgattctaaa tcttttaaag ttagtggtgc     24060
     ttcaattact ttttggtttt taaggagatg acgacgataa atcccattca accctccttc     24120
     tgataaatct ggggttaaaa accttccatt tttttctaaa acaatattcc caatacttgt     24180
     ttccaatagc aacccctcag gagatacaaa tatcttttca ttctgacctt caataatatg     24240
     tgggcgataa gaagttttaa aataagtaaa cggggataat ttaatagggt agtcttgtac     24300
     gaccacctct gccgttaaaa acttttttga taaattcact agttgtttta cctcaaacgt     24360
     taccttacca gttttatcaa gcattatttt caagcggtaa tccttctcat ctagctgatg     24420
     aaggtatttt ttcagttccc tttcgaattt acttttatca aaagaataag caaaataaga     24480
     cgctgattca actaatctct cgacatgttg ttgagagaaa agaagtttat tttcagtcac     24540
     tcttcctgta gttattaatt gaaattttgg attgacacgt gttaaaacag ctgatttttg     24600
     acgggtttct tcatattcag aatctgtctg gctctcccac gtaatacctc caccaacgcc     24660
     gtaataggct tgttgacctt tcatttgtac tgtgcgaata ggaacgttaa aaatagcttg     24720
     tccgtctggc atgcaaagtc ctatcgtccc acaataaata cctcttggcc gtttttccaa     24780
     ctcattaata atagccattg ttgatatctt aggagctcca gtgatagatc cacaaggata     24840
     tagagcttga aaaatagaca taagtgtcac ttctggcgat aaaactcctt caatagttga     24900
     tgtcatttgc cacacagttg catactgctc cacttgacat agttttttta ccttaactgt     24960
     tccaacatca cagatacggc ccatatcgtt tcttaataaa tcaacaatca tcatattttc     25020
     agaacgattt ttaggatcat ttgccaacca atctcgctcc gccacatctt cttgataagt     25080
     aggctttcta gcgcttgttc ccttcattgg tctagttgtt aagacttcat ccttcttctt     25140
     aaagaacaat tccgggctta cagataaaat ccttttatcg tcgtaggcaa tataagcatt     25200
     atatcctgct ccttgttcta ccattaggcg ttcataaaca ctaaagggat ccgagcataa     25260
     ttgttggcta agctctagtg tataatttac ttgataagta tttccttgtc taatttgtcc     25320
     tttaatatta gcaattgcct cttgatattc ttgctcagaa acattagcag tccaattatc     25380
     tgctaatcta acattttcat aacttaaagg aaaagcttcg ttctcacaat ctttatgtac     25440
     tgtaaaataa gctagatgtt ctccagccaa cttctgttga gaaactttaa aatgtgaatc     25500
     aaaagcagca gatgcttcat aagataaata accaacaaca taataatttt gagattgata     25560
     ataatcaact tcttttatca cttctaagac ttgttctaaa gtatcagcta ttaattcttt     25620
     tgtaggattt ttaaaacgat atctttttcc taattctttg aaatcaataa cagtctcaat     25680
     atgcattcgt aaccttcttc ttcatctatt tgcttcatta taacataaaa aactaatccg     25740
     acaatttctt gtcagattag ttttttctta ttcactcgga gttggagtca ttaaaacttt     25800
     tcgtggcttg gttccttctg ctggaccaat aacccccgct gcttctaatt cttccattag     25860
     tcttgttgct ctattgaaac caacagacaa tcggcgttga atcattgagg cacttgcttt     25920
     ttgcgtctct aaaacgagtc ccttggcttc ttcaaaaaga ggatcacttt caggtactcc     25980
     gccgccacca ccagagccgt tatctgtttc agatacttct ccaggatcaa aggcatcatc     26040
     atagtcagcc tcggcttggt ctttgataaa accaacgatc ctttcaacat catcatctga     26100
     aataaaggaa ccttgtagtc gtactggatg attctcatca ataggcttaa agagcatgtc     26160
     accccgtccc aagagctttt cagcaccatt ttcatcaagg atcgtacggc tatcagtacc     26220
     acttgaaaca gcaaatgcaa tacgcgacgg aacatttgct ttaatcaaac cagaaataac     26280
     atctacggat ggacgttgag ttgcaagaat catatggata cctgcagcac gtgctttttg     26340
     ccccaaacga ataatagcat cttcaacttc tttactagca accatcatca agtcagccaa     26400
     ttcatctaca atgacaacga ttaaaggcaa aggtatttgt ttttgctcag aggaagcatt     26460
     aaactcttca acctttgtat tataacctgc tatattacgc acaccaattt tgctaaataa     26520
     ctcgtatcga ttttccattt catcaacaac tttttggagt gccttacttg ctttacgcgg     26580
     attggttaca acagggatta ataaatgtgg aatatcatta taaacagata attcaaccat     26640
     tttgggatca atcatcataa acttaacttg atctggacgt gccttcatca aaatacttga     26700
     aataattcca ttaactgcca cagatttacc tgaaccagtt gaaccagcta ccaaaagatg     26760
     cggcattcta gctaagttaa aactgcgagc attgccgtta acagcttttc ctagtggtac     26820
     ttctaaaagg ttttcaggat tggcatcaga ttgttcccaa agttcgcgga aagaaaccgt     26880
     tgcaatttct gagttaggaa cttcaatacc tattaatgat tttccaggaa ttggtgcttc     26940
     tatacgaaca tcttttgccg caagagcaag agctaggtcg tcagatagat ttgaaatacg     27000
     attcacacga actccaactg ctggtttaat ttcatattta gtaactgatg gtccaatttc     27060
     agcacgttct acttttacat cgataccaaa acttctaaat gtttcttcta aaactctgat     27120
     attctttcgg actaaatcct tttctttgga ttgattttta ggcttatctg gtgcaaataa     27180
     atctatcgtt ggtaatttat aaaccagtgt cgttttaggt gtaaagtcga cattttctat     27240
     atcactatca tctacatcat catctaaatc ataaaccatt tcctcatcat tttctctcat     27300
     attaggaatc ggcgaatcat agtcttctaa ataaattgtc ggctctactg gtaaaggatc     27360
     attttgaggc gatgtctcat aagcaaggat ctctggctca aataccggag ttgatgtttc     27420
     acttacctca ggtggtagcg catcatccaa attgtcctca gcttgatcct ctagaatctc     27480
     acccgtttca gggtctacat taaccgaagc taaataagct tcttcttcag ctttttgacg     27540
     ctctatgcgc tcttgttcag cgattgcttt tttcatctct cgcttagcaa aacgctcctt     27600
     tttattttgc tcgtgcttct ctgccacttt atttttaaaa gctctaataa attcgacgat     27660
     gtcataaact tccagagaac tcattaaaaa gagacccaaa atgatgaaga gaacaccaat     27720
     catataggca ccaatattag aaaagagaaa agcaattggc ttgtaaatca aagcacccaa     27780
     catacctcca ccggcaaaaa cagtgatttt aaattgcatt aaatcagaca caattaatcg     27840
     agcagttgaa cgcaaaattt ctttatcttt caaaataggc attgagaaaa ggtaagcatg     27900
     ccactcaatc aataatccta aagaagctat caaaaaacct gctactaagc tatctttctt     27960
     tcgcaaccat ttaaagaaat aaaggtagat taaagttgcc gcaataaata agtaagccaa     28020
     gctacctacc ataaaacgga tgacgttata gactgtaata ccaaaaatac ctaatctgat     28080
     aataccaaag aagagaataa ttgttaaaac aagagcagta atcatccttt gaatagctct     28140
     ttgacgctct atttctgcct tagtaggtct tctggttttc tttccttttg tttttttctt     28200
     atttgccata aataccatat ttcaagtgaa atacttgttc ctcactttct ctatcaactc     28260
     atgctatact attctatcat aatttcaaca agtcccccaa taggtttact atttactttt     28320
     ataaattatt taaaaattta tgataaaata taatcatctt aataacttaa tcaaggagta     28380
     tgtatgaaaa aaattattta tcttggttta gcctgtgtca gtatattaac tttaagtggt     28440
     tgcgagtcaa ttgagcgttc tctaaaagga gaccgttatg ttgaccaaaa actagctgaa     28500
     aactcttcaa aggaagctac tgaacaacta aacaaaaaaa ctaagcaagc cttaaaagct     28560
     gataaaaaag cttttcctca attggacaag gctgttgcca aaaacgaggc acaagtgctt     28620
     ataaaaacct ctaaaggtga tataaatatc aagttatttc caaaatatgc tcctttagct     28680
     gttgaaaatt ttctaacaca tgcaaaagaa ggatactata atgggttaag tttccacaga     28740
     gttatcaaag attttatgat acaatctggt gaccctaatg gagacgggac cggtggaaaa     28800
     tctatatgga atagcaaaga taaaaagaaa gattctggaa atggttttgt taatgaaata     28860
     tccccttacc tctacaatat caggggaagt ttagcaatgg caaatgctgg agctgatact     28920
     aatggcagcc aattctttat caatcaaagc cagcaagatc attccaaaca actgtcagat     28980
     aaaaaagttc ctaaggtgat tattaaagcc tattcagagg gaggaaatcc aagtttagat     29040
     ggtggttata ccgtctttgg acaagtaatc tctggcatgg aaactgtgga taaaattgct     29100
     tcggtagaag ttacaaaatc agatcaacca aaagaaaaaa ttactattac aagtatcaaa     29160
     gttattaaag actacaaatt taaataattc tatcaaaaat gagactagaa cattttctag     29220
     tctcattttt taacaacact attgtttctt tttaaacaaa ctttgtttag gagaaaatag     29280
     gaaagcaagt aaaaacataa aagtagatgt taaaacaata cttgatcctg cggcaatatt     29340
     aaatgtataa ccgatatata accccagaac agatgctact gctcctaatg cagatgataa     29400
     aaacaacatt gttctgagac ttttaacata aagatatgct gttgcagctg gtgtaattaa     29460
     aagtgctacg atcaatattg ttcccacact ctgcatagct gttactgcaa ctaatgttaa     29520
     caaaatcatc aataaataat gataaaaaga aactctcatt cccattgatt ttgctaaaac     29580
     aggatcaaaa gaagtcaata ataattcttt aaagaagata gtaatcagag tcagtacaat     29640
     taatcccaca ataatagtca tatatttatc actatcttgt actgccaaaa tattcccaaa     29700
     aagaatatga aagaggtcag ttgtactatt agcaagtcca attaaaatga tacctaaggc     29760
     taaaaaggac gaaaaagtaa ttccaatagc agtatctcct tttatgacac tattttcttt     29820
     aatataagta atgataatcg aagacaacaa accaaagaca atagcaccta taaaaaagtt     29880
     aatccctaaa ataaaagata tagcaacacc tggtagaaca gcgtgagaaa tagcatcacc     29940
     catcaaagac attgagcgca agataataaa acagcctact gcacccgcta caataccaat     30000
     cacaattgca gttataaaag cattttgcaa aaaatgataa gtcaataagc cttcaaaaaa     30060
     tttcgtaaac attctagtct ccttgtccta acaaaatagc atcaccgtaa gcagcactta     30120
     aattctcacg ggtaaatgcc tgatctattg gtccacaagc aattagatga cggttcaaaa     30180
     taattacttg atcaaaataa tgatcaactt tactcaaatc gtgatggacg actaaaatta     30240
     attttccggc cttacttaat ttttttagta aattaactat gatttgttca ctaatggaat     30300
     caatccctac aaacggctca tctaaaaaaa tgtaatccgc ttcttgaacg agacatcttg     30360
     ccataagcat acgttgaaat tgtccacctg ataaggcatt aattggtcta ttttcaaacc     30420
     ctctcaaacc aacttgatca atcactcggg atactttttc ccagtcagtt tttgatagtc     30480
     gcttgaagag gcctcgttcc ttatataatc ctaaagaaac gcattctcca acagttatag     30540
     ggaattggta atcaatatta gttttttgtt caacatatgc tactctcccc attaaaggta     30600
     gcaaatctcc cccaatccct gattctccag tagaatcaac caaaccaaga agagctttca     30660
     taagcgtaga tttccccgcc ccattaggcc ctaaaatacc aatgattccg gagccttcta     30720
     agcgtaaatt aatatcttct agcactaaat tattatcata acttacgctt aagtgtttac     30780
     taataatcat ttttcctcca aaagtagaat ggagctggtt ataaaaccag actccacttc     30840
     tctgtattta ttaaggctaa gtcagttttt agattaggat ttcgacattg ttacaactca     30900
     gccttaagcg agaatactac atcattgatt tcattatgat ttcaatgtcg attctcactc     30960
     ttattttgct aaaccttctg caatcttatc aagattccat ttcatcatag cgtagtagct     31020
     gtcacccttt tgaccttttt tagcaattga gtctgtgaag atttctgcgt aaattgggat     31080
     acctgattct cttgaaacag atttcatagg acgcttgtca acacttgatt caacgaataa     31140
     agctgaaggt cttacttgtt ttaatttctt aactaagcta gtaatttgat ctggtgtacc     31200
     ttcttcttca gtgttaattt cccagatgta tgctgatgga actccataag cttttgagaa     31260
     atatttaaag caaccttcac tagtaacaat taatttttta ttagctggaa tggcattaaa     31320
     tttagatttt gcttctttat ccaatttttc taatttagct acataagcat ctctgttttt     31380
     ctcataagta gctttgtttt ttggatcttt agcaattaat tgcttagcaa tattttttga     31440
     gtaaataata ccattttcaa ggttcaacca agcatgtggg tcttctttac cttttccgct     31500
     ttgaccattt agataaataa catcaactcc atcgctaacc gcaaagtaat ctttgttatc     31560
     tttcttctta gcgttcttta ttaattttgt aaaccaagca ttaccgcctg tttcaagatt     31620
     aattccgttg taaaaaacaa ggtctgcttg agttgttttt tcaacgtctg ctggtaatgg     31680
     ctcatattca tgaggatctt taccaacagg tacaatacta tgtaagtcga ttttgttacc     31740
     ggctatattt tttgttatat ctgccaaaat agagttggtt acaactactt ttaatttttc     31800
     gtttttggct tgatcctgct tgttagcaca ggcacctaag cctaaaaatg ctacaaaaca     31860
     tgatacaata actaaccact ttttcatcaa aatgctcctt ttaaaattaa tataagttat     31920
     gtattaaatt aagttaactt aattttgata ttagcataac ctattataaa gtatttgtca     31980
     aatacttttt cagtattttt tgatataatg gtcttagaaa aatagatttt aagaagtata     32040
     agaaagactg aatatgactc caaataaagc agattaccta aaatgcattc atgaattagg     32100
     tgaaaaaaac aacaaaattt ccaataagaa aatcgctgaa atgatgcaag tctcggctcc     32160
     tgccgtgtca gaaatgatta aaaaaatgat aagtgaacaa ctgattgtta aagataaaga     32220
     tttaggatat tatcttacca aacaaggttt attagttgtt tctgaccttt accgtaaaca     32280
     tcgtctagta gaggtatttt tagttaacca tttgcactat actgctgatg atattcatga     32340
     agaagcggaa gttttagaac atactgtatc aacaactttt gttgatcaat tagaaaagtt     32400
     gttagacttt ccacaatttt gtccacacgg tgggactatt cctaaaaagg gagagttttt     32460
     agtagaaatt aaccaaatga cattggacca aattagtcag cttggcacat atgttatcag     32520
     tcgtgttcat gatgattttc agctactgaa atacctagaa caacaccgtt tgcatatcaa     32580
     cgataccatt gaattgacac aaattgaccc ttatgcaaaa acttatcaca tcacctataa     32640
     cgatgaaaat ctaacaatcc ctgagcgtat cgcaagtcaa atatatgtat ctgctacata     32700
     aataaaaaag tccgtgtatt cattagatac acgggctttt ttataatgct ttcaaaaatg     32760
     ccattaatac ttgggcagag cgtttaccag cttcaatgat aaattcatca aatgtgatat     32820
     tggcatcatg agctgcagta tcactcatag cacgtaccac cacaaagggc tttcctgtag     32880
     cttgagcagc ttgggcaatt gctgcacctt ccatctcgac agctaaaacc tgtggaaaat     32940
     gccccttaat aacatcaatc ttttcctggc cagcaataaa actatcccca gttgcaatta     33000
     aaccaacttt actagtcatt tcttctttag ataaaactgc ttcaaaagtg gaaacaaaag     33060
     tcttatccga atgaaaataa agtggctgca ttgacatttg tccatagtca taaccaaagg     33120
     cggttaaatc tacatcgtga taaactaatg tatctgcgac aacgacgtct cctacattca     33180
     atcctgttgc tactgcacca gctgatcctg tattaataat agcatcaact ttaaagcttt     33240
     ctactaaaat agcaacactc atcgctgaca tgactttccc aacaccagac tgtactaaaa     33300
     caagctcatg ttcaccataa cgtccactgt aatatacatt tgataatact gtctcttgag     33360
     atttatcctc aagattttcc acaaggagtt ttaactcttc ctccatggct gcaataattc     33420
     caattttcat gatatttcct tataatttaa aaattgcata aaacaagaga gccaacaaaa     33480
     taagcaaaat gaataaaact aaattcaact tacgttgaaa ttcatttcgt tttgcattct     33540
     caatccggcg actcttgtag atatgtttac cgttctcgtc agttagttgc tccatgccat     33600
     cttctgtaga aataatttta gtttcttgat ctaagattgt ttgacctgaa actttttcac     33660
     ctcgatttga acgttcaatc atatcatctg ttaacaatgg ttttcccatt aagaatgacc     33720
     tcccattttt aaaccgtaat attgtaaagc aatgatcgtt ttcgcatctt gaatcatgcc     33780
     tttttctacc atttgcatac aatcctcata acttaactct agaagctcaa ggacctcatc     33840
     atcatcttgt ggcctaggat tttcaacttt ttgtaaatca gtagctagat agaggacgat     33900
     tttctcatta caaaaaccaa tagcagtgta gaaactataa agaatttcaa gattccctgt     33960
     gtagccagtc tcttcttcta attcccgaag ggcagcttct tccttagaac ctgactcacc     34020
     cgtctcaagt ttccctgctg gaatttcgta agaaatacct tcaatagcct tacgatactg     34080
     tttcactaaa acaattttat gctcaggagt taccgccaaa gtagcaacag ctcctccatg     34140
     aaaaacaagt tcacgtttgg attgtcccaa tccatttggc aactctacat catcaacagc     34200
     tactttgata atttgtccat caaaaacagt ttgacgatta attgtttttt cttcaaaatc     34260
     cataagaacc tcccaaataa gtgttacttt tgtgaaggat gatgtggttt tttattggca     34320
     tatccttctt tattgacttg acgtcctctt ccaatagcta tgctatcaat tggaacatta     34380
     tctgtgatgg tagatccagc tgctgttaaa gcattatcac caatttcaag tggtgcaatc     34440
     agagtagaat tacttccgat aaagacatta cttccgattt ctgttttaaa tttattttgt     34500
     ccatcataat tgacagtaat cgtccctgcg ccaaagttaa catcacaacc tacctctgca     34560
     ttgccgatat aagttaaatg acctgccttc gtattctcac ctatttgaga accctttact     34620
     tcaacgaaat taccaatatg aacacctttt gcaagactgg ttcctggtct aatatgcgca     34680
     taagggccta cggttactcc atcagaaata atggattctt caaccatcga attagtgatg     34740
     gtaacatcat ttccgacttg agcatctact aaataactac cattggttaa taaagtacct     34800
     ttaccaatct tcgtctgtcc ttttaaagtc acattaggct caattacaga ttcttctcca     34860
     atctcaacat caatatcaat ataagcggaa tcaggattaa ccactgtgac cccattaacc     34920
     atatgttgac gtgcaattcg gtgacgcatc actttttcag cagttgcaag tgctacacga     34980
     tcattaactc ctagactttc gtcaaagtca cgaagtttat aggcacctac ctttttaccc     35040
     gcttctttga aaattccaat aacatcagtt agataatact ctccttgagc gttatttgta     35100
     ttaatgtctt taagtgcttc aaatagactt tgattatcaa aaacataagt tccagtatta     35160
     atctctttaa cctgctgctc aaagtcatta gcatcctttt gttctacaat tttagtaact     35220
     tcatcatctg aattacggat aatacgacca tatccaaatg gatttgcagc atcggctgtt     35280
     aagattgttg caacgttttt atgattgaca tgaaaaccaa ttaagttttt taaactttct     35340
     ccagtaatca ggggtgtatc acctgcaata actagtgtat gtccttttga tgtcgctaat     35400
     tcttcttccg ccatcattac agcatggcca gttcctagct gttctgtttg cattacaaac     35460
     tctgatttgt cacctaaaac atcacgtaca agctccgcct tatgtccaat aacagtaaca     35520
     attttacttg gctcaatagc ttgcacacta cggaaaacat gctcaagcat ggtaatacca     35580
     gatactttat gcataacttt tggtaaatca gatttcatgc gagttccctt acccgcagct     35640
     aaaataatgg cataatttga catattaatt cctctatctc tgaatataat tcaacctatt     35700
     atatcataat gccttcaact tatcactaat acccctttaa atccctatta caatagactt     35760
     tagctaaaat agcttacttc aattaggaat aaaatagcta ccttttggta gctattcaat     35820
     acatgaaatc cgttaatttt ttcttctctg tttgcaatca gtatttttat aaatctatca     35880
     ttgcaatgct cagatggtaa aaacgattag tttaactctg ttgaaatttg ccacatcaca     35940
     ccaaattggt ctactaagtt tgcgtaagca ggactccaga aagtttcttg taactctaac     36000
     tgaacttctt gtgcactctt ctttaatttt tcataaattt cacgcgcctc ctctacgcta     36060
     cccacaataa tagcggctgt aacattttta ccagcttgat acacgaaatc tggattttca     36120
     tccgagattt gaagacgaat gccatcaaaa ataagctgag cattaatgat taaatccttg     36180
     cggtcttcaa gacagttggg gtccatctct tcccatgtca tcatattcac taaatccgct     36240
     tgaaagacat ctttataaaa atcaaccgct tgtcgcccat ttccatttgt tacgatgtat     36300
     gtttctagtg ctttaaccat aagttctcct ttttatttta cttcacggat tgcaaagtaa     36360
     ttattgtcat tatcggaaaa attaaaaact ctcatactcc ccatatcaac aataggattt     36420
     gtcataacct catttgctgt taattcttga tatgtactgt caatatcagt agtttcaaat     36480
     aaaatagagg gagttgctaa atctagctca ggactcattt gagctataat tgctttgtca     36540
     tgtaagacga agctaacttc actatccaac ttcggtgcaa ctatataggt tacataatct     36600
     ccttgtgtct gtttttcaac acgctcaaaa cccaccttgt ttttccaaaa atctgctgat     36660
     gcttcaacat tgctaacgta gagcattacc tgtccaattg atgaaatcat tttattatct     36720
     cactttcggt tttattacta attagtataa catacagtat ttaaaataag taaaaaatga     36780
     ctcaaaagag tcatttactt atttcgttac catatctaga actttcatca ccgttctact     36840
     atgttctaaa gcttgagcag cacgcttaaa atctaaattg ctaataatac cttcaaaaat     36900
     aacaaattca tcgtgcatgc ggtgcctatc accatttaat tgataaacat gactttcttg     36960
     tccattcata gttaatgaaa ttttaggcat agtattagtt ggccctaaaa tcgctataga     37020
     ccccttatca ccttgaatag tagattttac ttctgcacta caatcttttg ctccaataca     37080
     gactgtttta aagtgcccat agtctaggac tagaactcct gaagtatcaa taccacgctc     37140
     tatatttggt aaatactgtg ctgttatagg ttctccaaaa agtccaatta ctaaatgtaa     37200
     attataaata ttaaggtctc tcaacgcacc tccacccatt tcaggattga aagctggtgc     37260
     tatttcccca cgtttaaagg catcataacg cgatgaatat tgggaataat tacattctac     37320
     aattttaata tctccaaggt tgcttaaatg ttcttttaca aggtcaaaat taggtaaata     37380
     ttgatttgta attgcttcga gtaatattag ttgcctagta ttggcaatag atacaagttc     37440
     ttctaattga cttgcttcta atgtaaatgg cttctcacaa atgacatgtt ttcctgccaa     37500
     gagtgcctcc ttagcatagt caaaatgcaa gtgattcggc agtccaatat agactgtgtc     37560
     aatctcctca ttgtccaaga cagccttata ttcactcgta gctagagaca tgttatattc     37620
     cttagctaga tctttagctg tctccaaact tctaactgtt gataagatag caactagatc     37680
     aataccttca attttctgca agacaggcaa aacttcctta acaatcatac ctgtccccaa     37740
     aaccgctaat ttcattcgtt aatctccttt gggtaaacca cttggaattc ctctaaaact     37800
     atcctagagt cctcactaaa cattaaacca aactcctcaa aataaggttt aaagaaatca     37860
     atgtgagctt ttctccacca ttctaaagtt ttatctcctt ctccttctcc ttctttaaaa     37920
     gcatggtctg cagagacatc tttaaaaggg acaatatcaa ctttagttat ttcaataata     37980
     cagatagctt catcattgct atccaaaata atatcatatg aaccaacttg tgtaaccctt     38040
     cctcatctaa ttcatataaa tcataggcag aggccgttgc agtttttgtc ccatctacaa     38100
     ctaactttgc cagaagatct ggttctgctc caaattgcca tgcgtctatc tcatcaccga     38160
     ttgaaggatt caaagattta aacttattcc ataattcttg tgccttcata ttacctccga     38220
     agcaattccc acaacaaact taactgcgtt actcattttt ctttgtcttt taaatccttc     38280
     tttaacatct aaaatataaa cagtttgacc aatccaaaca cgtaaataaa cagattttat     38340
     taaaatatca cctgatattc ctttaacttc ccgctcagta ccatcagatg cttcaaattc     38400
     cgtacgtaat aaccaagtat taccacaacc aaattcaatc tattttctca tttcaaactc     38460
     cagccaccat caattttgac aatttcacct tgcattgatc tcgcttttcc tgaagcaaga     38520
     aatccagtta attcagcaac ttcacttggt ttagtccaac gaccaattgg cgtctcacta     38580
     gctacccatt ctgctaatcc accaggttca aaatcactag cagtcatagc agtttgtaca     38640
     gcacctggcg ctataccaaa aatttgaata caatcttttg cgtaatccaa agccaattga     38700
     cgtgtgaatc ccgcaagggc atgtttagaa ctagtatatg cagctccacc gccacccgct     38760
     ataaaacttg ctattgagca catattgata ataatacctg acttcttttc caccatacgt     38820
     ctaagataat gacgtgttag cctaacagtc acgaaaaaat taatatcaaa taggtgttcc     38880
     agttcttcat cacttacttc tagaagtggc ttgtaggcat ctagaatacc tgcagtatta     38940
     cacaaaatat caacagtcgg taccattgtg aatagtgggg ataaatcaga ggataaatcc     39000
     aactttataa agttaaaatt accatttaag ttcggtttat ccgacttatc cacaccatat     39060
     acttgatacc cttgtttcaa aaaatattga gcctgtgcat aaccaattcc actagcacag     39120
     cccgtcacta aaacaacttt agtcattgac ctcgatccaa tcctctgcta aaacatcaca     39180
     tggtgttggt gcccacatgg aaaaaccttc accttcacca gtaacattaa taagaaaata     39240
     aggtgtagcc tgtagtactt tcccattaac ttcaagggta tcaaataact gaacataatt     39300
     ttcagcgccc ccccaacctg tacgtacata ttttttcttt gcttttaaac ctggtaaaat     39360
     ttcttcaaat gtcatattgt tctcctttat tgtctttaac cattgatata tcaaggttta     39420
     ttgcttattt aaaatcataa tttaaagttt cttcgccttt tagttcatct aaaggctact     39480
     attgttttca taggataaaa tagtttctgg tcatccatta ttagtaaata atatttcgtc     39540
     tttttcttgt tggtcaagaa cattattttt gttcttactc cttcaattcc cacaataaag     39600
     ttatctgctt gctccgtcaa caaaacaggt ccattttcca ctaattcata agaaatactt     39660
     agttgattta gcacagctat aactttttca aaatcattcg taattttctc cattcttcca     39720
     tagagttagc ataactattt gtagactaga gaacctaaaa ttgatacact gtttttcact     39780
     caaaaaattt taccttcata atcttcatta tacctataac aattttcttt tacaaatttg     39840
     ttccccttaa aggaaattgt ttttcaaaat aggatgttta tactattgta ttatcggatg     39900
     ctttatctcg ctagtgcaaa atcttctcat aacacatttc ttccttttca aaataagttt     39960
     ttgatttacc cttaaaagaa aaaccaaacc tatcgtaaaa tttccttgcg cgtgtatttt     40020
     ctgtaaatac ccaaagtatc actttattat aacctgcttg ttgtatctct gatagtacat     40080
     gattcatcat ttgagaccca taaccttttc cccaaccttc tttaagacta tgtatacaaa     40140
     tgagttctgc ataatcaagc ataccatctt ctctactttt atcccaccaa gccatacaat     40200
     gaggattgct atctacttcc aatatatacc ccttaccaac ctccttgtgt agtagctgtt     40260
     gatacattgt tatggcaggt tctatttccg tagttttttg aatgatatcc tcaggtagta     40320
     tcttaccaaa agcagctttc cagctctccg tttgaatata agctaaattg acttcatctc     40380
     ctaatcttgc tctcctgatt atgcaagcca taactaaaat cctttcaaaa attattatta     40440
     actgcctgat aactactcca attataccat tttcgtgata ttaattttta ttttgaacag     40500
     ttctggttct catttatcat tatatttcta aaattttaga tggttttaaa cattaacctc     40560
     agattaggcc aattattgat aatcactaaa agagcgtagc taattacgct cttttagtga     40620
     ttattttata tatatgaatc gctataactt ctaagtaaca cttgtttcaa aatccttcat     40680
     ttgtttctct ctcgtaatat gcccccaaac cattttttta tttttatagc caataacact     40740
     tgcaacctta acaaaagtta atacaggatg taggataaga tacctaaaaa cagcaatata     40800
     aaatacttta acaatatcta aaattcctat tactagttgc tgagaataaa tacggtgtaa     40860
     gaaagagctt aatgtaatta aaacacagta aaagatataa aggctcacca atgatataaa     40920
     gaatgggatg tttaattgat taaataataa ggacaaaaat ataatgacaa taccaaaaca     40980
     ttctataaaa ggggtcagta attcaaataa aatatagtaa atataagaaa ttgatcctac     41040
     agctccaaag cgataattgg caaaaatact tttatatttt tttaaacatt ggtacaagcc     41100
     aagatatcac cggcgtctct gtttacgtaa atcccctaaa ttcgttggtg cttgactcca     41160
     acaaacagca tctgtttcat aacaaatacg ataaggaata ttattattac gacagaagaa     41220
     atgtaatttc atcaccaact ccatatcttc tcctagagtc tgggtgtcat atcctcccac     41280
     cgctttaaca aggtctttct taaaaagacc gaaagccccc gaaataatta aattagctct     41340
     taaatagtct aaaaagattc gagctcctaa aaatgatgaa tcatactcaa gtgcttgtgc     41400
     acaaggaata attctccaag gcaaacgata agatgctact ttcccctgct caatcttaac     41460
     accttgggca acttggacga gccctcccac tgctataacc gtcggatcta cctgtatgga     41520
     tttgctaatt tgactcaaag aatctacctg caacatagaa tctgcatcta gacatagaaa     41580
     ataatcgtaa ttagcagcat tgatccccat atttaaggca tcccctttgc caccattttc     41640
     tttaacaatg agtgtcagtt taaccttacc aacctgtctc tgaaagacat ctttacaagt     41700
     ttgagtagca ataattgaat caatcgtatt cgagattttc attaatgcaa actcttcctt     41760
     gagaacatct gaagtattgt cactggaacc gtcatccaca acgataattt catacgcttc     41820
     ataatcaagg tgcaataacg aatcaatcga actcacaatg gttgttgatt cattataggc     41880
     tggtacaata attgaaattg gaattttttc tttatttcta gttaaacttt ttttgcgctc     41940
     atttttttca tagagatgaa cacctccaat gactaatgaa atcactaaaa agctggcata     42000
     ggcaatcaat aatactaaga aaatgacttg agataccttt aggaaggtaa aaaataatgc     42060
     catagaaaat cccctttatt tgatatttat atcctttttc cgaatacgaa gccaactaag     42120
     cttatctaat cgttgtctta agatatagtg aatgttaaaa acaataattg ctaagcaaat     42180
     caaaatgtaa aaatataaaa tattatgtac catatgttct ctctctttct ttagaccatt     42240
     ctttcttaat actataatag gagtctttta aaaaggtttt ggtatcgggt ctctcccaat     42300
     ttttcaaacg ataatctgcc atctttatca gtgtgttttc tttgctatta gcacctaatc     42360
     ctaaagcaat gctctcaatt tctaactcct tcacaccata atgtttaaag taatcatcgt     42420
     gaattttttg agatgatgga tcagaaaaat tcaacaactg ccacggaatt ctgacctcta     42480
     taaagtcctt tccaaacgaa atatctgttt gtgaatcaaa tgttttttgg tgcctatcag     42540
     ttgttcctgt tttgagaaga ccagtaggat gagttggtaa gaacctctct gttgctttta     42600
     ctttttccat gtcttcaaca atctttgtat ttctcaatac catatttatc tgctcaaaat     42660
     tactactgtt cttctttggt gggaaagcat aaaaatcttt accgttaagc tgtcgaagat     42720
     agttcgcttt taaggcatta tagcgctctt ggacaaataa ttcagacttg ccatttggat     42780
     caatagacaa tacaaagtca ctagatttag aaaatgtgac cttactacca ttcatttttc     42840
     tactaccaga ttttggtgta atatctattg gtaataatcg tttttctttt agtttttcag     42900
     gttttgtttt aatcgcaagg tagagatagc tttcatcact gctagcatat aagtcatctc     42960
     ctgttgcact agtcatcaga ggatgtttcc actctccttt gcctctttta ccatcaactt     43020
     gataatgatg ttttgcgttt ttaaagccta ataaaccata accttgatta aatacttgtg     43080
     catcccccca taggaattga ctatgtttat ttgtggcgaa agatgtattc cacgcccttg     43140
     cattccaatc gtcttgccat gcattgatag tcgctccaaa actaccggat gatataaaag     43200
     attcataatc ttctagtaaa cgctgacctt gttctttttc attaatcggc agaggacgtt     43260
     tatcaatttc tttttgggca atacctctcg ctgtcgaata gccataaccc gtgactagaa     43320
     cagggatttt gtgataagca tttagcagtt taacgtatcc ctgtgacaaa gaaagttctt     43380
     taatcttttg tctatcttct ttactgatat tctctttatc aaataataga taatccttgt     43440
     atcgaggatg gaaatcaata gctttatatg ctgcaaacat acctgcttta acatttgaat     43500
     tagcttgaat attttctaca tttagttgta cgtatttagg agcctgtgcc tcaaatggtt     43560
     ttcgataatg aaaagggtct gttgttggtg agtttgaaaa actaatcaaa tgttgccaac     43620
     catatttagc tgtctcataa tgtgtcaatt catccattac ttgagctagc atgacctcaa     43680
     atggattagc tgccacagaa gttttaaaat aacgtccttt atattgcgtt tttttctctt     43740
     gatgattagt ataagcgaca gtaccactat tccaatcatc ccctacgaca taaccaagta     43800
     cccaaggact aagatcataa tgataatgac ggctaccaaa atctgtattc catacttgct     43860
     tacgcccatg gagaatatcc acaacgcctt ttgcttctcg ttttaaatac cccctataat     43920
     tatcattaaa agctgttata gaagcattat tgcgataaga atctatacgt attccttgca     43980
     acaaatacag tggcctcttt gatgctttgt tgtggtgata taaggcatcg taaaatgcaa     44040
     cattcatcgg taccttgact cttacagtat ttgcccccat gttggaaatt aaatggaacc     44100
     attcacgata cgttttttga gtaataggaa aatcgttgtg atgataaccc gctaaggaag     44160
     actcaacgtc tactccttta acaacaaaag gtttattggt gggcttgtga agtacagtat     44220
     cacctttaac aacaaagtta gttcttgtat tttcttttaa taagcccttt ggtaaataca     44280
     aactaccatc aaagtaatac aaataataaa tagagctaaa caaaatagtt aaaagggcta     44340
     caatacttag atattttttc ataatgttct actccagtaa agtattagta tttttcgatg     44400
     gtgcactata ttgatacaag gtctcaatat ttctatccat ccatctgcca cgctttttga     44460
     taaaatcttt taattgttct actgatttgt gataacttgt cacattgcgt tcagtaggaa     44520
     tcaaataatt ccttggatca gtattcttta aatcaaagac atagccccat tttttataat     44580
     ttcgatcaat agctggacct aaaaaatgcc ttgtctcgtc tatgtaatta gataaatatt     44640
     ctgtcgctag aactcccttt cgtaattctt tatagcgatg aacaaccagg tctataaatg     44700
     ctttgtcctt aatgagcata ttgaaccacg gtgcatccgt caaggtaaaa tctgcctcat     44760
     caacacgtcc ttcaatttga ttatcaaaag cattattaaa atcccaaact actagttttg     44820
     ctctatcacg aagatcttta tatagatagg ttgaaaattt acccgcatcc acatttctaa     44880
     aaaattcatt gatgacaaaa taatttgcaa atgattctct atcaatatat ttaggatatt     44940
     gtgaaaaatc ataagaataa aggacttttt caatatgatt gatgtcctta ttaataaact     45000
     ctaattgttt tgatgtcaat ctttgtttac ctggatattt cacatcaaga gctgagatac     45060
     cagactggtg tgtataatgt acatagttat ctaacttttg ctttgcctta tgttcacgat     45120
     cccaagcaac gatataaggt gttttatgca actttttatc acttttttca atgggaactc     45180
     gttgctcacc ttgttcgata ttctcaactg ctagatatac tccctgatac tcaccattga     45240
     caaataactc acagtagcga acgtttgggg cataggacat aatctcacca gcaatattat     45300
     aactcagata atttcttaat aatgttctgt ctagaaaggg accatgcaat acccactccg     45360
     attctttagg cattcctgct aatcgatgct tcttttcctt taacttatta gtaacaaact     45420
     taactttcaa tgacttctta tcaaagtaac gagaggaatt tcctctatat gatattaacc     45480
     cttttgtcct aattctcggc ttttctgata aatgatgtga tctacttgga gaatcccgta     45540
     attcgatatc aacattaata ttatccctag ctttgacata ttttccgcct tcttttgtaa     45600
     caagaggaat aacttgttgc tttgtatcaa tgctgataat gggcaaatgg gttttaaatc     45660
     ctgttaaatc actcttcgca tctacctgct ttatacgatg atgatgtatt ctctcgatgt     45720
     gatgcttagg aatccaaaaa tagaaaaata agaatagaaa aagacctata agggttgtgc     45780
     cgtaaataac cttccctctc ataagtctac ccattgattt cgtcgctttg gctaacaatg     45840
     ttgaaataat caatatttcc caattggtac actttttcag ttaactgatt atctacatgg     45900
     agttgcttat cgtaatcttt tctagagatt tcgaaaatca tttcaatagt attagttgtt     45960
     gaatttttaa cacgctgaac agcttttccg tcaaaatatt ggaagaaaat tccttctaaa     46020
     tcaacttcta gtgttctatc gcacttcaca atcaataaca tacgattctc gtttttaaca     46080
     cgtcccataa cccataataa gataaagata acgctacttc ctaatgcagc taccacatag     46140
     tcaccgacac cacaacagat accaacaact atggtccaaa aaatataaac tgtatctctt     46200
     gaatctttta tggctgtcct aaaacgaaca actgacaagg caccgaccat acccaatgac     46260
     aaggctacat tattaccaat aacggtcatt actgttgcag tcaagaccgt caatgtcatt     46320
     aatgaaacat taaacttttt actataggca gttccactat gcgtataagc ataggaaaca     46380
     taaataacta cactcaataa agctgctaca agaatatgta aaatcatatc ttgaaaactt     46440
     aaatttccac tttgctctag actatttcgt aataggtctt tcattttttt gttatcctct     46500
     cacatttaat aataattaac gtatatactt tttcactaaa aacgataatg tttactaaca     46560
     gctcttccta aacaatactt actcgctgaa agttcacttc tatctaccga atctaagagt     46620
     tctttaatat aagacaataa aaatccatta tatttaactt ctaaaataac aagataagga     46680
     tctaataaat aattttgatt taaatcctct gagaaaatat cataactagc ctctgtacct     46740
     attatatggt ggtcaaaggt gattcggata ttgttttcct tagcaacaaa agcttttctt     46800
     tggtactcaa taaccgtttt aggttgataa agttgcgttg ttatccttga ataacactcc     46860
     gcagcaaatg tatccggata atttaataaa acactattgt taccattaat cagcgcttga     46920
     gcatctgtct tgcttaattt tagagagcgc tttttttgat tagcaccttg tttttgtttc     46980
     atttctaatt tcgcaaaatt gctttgacta ccataattgc gcaaacgaat ctttcttcgt     47040
     atctcaacac catcttcctt ttcttgccaa tcaacatctt ctaaagaatc aaagtatagc     47100
     gaacggatag tatagccgtc gtctgaacta tgcgaatcga gcgtcattac ttgggaaaat     47160
     ttcttagata aaagatagta atcttcaagt gatattaaat atttttttcc tgtctaagaa     47220
     cttcgttcat cactcaccta tgtttaatta aatattaatt tatatataaa tattaacaat     47280
     aaattaagca aaaataaata tatcagaaat tatacacctt gtcaacagga aaatatataa     47340
     tgtatatttt tttatacgaa ggcatttcaa actttatttt tatactataa atatgattgt     47400
     tacgctcatt taaacctaga agaaaaatgt atattttcaa tccacagctg ttataaaata     47460
     atttttaaaa agtgtttata tcttagttta atcacacctt actacaatct atatatcatt     47520
     taaaaaaatc tgatataaaa aaggctaaaa ctaagtttta acctttttga catatctata     47580
     aaattgaaat agtgctatcc ttcaaatttc tctaaatcaa atgcttggcc tttttgctta     47640
     tctgacagca ccaaagaaaa tactatacca atcaacattg gaactagcca ccccattgaa     47700
     atagtatgaa aggggaggaa tccaactaac tgagttaatg ttttttcttg ccattgtccc     47760
     gctagaacct caacaaacga cactaaagtg acaagaccaa ttgtcaaaga cattcccttt     47820
     tttgaaagcg gcaaccactt attaatcaaa ataattaaga caataacaat aacaatcgga     47880
     tacaataaag ttagcacagg aactgaaaaa gtaattacag catttaaacc aagattagca     47940
     attaaaaagc caatcaaagt aaaaacagta gcaaataatt tataattccc aaaacgaaag     48000
     ttcttatcaa aaaattcaga tactgacaca ataagcccaa ctgttgttgt aaagcatgtc     48060
     aatgttacca taatactcaa gaaataacga ccaaaatttc caaataattt ataagatgct     48120
     tgtgataata cataagctcc tttattaaca tttgggtcag ctaaaatatc agctgggaca     48180
     ggaaacttat tccctaaaaa acctaagcca atatataaaa tactaaatgc taaactagta     48240
     acaattccaa caatccaaat ggttgataaa tattcttttt tagttttaaa accaaacttt     48300
     ttaagcgttt ctgttgctac tagacaaaaa gcaactgctg caagtgcatc aagtgtatta     48360
     tagcctgcta agacaccact tccaaacgct tttcctgcat agtcagcact cgccttagca     48420
     ctctccaagt ttccataagc aatagctcca acaacaacca aagagagaat taaaaaggca     48480
     aaaacaggcg ttaagatttt tccaacacta tctaatatac catttggtct aatagcgaga     48540
     taataagctg cagcaaaaaa acaggctgta aaacacaaaa gagcaatcgg actatgccct     48600
     acaattggag caaccccaat ttcaaaagaa accgttgctg ttctaggaat agcaaaaagt     48660
     ggaccaatag ttaggtagag tataactaaa aatgttaaag aaaaccacgg actaaatttt     48720
     tccgacatct ctgtcttata accaccatta gttagtgtgc ctagtaggag ggtaataata     48780
     gctaatccaa ctcctgacaa acaaaatcct aaaatcgctg gccagaaatc ttgtccagat     48840
     gctacaccta atgctggtgg aaaaatgagg ttccctgcac caaagaagat accaaataag     48900
     agtaatcccg ttaaaaagcc tttttttacc ataagcaacc attagtgtaa ataatctatt     48960
     tacacccttt ccataaattc tccttatcaa attctatcta aatgcttaga atcgatgtct     49020
     tttattatat caaaaataaa aataaattct aggtcatttt cataattttc caactattca     49080
     gtcacttttt tcttgaaaac aaaaaaagag cataatgctc ttttcgatta accaataatt     49140
     gatccatttg ccactgctga atcgaccgtc aacactgtca atttaccatc atgttctgct     49200
     gagagaatca tgccttgact gacatatttt ttcatcattt tacgtggttt gaggttagca     49260
     acaatttgga gttttttccc tactaactct tgttcatttg ggtaaaattt tgcaatccct     49320
     gataagattt gacgatggcc ctcatcacca gcatctagac ggaaacgaag aagtttatca     49380
     gaaccttcca ctttctcaac ttcaattact tctgcaacgc ggatttcaac agcgtcaaaa     49440
     tcctcaaact tgatttgacc tttgcttgat gtcaattcaa cttcttcagg aacccactcc     49500
     ttttccactg gtgcttttcc agcattcatt tgttctttga tataagtaat ttcgtcttcc     49560
     atatccaacc ttgggaaaat tggtgaacct tttgcaacaa ctcgaacacc ttctggtaga     49620
     tcagcaaaag tcaatttttc aagatcgaat gttgccccta aaccaagttg ttccataatg     49680
     gcatcggaag tttccatcat gaacggttga atgaggtgag caacaacacg tagactagca     49740
     actaaatgac tcattacagc tgctaactta tcacgatctg tttcgtcttt tgcaagtacc     49800
     cacggtgctg tttcatcaat atatttgtta gttcgtgaaa taagattcca tacagcttca     49860
     agggcacgtg ggaaatccac cgcttccatt tgtttatgat agttttcaat actatctgtc     49920
     gcaacagaag ctaaatcggc atcaaagtca gttgcaacag caaaccttgg tacttctcca     49980
     tcgaaatact tgttaaccat agcaatagtg cggttgagaa ggtttcctaa atcattagca     50040
     agttcatagt taatacgtcc aacataatct tctggcgtaa aagttccgtc tgaaccaaca     50100
     ggcaatgaac gcatgagata ataacggagt ggatcaagac caaaacgctc tactaacatt     50160
     tctggataaa cgacattccc ttttgattta gacattttac catcttgcat cacaaaccaa     50220
     ccatgagcaa ctagacgttt tggtaatggc aaatccagcg ccatcaacat gataggccaa     50280
     taaatagagt ggaaacgaag aatatcttta ccaatcatat gaatgtctgc tggccaaaat     50340
     ttatgatatt gactgagatc gtcagaccaa ccataaccaa gagcagaaat atagttcatc     50400
     aaagcatcaa tccagacata aataacatgt tttggatttg atggtacctg aactccccat     50460
     gtgtaagttg tacgagacac tgctaaatct tctaaacctg gttctataaa gtttttaagc     50520
     atttcattca tacgaccatc tggctgaata aattctggat gctcagcgta gtacgctttt     50580
     aaacgatctg catatttgct catgcggaag aaataagatt cttcagaaac tttttcaact     50640
     tcatgaccag atggcgcaac accaccaatc atattaccgt tttcgtcacg ataaacttct     50700
     gctaattggc tttcagtaaa aaattcttca tctgaaacag aataccatcc ggtatactca     50760
     ccaagataga tgtccccttg tgccaacaat tgttcaaaaa ttttagcaac cgcttcttca     50820
     tggtaagtat ctgttgtacg gatgaatttg tcataggaaa tatctaaaag ttcccataat     50880
     gttttgacac tttcagccat gccatcaaca tattcctgtg gtgtaatgcc tgcttcttca     50940
     gccttttgtt gaattttctg accatgctca tcaagaccag tcaaatactg aacatcaaag     51000
     cccatcatgc gtttgtaacg tgccaaaaca tcacatgcta tcgttgtata ggcagaaccg     51060
     atgtgcaatt tacctgatgg gtaataaatt ggggtagtaa tgtaaaatga ttttttttct     51120
     gtcatgattt ctcctataag ccaccctaat gagaggtgtt ttttatcatg atacattata     51180
     acataaaatc tttttcaact ggatatatct ctgaataata tatctacttt tgctataata     51240
     aaggtattaa aaatagagag ttaatatatg gttaatacaa aaacacttct cccctacaaa     51300
     actatgccgg tttggactgc acagtctatt ccaaaggcat ttttagaaaa gcataatact     51360
     aaggaaggca cctgggcaaa actaaccatt ctaagtggtt ctttagtatt ttaccagtta     51420
     tctcctgatg gagaggaaat ctcgcggcat atttttgatg ctagtagtga tattcctttt     51480
     gttgatccac aagtctggca taaagtttcg ccgaatagtc cagacttaag ttgctatcta     51540
     actttttact gccaaaaaga agattacttc cataaaaaat atggtctcac gcgcacacat     51600
     tctgaggtta tcgccagtgc acctctctta tctgagaaga gtaatatatt agaccttggg     51660
     tgtggtcaag ggcgaaactc actttattta tcgctgctgg gacatcaagt gacttctgtc     51720
     gattcaaacg gacagagcct tgtagcttta gaaaatatgg cattagaaga agagcttcct     51780
     tacaatataa aaaggtatga tattaatact gctgctattg aagggcacta tgattttatt     51840
     ttatcaactg tggtatttat atttttaaat cccgactgca tttctgatat tattttacaa     51900
     atgcaatcac atactcagat tggaggatac aatcttatcg tttctgctat ggataccgct     51960
     gaaaatcctt gcccgcttcc attccctttt accttcaaag aaggacaatt gaaatcttat     52020
     tacaatgact gggaaatcat caaatataat gaaaatttag gtgaattgca cagggtggat     52080
     gaaaacggta atcgcttaaa attacagttt gcgactttat tagctcgaaa attaagatca     52140
     taaaagtgag tagaaatcta ctcactttta tctttggtta ggtaataagt atattctaaa     52200
     cccatacata attatcctat aaaatatata gagatgatat ttcaaatcat tattgtaaca     52260
     atcagcttta gtatagctct tcaacataaa acgccataca ttaggagtgc ctttctactt     52320
     gtaggttata aaattcatgg cctaacagca agttgacata taaaagagga attaatatta     52380
     atgataagct ccattcgccc agtttacttg aaaaataagt cgagcaaaca acaccaaaga     52440
     taaatcctcc aataataata atcgtatttc tagcaattaa gaaaatatca gaattttttt     52500
     cgtaaagtcc ctttgttaat aaataagcag cattcttgat attaccagtc atcatcatat     52560
     tagcataagg tgctcctctg agcgatttaa aggtatctac ttgtattgaa gcaaagaagg     52620
     ctagtcctgc cacagtaaac gacgatggta agaaaggagt caatataatt gttactatag     52680
     caacctgtgt caacgcaaaa ctagataata ggtaccagtg cagttgatgt ttattcgccc     52740
     aacgattcat gaaataagta aacgattgac ctaacatgaa aaccattata ggtagcaaaa     52800
     aagcaagcgc ttgactataa tgcttattac taagatgaat agcaaaagat aacaaattcc     52860
     ctgtttgtac acctgcaaaa cgttttcctt gtgttacata agtaaaagca ttgatataac     52920
     ctgaaataaa acagagtgca accgcacacc tgagcccttc atatatttga tattgacggt     52980
     gagacttttt agacatattt tcctctaact ttatggcaaa caaaaataag actgggcaat     53040
     cttgctcagc actttttttc taatagattg gtttaaaata gtattaatat tagcactagc     53100
     tagcctaaca gttctaaata aattattaag caatgataaa tgtagtttta gtatatcata     53160
     acctcagcat tgaagcaatc tcactttatg aaaggataaa gaaaatctca taagtcattt     53220
     acccttaatt tgaagtttaa ttagttactt ttaattttac taccaaaaaa cttgcaccat     53280
     tcttaacatt tgttacaata aatacaacct attaggaggt cagtacagat tatgcacagc     53340
     actatttata aatgtcatca ttgccgttat ctaatttata aaagttttaa agatatcttt     53400
     ccttttgctc tcattttttc ttggattgaa atccttcaaa aactcgttat atcagatgat     53460
     tcttttttag ctcaaacaac aaagtccagt atttataaaa acgagtggtt atatacggtt     53520
     tccaatactc tttatgattt atctcattta ctaatctact ttatggctag ttattttgtg     53580
     gctagtttag tatggagagg cttatctaac caaactaaag aaagtttttc tgcaagttta     53640
     cttggctttg ccactgtttg gttgcttcta acttcagttg ttccaggtac agattatcac     53700
     tatcctagcc aacccatttg gcttatgctg gctttgattt cgtatctttt tatcttttta     53760
     actcgactgc ttcaaaatcg acatcatatt ttccagtata gtatgttagc tatactacta     53820
     ttaatctctt ctattttgtc acatatctta tatcgttatc ctaatattga tttagaatac     53880
     cttatacaaa atcacttttc tcaatggctg ggtgatgggc cacatcaatt aattcctatt     53940
     atgctttggt ctatcttagc tatttttcta accttatcag gtctttttgt accagatatt     54000
     ttatttcgtc cttactccta tttttcagta gttagcgaaa atttaaatgc tgccttgagc     54060
     caacatacag ataaaatccc ttatctgtat accttttata ctgttaaaaa tagctttgct     54120
     atgtttggcg gtattggaat cctattatcc ttatttttag cagttttata tgaaagtaga     54180
     aaactacaat cgaagaatta ctataaattg acattactga ccttaactcc tcttattttt     54240
     gatcaaaatt taccattttt agtaggtcta cctgtcattt tacaaccaat attattcatt     54300
     ccgatggtat taacaactat ctttgcagag gcttttggag ctcttatgct ctacctaaaa     54360
     tttgtcgacc ctgcagttta tactgtccca agtggtacac ctagtctact atttggcttt     54420
     cttgcttcaa atggggattg gcgttacctt ccagtcactg caattattct agttgttggc     54480
     ttctttattt atcgtccgtt tgtcaaaatc gctttcgcta aggaggagca atatgaaaaa     54540
     attacttaga tggcttcctc ctgtactttt cattattatc cttataggaa tgactatctt     54600
     aggtaagtcc tatatcaata aagtaacagc tcacaaaata aaactctata actctcgaat     54660
     gactcctact attttaattc caggatccag tgctactcaa gaacgattta acagcatgtt     54720
     agcacagctc aaccaaatgg gagaaaaaca tagcgtttta aagttaactg tcaaaaaaga     54780
     caatagcatt atctacaatg gacaaattag cggcaatgac cacaaaccct acattgtcat     54840
     tggatttgaa aataatgaag atggttatag taacatcaaa aaacaaacaa aatggctaca     54900
     gattgctatg aatgatcttc agaagaaata taaatttaaa cgttttaatg ctatcggtca     54960
     ttcaaatggt ggcttatcat ggactatttt cctagaagat tattacgact ctgatgaatt     55020
     tgatatgaaa tcattgttaa caatgggaac accttttaac tttgaagaaa gtaacacctc     55080
     aaatcatact caaatgctta aagatttaat cagtaataaa ggaaatattc catcaagtct     55140
     catggtatat aatttggcag gaactaattc atatgatggt gataaaattg ttccatttgc     55200
     tagtgtggag actggtaaat atattttcca agaaaccgct aaacactata cccaactaac     55260
     agtaactggt aataatgcta cacattctga cttgcctgat aatcctgaag ttatccaata     55320
     tgtcgcagaa aaaattctta aaaatgagaa aggtaaatta ccaaaacctc actaaagctg     55380
     taaaatagca acgcccctgg tattttgata taatatattg cgaattaaac taaataaaaa     55440
     aggatattat tatgaaactc atttcatgga atattgattc cctcaatgcg gcattaacaa     55500
     gtgaatcaac acgtgcttta atgtcacgcc aagttattga tactttagtt gctgaagatg     55560
     ccgacatcat tgcgattcaa gaaactaaac tgtctgccaa aggacctact aaaaaacatt     55620
     tggaagtact tgaaacttac ttcccagaat atgatttagt ttggcgatca tcagtcgaac     55680
     ctgctcgtaa gggctatgct ggcacaatgt tcttatatcg taaagggtta aatcctattg     55740
     ttagcttccc tgaaatcgat gctcctacta caatggataa tgaaggtcgc attattactc     55800
     tcgaattgga aaactgctat atcacacagg tctatactcc aaatgcaggt gatggcctaa     55860
     agcgcttagg tgaccgtcaa atatgggata ttaaatatgc tgagtattta gcaacattgg     55920
     atagtcaaaa acctgttcta gcaacaggtg actataacgt agcccacaag gaaatagacc     55980
     tagctaatcc tagcagtaat cgtcgttctg ctggattcac agatgaagag cgccaaggct     56040
     ttacaaatct actagccaaa ggttttacag atacttttcg ttaccttcat ggcgatgttc     56100
     caaatgttta tagctggtgg gcacaacgaa gtcgtacatc caaaatcaac aatacagggt     56160
     ggagaattga ttattggcta acaagtaacc gtgtcgcaga taaaattacc aagtcagaaa     56220
     tgattcattc tggtgatcgt caagatcata caccaattat tttggagatt gaactataaa     56280
     cccaaaaaaa gatgattgag ttataactca atcatctttt tatactaagt tgaggtcttt     56340
     atacttagta cgatagccaa tctgaagaat tttattatct ttaactagca atggacgctt     56400
     aataagcatt ccatccgatg ccaataagtc caaagcttgg tcaagagtta aatcatcaaa     56460
     tttatctttt aagcctaatt ctctgtaaga atttcctgaa gtattgaaaa actttttaag     56520
     gtcataaggc gaattctcta acaattcttt taataacgaa gctttgggag gattgctttt     56580
     tatatcaata gcttcaaaag ttaagccgag ttcagttaac tctttttttg ctgaacgaca     56640
     agtggtacat ttggggtatt cataaaacgt atacatatta tttctccttt tcgtattcta     56700
     ataaccaaga ttttctttct aagccaccag cataaccagt taattgacca tatcttccta     56760
     aaacacggtg acaaggtatg attagagaaa taggattttt acctattgct cctccaacag     56820
     cctgtgcaga tggacaattt agctctttcg ctaattctcc ataagttttg gtatctccaa     56880
     aagggatttt ctgtaattcc tgccatactc tcgtctgaaa tgctgtccct ctcaatgata     56940
     atggaatact aggtaaattt tgctgtgaaa aataagcatc taaccacttc ttaccaagta     57000
     aagtatagga atttgacata ttaacaattt cctcttggtt gactgctagc atatcatatt     57060
     tttgcccaac aaaataaagc cctgataaac ctagattgtc tgctagaagg cgaatttctc     57120
     caagaggaga ctgatagaat tcttgatata acatatgata agcataactt aaaaagccat     57180
     gaaaagcaat tcatgacttt tttagttctt tattgttgtt ttgcaattaa acgtacacgg     57240
     acgatattct catcaccttc aaattcttca attaaagtag aaatcttgtt attatccgtt     57300
     tcatctaaat ctattagtgt gtaggcgtag tcaccctttg atcggttaat aatgttatca     57360
     atatttatac ctagctctga tacagcagtt gaaattttag ccacaatgtt aggaacattc     57420
     ttgttaatta aagtaatacg aaatggtgcg gtttggattt gatgtacatt ggggaaatta     57480
     actgaattag tgatttctcc tgtctccata aaacaacgaa tggtttgact tgccataata     57540
     gcacaattta gctctgcctc atctgttgat ccgcctacat gaggaaagac tgtaattcct     57600
     ttttggttta ataattcttt gtctccaaaa tcagtaatat agcgcttgac aacaccagtt     57660
     tctatcgctt taaatagctc ttggttattg actaattctg cacgagcaaa gttgataatc     57720
     gtagttcctt ttttcatgat tgaaaaagct tccgcatcaa aagtatgctt agtttcattt     57780
     gttaagggaa catgaattgt gatatagtca caagtttcaa aaatatcctt aatctcttta     57840
     accctttgaa catggcttga aatattccaa gctgtttcaa ttgaaacata gggatcataa     57900
     ccaagaactg tcattcctaa gcgtctagca tcattcgcaa ttctagctcc aatagcacca     57960
     aggccgataa ctcccaattt tttccctgca atttcattac cagcaaaagc tttctttcct     58020
     gcttcaattt gtttgggaat atctgttcca gttagagtat taacccatcg gttagctcct     58080
     aaataatcac gagctgaaag caataaggca gcaatgaccg cttcttttac agcattagca     58140
     tttgcacctg gggtattaaa cacgactatt ccctgtgcac ttgcctcttc aataggaata     58200
     ttatttgttc ctgcacccgc cctagcaata gctttgaggt tacttgggaa atcctgatta     58260
     tgcaaatttt gactacgaat aatataggca tcaggatttt ctgacatatc cccatcaatc     58320
     tggaaacgat tccctaactc ttgtaaacca atttgattaa tattattaaa tgttttgaca     58380
     ctaaaaacca ttctttttca ctaaggttat ctctttagtc atcattgact aaaataaccc     58440
     ctttcttttt tcttacatgg gatttctttc atcaatctca cgatagatgc tcgtttctcc     58500
     cttttctttt atcttctgat aagccaatcg taccccatct agaggtactt taccacaata     58560
     ttgatagcct aatttattta gaatatgctg catagtgaca tttttttcat gagtatcgca     58620
     acgaaaatca ggtcctttat gaccttcaat taacccttga aggaatgtct gtgctagtcc     58680
     tctaccacga aattgatttg aaatagcaat acgatgaaat gtaagatagc gatggttatc     58740
     atggagccat tttccctcat aaatagcatc ataaacctct tcatgaccat caatgacagc     58800
     cgcataagtc gctagcatcc catcttcaat accaacccaa gcataaccgt tcaagatatc     58860
     atcaataata tcgttacgat tagggtatcc atcttctttt tgccattgat cacttcctgt     58920
     tttagcaatt tcggcacgcg cttcctcaat aagaagcata atttggtcaa tttcatttgg     58980
     aaaagctaat ctgacttgca ttatattacc cacttttata tattatagac ttataataac     59040
     ggtttaattt tctttcgtga taacatttac tatgcatttt ctgcttcaaa tgttttcata     59100
     aaatcaatta attcgatgac accttgttta ggaaaggcat tataaaggct agccctcata     59160
     ccacctaccg aacgatgccc tttaatattt ttaaatccac gttctgtcgc ttcctttaca     59220
     aatttttcat ctaaatcttt attaatagtt atgaaaggaa tgttacatag agaacgactc     59280
     tttttatctc tgacaggatt actataaaat tctgaggaat caatataatc atagagaagt     59340
     cctgattttt cacggttagc tttttccata gcatcaacac cacctagact tttcacccat     59400
     tcaaagacta atttagcaat gtaaatactg taagcaggcg gcgtattata aagagaacta     59460
     gcatctgact gaatcttata atccaacatt gatgataaag ttggttcctc attaatcata     59520
     tcttcacgga taataactac cgttacacca gcaggtccaa tatttttttg agctcctgca     59580
     taaatcattg caaaatcttc tactttatat tttacagcta agatattaga agacatatcc     59640
     gcaataacag gcactccatt agttttagga atatcataaa gcgatgttcc ttcaatggta     59700
     ttatttgttg tcacatgaac ataggcagct tcaggatcaa tctctttttc atcaaactct     59760
     ggaatataat cataaactga ttcttctgat gaggctaata gaattggttc aaaaggaatt     59820
     gtttttgata gttttacagc ctctgtataa gcttttttcc cccacgaacc agcaacatga     59880
     tagtaagctt tacgccctct ggcaatattc aagggaatca tactaaactg taaggatgca     59940
     ccaccttgta aaaagattac tttataatta tccggaattc ccatcaaatc tcttaagtaa     60000
     cgctcagcac ctttgataat atcatcaaac tctttggagc ggtgcgatac ctccaaaaca     60060
     ctcatactgg acccttgata attaaggagt tcagattggg cttttacaag cactggtttt     60120
     ggtaagactg caggacctgc agaaaaatta taaattgtca tataacacct ccatataatt     60180
     gtgtaagatt atagcacagt attttgaata ttgtaaagat ttttttgatt aattttgctt     60240
     tttattcgtg atataatggt aaaggcgaac aatcaagttt aaaggagtaa tttatgattt     60300
     tgagggaatt ttgtgcagag aatttaacag acttaaccag attagataaa gctattattt     60360
     cacgtgtcga gctttgtgat aaccttgctg ctggaggcac tactcctagc tacggtgtta     60420
     tcaaagaagc taatcaatat ttacatgaaa aaggtattag tgtcgctgtt atgattcgtc     60480
     cccgtggagg aaattttgta tacaatgatt tagaattacg tattatggaa gaggacattc     60540
     tacgtgctgt tgagttagaa tcagatgctc ttgttttggg aatattaact tcaaataatc     60600
     atattgatac tgaagccatt gaacaacttc tacctgctac ccaaggtttg ccacttgttt     60660
     ttcatatggc atttgatgtt atcccgaaat ctgaccaaaa aaaagcaata gatcagttag     60720
     ttgctttagg ctttacaaga attctcctac atggttcatc taatggcgaa ccaattatag     60780
     aaaatatcaa acatatcaaa gcattagttg aatatgctaa taatcgtatt gaaattatgg     60840
     ttggcggcgg tgtgactgct gaaaactatc aatatatttg ccaagaaact ggggttagac     60900
     aagcccatgg tactagaata actcaataaa aaattcgaaa cagggctata agtttcttta     60960
     gtatatttac tactaagttc tttcatgttt tgtaaaacct gaaagaaccg gaataagagc     61020
     ataccatctt ttataacctg ctctcagaaa taaaatccaa tttgcaatgg tattcaaaag     61080
     agctgaaatt aaaaatctta aggaaattgg aagcacctta cttctttatt ccaatagcta     61140
     agtcggagat tataaaaggt tgccaaagaa aactttggca acctttttat attattactt     61200
     ataaatcatg gaaactagca tagagttctt gtctattgag attaagttct tttgctactt     61260
     tttttatcgc ttgattagtt ttatcgccat tagcgatata ttcttttact aatactagtg     61320
     gatcttgttg gctactgtct ttcactcgct cggtatctct cttaccatca acaataatta     61380
     agcattcacc tttgagaggg actttttcaa tatgccctaa aagttgacta atggttcctc     61440
     tttgatactc ttcatagagt ttcgtcaatt cgcgtactaa aacaacttgg cgatctccgt     61500
     aaatctcttt catgtgtttt agcgtatcag agactcgaaa cggtgactca taaaagattt     61560
     gtgtttcagg gtaatctttc tttgtttcaa aaaaagttat ttgttgacct ttcttacgcg     61620
     gtaagaagcc ataaaaaata tgaggttgtg gagctaaacc tgaagcgatg agagcagtaa     61680
     taccagcgct agctcctggt atagatacga ccgggatccc cccttcaata gcagccttga     61740
     caaggtcatg tcctgggtca gaaatagagg gcattcctgc atcagatact tgggctaaag     61800
     atctcccttc ttttaacaaa tcaattaacc cagagatttt atcgtaagca ttgtgttcgt     61860
     gaaaactaat ttgtttagta gtaatatcaa agtgcttgag taaaagtccc gtatttcgtg     61920
     tatcctctgc acaaataaaa tcaacttctc ttaaaatcct aatggcacga aaagtcatat     61980
     catctagatt accaattgga gttgggacta gatagagtgt cccgtaatgt gtatttgatt     62040
     taaaactttt ttgaacttgc atttccatca atctctatat aataattcaa tacaaaaagc     62100
     acattcttcg tcattttcac gacgttgacc atagaaagta ttacaaatgt gaaagccatc     62160
     attgtaaatg ccttcgagta attctcttcc ttgtttagaa tttttaactg cagtttctgt     62220
     ttctgcttca ataacgctca gacgctcacg aagtttacca ttttcaatac gtagaacagt     62280
     attctcctcc aataattttt ggatttgttt tttcatagtc tcaatttcag acaacccaac     62340
     taataaattt tgtgaaaaat catcaaaggc atcaaacaag tcttttttat ccattcactc     62400
     ttcctctctg cgcgtattat ttgtctaaga aagcaccata tactctaaac tattttgaaa     62460
     actaacattg ctcttccaca tttgctgagc tctataagta ttttctaaat cataaagttg     62520
     gccttcttta gccagcatta ttgtcagcca ttgaaaaaca aatgcctgat catttttatc     62580
     tacaacttgc gatgtcaagc gagatacttc taaataagca gtttgcctat cttttgccaa     62640
     ggtcgtcaca aactgttgac ttaaattcaa gtaatctaat aactttttgt tagccaacaa     62700
     tatttctaaa tgtttaggat cgtctgctac ttgagctaat aagctagctt gtgattttag     62760
     caatcctgct tgttcagctt gatgaaccaa catgtccaat tgttttggaa aacgaaaaat     62820
     ttgcgttcta ctcttaattg ttggcaaaac attgttttca tcattagtca ataagatgac     62880
     ataagatgaa ctttgaggtt cttcaataaa tttcaaaagg ctgttggctg cattgacatg     62940
     cattttttcg caatctttga tgataaagac ctgtgatttc ccttcgaaac ctgatcttga     63000
     aaaatcttta gtcagctctt ttatagtctc tgtcttaata agttgcccct gtggttctat     63060
     gattttaaca tctgaaaatt ctccattagc gattaaacga caagctctac acttttggca     63120
     tggtaaacca ctctggcgct tttcacagaa ctgactttgt gctaaataaa gtgccatatc     63180
     tagacttgca aaatttcccg aaaaaagata ggcatgactc atcctatctg actgtaaaat     63240
     agtattaaac ttttccagca atttgggttg tgttcgcttt aaatccatga cctttgtact     63300
     tcctgattca ttggttgata cgatctaaaa taatagagaa tgtctcagct attacttcat     63360
     ctagctgttg ggaggcatca atcgtcacaa tgcggtttgg ctccgaatcc gccaattcaa     63420
     ggtaaccttg acggacgcgt tgatgcatat ctaattgctc gagatctaga cgatttacct     63480
     ccctttgaac acttttttga atacgctcta aacctacttc agaaggaaca tcaaaatata     63540
     aagttaaatc aggtttatga ctatcagtcg catagtcatt aagccatttt atatgtgact     63600
     tatctaatcc tcttcctgat ccctgatagg caacagaact atcaataaaa cgatccatta     63660
     ggactatttt cccttcttct agagctggga gtaccttttc cactagatgt tggcgtcgag     63720
     cagccatgta aagcaatagc tctgtttttt tatccatttg cgtgtgttta acatctaaaa     63780
     taatatgacg aatttcttct gaaatagtta cgccaccagg ctctctggtg gtgagaatat     63840
     cttgtgataa tttttctctg agcaagggta aaacagcttc taaaacggtt gttttacccg     63900
     caccatctgg gccctcaaaa gaaatcatta gtcctttttt catggtacat cctttattta     63960
     taattactac tattctatca aaatttatca aaaaaagaca cccacaactt gattgtgcat     64020
     gtctgatatt tttaagaaag tggttttttc acggtctttt ctaaagtttc cacaataaca     64080
     tcatcaaata ctagttcttg ttttaaaaca tccttgtcag cgtatccttc tagttgtatc     64140
     tcgaccgctt tcttacctgc ttttcgttca ataatgacta aacgtttaac acttaaattt     64200
     gcactagaaa gacgatttag gacttttgat agtaccccta tcccctcatc agctaatata     64260
     accaagcgat aaccttcttg accatacccc gcaatttcaa ggaaggcttt aaaaacatcc     64320
     ctatccgtga taatcccata aagttgtcca ttatcaacta ctggtaaaac accgatcttt     64380
     cgagacatca tcaaataaat agcgtcctca aggctagcat actgtgaaac agtcacaata     64440
     tctttaatca taatatctcg aatttttgtc ttattaagaa gatagttcat ctcatatata     64500
     gaaagactgg ttgctttaga aggttgtgct tctgccattg tcccttctgt cactaacccc     64560
     aatagctgat cattttcaac aactggcaaa cgccttaagt ggtgttctct caataaatca     64620
     gcagcttctg caactgtagt gtctggagag acataaacta atttttttgt cataaaatct     64680
     ttcactggca tacctgactc ctctaaatat tatccaccta agtaagcttt acgaacttga     64740
     tctgaaacta gtaattcctt acctgtccct gataaaacaa ccttcccagt ctctagaaca     64800
     tatgctttat cagcaatcgt cagagcttta tttgcatttt gttcaactaa aagaactgta     64860
     gtcccttgtt ttttgatgtc ttcaatgata ttaaaaattt cttgaataaa aattggagct     64920
     aggcccattg acggttcatc taaaagtaat aatttaggac gactcatcaa tgcacgcccc     64980
     atagcgagca tttgctgctc accacctgat aaggttgctg catcttggtt tttacgttct     65040
     tctaagcgag gaaaacgatc aaacactttt tttaacattt tttgattttg ttcacgatcc     65100
     ttttgaagaa aggctcccat ttctaaattt tccataacag acaaacttga gaaaacatgg     65160
     cgcccttctg gaacctgagc taaaccattg ccaacaattt ttctagctgc taacttatgt     65220
     ataggtttcc ccataaaaga aatagaaccc tgacttggtc ttactaaacc agaaattgtc     65280
     ctcaaaattg atgtctttcc tgtaccattg gctccaatta aggttacaac ctcaccttgg     65340
     ttaacttcaa acgagacatc attcacagct tgaataacac cataatgaat agatagattt     65400
     tctactttca acatggtcat tataactcac cccccaagta tgcttctata acacgtttat     65460
     tatttttaat ttcttcaggt gtcccgtgag caatcagacg accatattcc aatacataaa     65520
     ttctctctgt tacttgcata accaagttca tatcatgttc aattagcata atagtaatat     65580
     caaaatcact ctttatttga ctaattaact gcgtcaattc tgcagtttct tgaggattca     65640
     ttcctgccgc gggctcatcc aaaaacaata tttttggttc tgttgctaaa gcacgaacaa     65700
     tttctaaacg ccgttgtttt ccataaggga ggttcttagc aagagcatct tgatatgctt     65760
     tcaaaccaaa aatctctaat agctctagtg cctttttcct taaggctttt tcactatgat     65820
     agtatttggg taatcgtaaa aaactagcaa taggatgtga taagtgatga ttactgagtc     65880
     ctactagtac attgtctaaa acagtcatat ttttaaaaag tcggatattt tgaaaagttc     65940
     tacctaaacc taaagaagct attttagctg gtttcctccc atttaatatc ttaccatcaa     66000
     gtgatattgt ccctttacta ggaaggtata ctcctgttaa gagattaaaa agcgttgtct     66060
     tacccgcacc gttggggccg attaagccaa ttaattcacc tttatgtaat ttcatcgaaa     66120
     catcacctac agcagttagg ccaccgaaat gtttacttaa attttttact tcaagaagtg     66180
     ccatctaatt gcctccctta ctcgtcttac gaaatagatg agatagagtt aactccttcg     66240
     ttcctaataa accgctaggt ctaaaaatca taattaaaat cagagctaaa gcatagataa     66300
     tcattcgaac agaagcgtag tcttgtagta acatattcaa taatcctaat aaaattgctg     66360
     ctaaaactgt ccctgtcatt gaacctaaac cacctaaaac aacaataatt aaaacattga     66420
     cagacatcat aaatgaaaag tcttttggca taacagttcc aacgtagcca gcctgtaaac     66480
     taccagcgat agaagctaaa atagctccaa aaacaaaaac aattactttc acttttgttg     66540
     tatccacacc catagactct gctgcaattt catcttctcg tatagcaatt gtattacgcc     66600
     ctaagggact acgcaaaaaa ttcattgcaa ggataagact cacaactgcc accccataaa     66660
     ctaaagacca ggttgtaaaa ggcggaatcc ccatgatacc cgcagcacca ttcgtaatat     66720
     cacctccatt aaccaacaaa atacggataa tctcagcaac acctaaagta gctatagcta     66780
     aataatcacc ttttagtctc aaagtaggaa ttcctacacc taaggcaata cctcctgcaa     66840
     caagagttcc aacaagtata gctatcaaaa aacctacata agttggcatt ttaacgccga     66900
     taatagcaac tgcataagcg ccaatagcca tgaaacctgc atgtcctagt gaaaactgtc     66960
     ccgaacaacc tacaattagg ttcaaaccaa ctgctaaaat aacattaatc ccaattgttt     67020
     caataatttg aatatgatag aggttaaata tacccataga tattagcacg ctaatcaaga     67080
     gataacctaa cactactata gctaaccaag ataaaattga tttcatattt tctttcatgc     67140
     ctagaccttc tccttaatat tttttccaag aattcctgct ggacggatca agaaaatgag     67200
     aattaaaata gcataaacga taccatctcg aaaatctgac acaccaagtg cagtcgctaa     67260
     agtttctaaa atgccaataa caaaaccacc gatagccgct cccggaatga taccaatacc     67320
     acctaagaca gctgcaacaa atgctttcaa ccctggagtt acccccataa gaggttgaac     67380
     agaattataa taaagcccaa tcagtactcc acctgctcca gctaaagcag accccagcgc     67440
     aaatgtaaaa ctaatggtac ggttaacatt aattcccatc aattgtgcgg catcgctatc     67500
     cactgataaa gctctcatag ctttccccat tttagttttt tgaacgatga actgtaaagt     67560
     aagcattagt aatagcgcaa tacctaaaat gatgagctga acattggtta tagttatcgg     67620
     tcctaaatta tatttaacag tatgaatggc ttgcggaaat gccctagtat ccgctccaac     67680
     aaggtatacc atcccgtact ccaaaagaaa agaaacacca atagctgtaa ttaacgcggc     67740
     aattctagtt gattttctca gtggacgata agctaaatat tcaattacag cacctaggaa     67800
     agcagacccc agcattgcaa ttaataaagc taggaaaaaa ttaagatgaa gatgattaat     67860
     caaataatag cccatgaaag cgcccatcat atagatgtcc ccatgagcaa aattaatcag     67920
     cttaataatg ccatatacca tagtatatcc taaggcaagt aaagcatata tggatcctaa     67980
     gataagtcca ttaatgagct gttgaagcat attataacca tactttctat tatatattat     68040
     tgtcgaatta ttctgaaaaa ttacttttta aaaaagggga gctgaaaatt aaactcccat     68100
     ttttctagag aatacttatt ttgctgaaat aatgttaacg ctacttgttt ttccatcgtc     68160
     taatttgaca acgtaagctg atttaacaac attatgattt ttatcaatag acattttccc     68220
     tgtcacacct ttaaaatctt tcagcttagc taaagctttt ttaagatcaa ttgaagtttt     68280
     agctccttta gcagatttag ctgccatata cacggcatcg tatgataaag ccgagaacat     68340
     ggatggttct tcaccatatg ccttaacgta atgatcatgg aaagctttag ctttggttga     68400
     tccttgtgta gtgaaacctg tcaaataata aacgtttgaa gctcccacag gtgttgccga     68460
     ttgcacaaat ttcggactat caaaaccatc aggcccaaga accggtttag agatacctaa     68520
     atcacgcgct tgcttaacta ttaatcctgt ctcggtatag taacctggca tcacaatagc     68580
     atcatattct ttccctttca acttagtcaa tgacgcttgg aaatcagtat caccagcgga     68640
     gaatgtcatg ctatcaacaa tttttccact ataactttcc ttaaatgatt ttgctacccc     68700
     ctttgagtaa tctgatgaat tatcataaaa tagaacaact tttttagctt taaggttgtc     68760
     tgtagcatac tgagacaata gctttccttg ataattatcg acaaaagtag ctcggaagaa     68820
     atactgattt aaggtttttc catcagaacc atagactaaa ttgtcttgtg tcgcagcagg     68880
     tgcaatcatt ggaactgctg ctgcatttac ttttggagtt gaagatgcag ctgcacccga     68940
     tgttgctggt ccgataatga cattagctcc tttggtaacc aagtttgtgg caaccgttgc     69000
     tgcctctgca ttttctgatt tattatcctg tgataggact tttaacttct tgccgccaac     69060
     ccctccagca gcattaattt cttttactgc taagtcagct ccattcttca ttgaatttcc     69120
     atacgaagaa acgtttcctg ataattccca gttataccct accttaatat ctttccctat     69180
     ttttgttcct gtcgaagatg ctcctcctcc gacatttcca catgctgcta aaagaactgt     69240
     actagctaaa acaagagctc ctaaactaag tctcttttcc atatttttct ccttttttga     69300
     aaatggtaac taaaataata cagaattatc agaatattgt caatagtttt taaattattt     69360
     ttttgaaaat tatagaaact aaataaaaaa gaaggacatc cgaactcctt ctttctaata     69420
     actactataa gtatcttagc gatataagtt tccaacaaaa tcctgatcaa tatcatcaat     69480
     tgctgataac cgaacatcct taacaaattt taaatgtttt atctctttac taacgctaac     69540
     aatatcctct ttattaacat aaatgactag atatcttaat ctacgagaat gataatgaac     69600
     atctccgtat ttatataatt tacgagcgtc acgattatag taaagataaa cgctcattcc     69660
     taaacgctct tgtttattca ataatttttt cctttctgcg tcatatctgt aattactaag     69720
     attataacat aattccaaca aataaaaaaa gagttgataa actcaactct tttaaatcta     69780
     ttattgtaga ttattatttt ccataatagc atcaataaag ccataatcaa gtgtttcttg     69840
     agcactcatc caacgatcac gctctgcatc atcatggact ttttcaatag attgaccaga     69900
     attatcagct aagatttttt ctaaagtatg acgcgttttt aaaagatgct cagcagcgat     69960
     agccatatca gattgctgtg tgcctccgcc tgttccaccc attggttggt ggatcatata     70020
     ttctgcattc ggtaacataa aacgttttcc tttagcacca ctcgaagcaa taatggttcc     70080
     catcgaagca gccatcccca taacaatcgt ctgtacgtcc gatttaataa agttcatggt     70140
     atccacaata gcaagtccag ccgatactga accacctggt gtattgacat aaaggtaaat     70200
     atcctttgta ttatcttgtg catcgagaaa caataactgt gcaatgatac tattggccat     70260
     attatcctca acttggcctg tcaacataat aatacgatct tttaaaagac gtgagtaaat     70320
     atcataagag cgttcaccac gacttgtttg ttcaataact actggaatca tatctttctc     70380
     catttctttt tatcactgtc actattataa tcatttggtc aacaaaggtc aaataataac     70440
     ttttttaaga aaaggctttc tgagttcttc agaaaagcct tattcatctc aaatcttatt     70500
     ttgtaccaaa taagcgatcc ccagcatctc cgagtccagg aacaatgtag ccatgttcgt     70560
     tgagtttttc atccaaagca gcggtataaa tatctacatc tggatgtgct tcttgaagtg     70620
     ctgccactcc ttctggagct gctactaaac aaacgaattt gatactagct gcgccacgtt     70680
     tttttagaga atctactgct aaaatagcag acccacctgt agcaagcatt ggatcaacta     70740
     caaaaatctg acgttgatca atatcttcag gtaacttaac taaatattcg actggttgga     70800
     aagtctcttc atcacgatac ataccgatat gaccaacttt agcagctggc acaaggctta     70860
     agaaaccatc aaccatacca atacctgcac gtaaaattgg aacaattgct aactttttcc     70920
     cagctaattg tttttgtaca gttgtcgcta ctggtgtttg gatttcaaca tcttctaaag     70980
     gcaaatcacg agacacttca tagcccatta acatcgcaat ctcatcaact aactcacgaa     71040
     aatctttagt agatgttgta gtgcgacgta agattgacag tttatgttga ataagtggat     71100
     gtgaaatgac ttgaaatttt cccattataa tgaccgcttt ctatttaatt ttgagcatta     71160
     aaaacattct aacgcttgtt tacattcaaa gtattataac ataaaaaccc tttctatgcg     71220
     acttttttta tagtctagtc attttttcta aagtttgtca ctaatcgcaa aactgcctcc     71280
     tcaataacag acctaggagc tgcgacattg attctagcat gttttttccc ttcttttcca     71340
     aaagttaaac catcatttaa tattaatttg gcatcatatc gaagtttttc ttgaatttct     71400
     aaatgcgtta aattataagc agaaaaatct aaccaaacaa gataagttcc ctctggtttc     71460
     atcactttga tatgagtttt ttgcgttaat tgctcataaa ggtattctat tgatccttct     71520
     aactccattt ttagggcctt taaccatttt ttcccttttg taaaggcaac ttctgtagct     71580
     aataacccca atgaggaaat ttcttgttga ttgttagcta tttgcctctt cttaaaatca     71640
     gagcgtaact tttcattttc aattattgca aaactatttt tagtccctgc aatattaaac     71700
     gttttagttg cactagataa aataacacta aattctttaa aactagaatc aacagtattg     71760
     aagctatggt gtacattatc aaataatacc aaatcttgat gtatttcgtc agaaacgagg     71820
     ataacattat accgtttaca gatatctcct attttttgaa tttctccttt tgtccagaca     71880
     cgtccaccag gattatgtgg actacaaaaa atataaagct ttacattatt ttcaatgata     71940
     tctttttcta attgtttaaa gtcaatctca aaatactgat tattattaag taaactattt     72000
     gaaactaaat gacgattatt gtattttata gttctagcaa aaggcggata gactggggta     72060
     ttaattagaa cagcatctcc ctcctttgtg aaggcttgta tggcaactga aatcgctggt     72120
     ataaccccat caattaataa taatgatttt ttatcaaatt gataaccatg ttcttgcact     72180
     tcccaattag agatagcttg gtataaactg tctttaggac tatcatagcc aaaaaccatt     72240
     tggtgtgaaa aatcttcaat agcctccgac atttctggaa agataggaaa atccatatcc     72300
     gcaatccaga ggggaaggat ttcttgatct ttttgaaccg ccttccattt tatggcatta     72360
     cttgaaaaac gttctggtaa acttgtgaaa tcatatgtaa tcataattac tcctgactat     72420
     tctacagcta aaaatatccc ttgtcgcctt ggtgactatt ttaccatttg tttttgatac     72480
     tatatactaa ttaacattct aaagataaaa gtgaccattt taaacgatca ctttctttat     72540
     tattttaatt tatcattttc ataagtatgg cttaattcta aattaggaaa gctttgctgc     72600
     ctaagggctt cataaacaat catacaaaca gtgtttgaaa cattcaagct acgcacatgc     72660
     tcatcgttca tgggaattcg taaggccttt tcggcatgct cgcgcataaa agtttctggc     72720
     aatcctttat cttcacgacc aaacataaaa taatggtctt gatcatcatt ataattttca     72780
     tctgagtaaa ccttgtcagc aaatttgcta attaggtgaa ctttccctcg acatgacaac     72840
     ataaattctt ccaaactatc atagaaacta acatctagct tatcccagta atccagtccc     72900
     gctcgtttca tttttttatc atcaatagga aatcccattg gtcgtatgat gtgcaaagga     72960
     gcatttgttg ccgcacaagt tctagcaata ttaccagtat ttgctggaat ctgtggttca     73020
     aataaaacaa tatgatttcg tccgctatcg gaacgatgat ttttctgcgt tagtgtttca     73080
     atattcatct catcatcact ttctagaact cattctgact cgcaaaaaaa ccacactgct     73140
     cggagtcaat ctcagcaaac aatgtggttt atggtggttt gttaacttaa atcataacag     73200
     gtttgattta aactaacaaa tcgttgacac tattatagca cttcagtcta caaagtcaac     73260
     ctattcatga gtttttgggt tatttttttg atagatataa tgacaaatca aacagaataa     73320
     taagcaaaaa cattggaaaa ttaaaaccgt aaagaaatta cttaacaaac tcccgataaa     73380
     gaggatcaaa ccgcctaaaa ttgctagaat cggtgaaact aagccggtaa atttattttt     73440
     aatatctttt ttgagataaa ggctgagtac taaaacataa agaatgatta aactagtatt     73500
     attaaacacc acagcaattt cactaatatc actacccggc aataaattaa attttgtaac     73560
     cataaagtga acaaaaagcc aaaaaatagc tacagccgtc accgtcaaac tagctggcaa     73620
     tgacatttga tacttcaaat ttatgttagc catcctctca cttttgatcc atccgcgttc     73680
     cgcaaaagct tgaggtagac gcatcgtccc aagtaaaagt ccattggcaa cacctaatac     73740
     agataaaata acaatgaaag ataataaacg cccaacacta ggaccgaaaa taatgttagc     73800
     tgcataatta atagcatcat taccggttgt cataataaag ctagcaccta aaatttgtgt     73860
     caaaccatag aaaaatgcca aatatgataa taagataagc gctggaccaa tgacaaaggc     73920
     aagtggtaaa ttcttcttgg gattcttgac ttctggtgca atactaacaa aaattgtcca     73980
     accatcatat gcaaaataca atggtaccag acctgacacc caactccatc caacatttga     74040
     cggctgaata gctgttaaat gttgtggaag ttgtggagct ttatcagacc aaaaagcacc     74100
     aattaaagca attaggacta aaggaatcat ttttacaaag gtcgttaaag attggaatcc     74160
     ccctgcaata cgcttagcaa agatattcat gagactaagt gctaaaatat aaacagcagc     74220
     taaaataatc tgtgattcca aacttgatga ttcacctaaa gtataaaatg cagctaccca     74280
     tgaaacgatt gctgttaaag ttggaagata caaaaaagac gcaaacaagc ctaaagttgc     74340
     tgctaaagct gggctaacat atttttcgta gtaagaaaaa ataccaccac tttcactcgt     74400
     tctaatagct agctcagaaa ttgacaaact tccaaaaaca atcgaaaaag aacctagtac     74460
     taaaattacc atgcctaaaa agacatctcc accagtaaat ttaaggatgt catcaacttt     74520
     aaaataaatg cctgaaccaa tcactacacc tacaatcata gcaattgtag tcattaatcc     74580
     ataggtctgt ttaatagaat tatgattctc cataatatct ccatttctac tgtacgctta     74640
     aaggttaatt ataacctaat ttagggcttg tcacaagttt atctgtgtta tttttcacca     74700
     gattctgata agagaatcat attactctta tcagaaagat gaaaacgttt tttaaccata     74760
     attctcgtgc atttttacta aaaaaaaggt atcatagagt ttattattgg aggtaaaaat     74820
     gagaataatt gttgtcggcg gaggtaaagt cggaaccgca ctttgtcgct cacttgttgc     74880
     tgaaaagcac gatgttgttt taattgagaa aaaagaaaac gtccttaaac gtgtcactaa     74940
     acagcatgat attatgggaa ttgttgggaa tggggcaaac tataaaattt tagaacaagc     75000
     cgaagtcaaa aattgtgata tttttatcgc tatcactgat cgagatgaag ttaatatgat     75060
     ttcagcagtt cttgccaaaa aaatgggggc aaaagagact gtcgttcgca tgcgtaatcc     75120
     tgagtattct aatccttact tcaaagataa aaactttctt ggcttctctt cagttgtcaa     75180
     ccctgaattg ttagcagcac aatatatcgc taataccata gaatttccaa atgcaacttc     75240
     agttgaacat ttcgccaacg ggcgtgtgat gttaatggaa tttaaaattt tagaaggaaa     75300
     taaactctgt catacttcaa tgagtcaaat tcgtaaaaaa tttggtaata ttgttatttg     75360
     cgcaattgaa cgcgatggca aattgattat tcctgatggc gatgcaacta tccaagtcaa     75420
     agataaaatc tttgtaactg gaaaccgtat tgaaatgata cttttccata attacgttaa     75480
     aaataaagtt gtcaaaaact tgatggttat cggtgcagga cgcatcgcct actacctact     75540
     caatatcctt aaaaatacca atacacacgt caaactagtt gaactcaacc aagaacaagc     75600
     tgaatatttt agtcaagaat ttcccaatgt tcctgtcgtt catggggatg gtactgctaa     75660
     aaatattttg ttagaagaaa gcgttacaag ttttgacgca gttgctactt taactggtgt     75720
     tgatgaagaa aatatcatta cctcaatgtt cttagaaagt atcggtattc ctaaaaacat     75780
     taccaaagtt aatcgaacta gcctactaga aatcattgac gataaacaac tatcaagcat     75840
     tatcacaccc aagcgtattg ccgtagacca tgtgatgcac tttgtacgcg ggcgtgtaaa     75900
     tgctcaggat tccaacctag aagctatgca tcatattgct aacgatcgca ttgaaacctt     75960
     acaatttgaa ataaaagaaa ctagcaaatt agcaaatcgt agccttgcat ctttaaaatt     76020
     aaagcaaaat attttaattg cagcgattat tcgcaataat aaaacgattt tcccaactgg     76080
     tgaggatgtt ttaacagtgg gtgatcgtat cgttgttatc accttattaa aaaatattac     76140
     tagaactagt gatatgttag cgaggtagga atatgaataa aagtatgatt cgtttccttc     76200
     tctcaaaact tttgctgatt gaagctgctc ttctagcgat tcctctaact gttggactta     76260
     tttaccgtga accgcaaagt gtcatgatga gtatagtcat taccatgatt attctaatca     76320
     tccttggatt actgggttct ctctttaaac ctaaaaatta tcatatctac actaaagaag     76380
     gcatgttaat tgttgcactc tgctggatac tttggtcctt ctttggcgcc cttccatttg     76440
     ttatttcagg gcaaatccct aatattatcg atgctttctt tgaagtatct tctggtttta     76500
     cgacaacagg agcaactatt cttgatgacg tcagtgtctt atcccccgcg ctcttatttt     76560
     ggcgtagctt tacccatctt atcggtggaa tgggggtttt agtatttgcc cttgccatca     76620
     tggaaaattc taaaaatagc catttagagg ttatgagagc tgaagttcct ggacctgtat     76680
     ttggtaaagt tgtctcgaaa cttaaaaaaa ctgcacaaat tttgtatttg ttataccttc     76740
     ttatgtttgc agtatttgca gtaatattat attttgcagg tatgcctttc tttgatagta     76800
     ttatcatagc aatgggaact gcaggtacag gtggttttgc agtttacaat gatagcattg     76860
     cccattataa tagtcctctg ataactaact tagtttctat tggtatgctt atcttcgggg     76920
     ttaactttaa tctttactat cttcttttac tccgaaaaat taaagcattc tttggtgatg     76980
     aggaactaaa aaactatctc cgcatcgtgg caatagcaac tttcatgatt gctctaaacg     77040
     tcatcggtat gtatgataat tttcgacaag gcctcgaaca tattttcttt gaagtatcag     77100
     ctattattac gacaactggt tttggcgtga ctgatatcac tcgttggcct ttgttttcac     77160
     aggttatttt gctattcttg atgtttatcg gtggttctgc tggctctaca gctgggggct     77220
     ttaaagtcat gcgtagctta agcctagcaa agattgcacg taaccaagta ttgtctacac     77280
     tctatcctaa tagagtcatg tcactacaca ttaataaaag cgttctagat aaaaatacac     77340
     aacatggcgt tttaaaatat ctaactatct atttagctat cttcatggca ctcgttcttg     77400
     ttttaacgct tgatactaat gattttttgg ttgttgtcag tgctgcagcc tcatgtttta     77460
     acaacatagg cccactctta ggtagcaatg aaactttctc attctttagt ccattctcaa     77520
     aactccttct ttcatttgct atgatagcag gacgtttaga aatataccct gttttattga     77580
     tgtttattcc taaaacatgg tcaaaactat aattacaaat aataaaacgg atatatcaat     77640
     ctgatatatc cgttttatta cgtcttaagc taaaatgatc agggacagga tcatttcctc     77700
     cgtgggctaa gggatgacat cgcaaaatac gtgcaatccc catcaacaca ccttttagac     77760
     catgtttttg aatagcttct atcatatacg tagagcaagt tggacaataa cgacagctag     77820
     ctgggaaagc tggagaaata tttttttggt aaaagcgaac caagaaaatc aaaaaagatt     77880
     taagcattaa gatttattaa tagccgcatt atgcaactgg ctaatttctt ttttatttaa     77940
     tcgtcgtgct tccccaggac ggagacccgt taaatctaag gtaccgaatt gtgtacgaga     78000
     tagcttgtcc actaataacc caacttgttc aaacattttc ttaacttgat gattacgacc     78060
     ttcatgaata gttaactcaa ctactgaacg atttttttca tgatccactt ttatgatatt     78120
     atagcgagca ggttttgttt tcttaccatc aataacaacg ccacgcgtta atggtcgaag     78180
     gttttcttta gtagctattc ctttgatacg tgctaaataa actttatcaa tttcattacg     78240
     aggatgaatc attttatcag taaaatcacc atcattagtc aaaattaaaa gtccagttgt     78300
     atcccaatcc aagcgaccaa caggatatat ccgttctttg acttgtggca acaagtcaat     78360
     aactgtctta cgtcctttat catctgagac acttgaaata acaccacgtg gtttatttaa     78420
     gagataatat accttctctt cgttgtaaat tggacttcct tcaatttcaa ccagatcacc     78480
     agcctttact ttggtcgcca attcattaac cacttgacca ttaatcgtga ccattccttg     78540
     cttgattaat tcctcagctt ttctacgact tgcaatccct gcatgcgcaa tatatttatt     78600
     aattctcatt gttttcctta tcttctgtat taattgaatc cattgaaaat aacgatactt     78660
     cttcgtcaac taattcaatt gaagaggcgt caattaagtc atctaactga ttaattccca     78720
     tataatctaa gaaataatta gttgtctcat aaaggttagg acgtcccaac acttctttct     78780
     ttccagcctc tttaattaaa ccaaaagcta tcagtctcgt tatagctcca ctggaattca     78840
     cgccacgaat atcatcaatt tcaatcctag taataggttg tttataagca ataatagata     78900
     gaacttccaa acttgcccga gatagactct gattaatcgg agccttcgca taatctctca     78960
     acaaagtcat ataactatcc tttgttacca atttataagt ttgtgctgtc tcaagcaata     79020
     atagactaga atcgtcatct tcttcatatc gtttagccaa cttttctagt tgctgtatta     79080
     atgctgatgg tgtcaaagac aataattctg ccatttgacg caaactcagt ccatcttcac     79140
     ctgcaacaaa aagaagagct tctattgagc ctaaataagt catttctctt cctttcttaa     79200
     gataacttga ctaaaattac tgtcttgttc tactgtgatt tgatgtaatt ttatcaactc     79260
     taacattgcc aaaaataaag ttatcatttc agattttgtt tggcaatccg caaacacttc     79320
     ttgtaatgtc gttttctttt taagattaaa atgtctttca ataacgatca tcatatcttc     79380
     aatacggtag tcttctttct caattaccgt ttgactattt gacaattctt tttgtttttg     79440
     ggacatcatt tgagaaaaag tcaaaaaaag gtccatcacc gatttatcgt gtagaagaat     79500
     tgcatcttca aagataactt cttgttttgg ttttgaaaaa tatttggcac gttcctgatg     79560
     ctgattagct aactcttcac ttagcacttt aaaacgtcta tattcctcta attggctcaa     79620
     caattccatt tctggatcat cttcaatagg agttgactcc actactttag gtaataagtt     79680
     acggcttttt atcaacatca actgacttgc cataagcata tactcaccag ctacttctag     79740
     acgcatcgcc tgtaatgttg ctatataagc aaggtactgc tcaataactt ccacaatcgg     79800
     tacatcgtat atatcaacct catatttaga tacgaggtgt aagagcaagt ctaggggccc     79860
     ctcgaaatct tttaacttaa tatccattat ctataatatc tctctaaagt gataggagtt     79920
     tttaagccta gaaggcggct gagctccgtc attgttttgc cattttcttt ttgctttaga     79980
     ataaattgtt ctcgcagaag ttgtgcagtt agttgttgct cattcttctc atttaagaaa     80040
     tctgttaatt gattaaaaaa ccattgtcta gaataaggct taccgttatg ctcaaagact     80100
     aagtcaccat cttcctctaa agattccaaa agaaaaggaa gcaagttttc tggaagtttt     80160
     aaaatacgct tcatctgcga tttttcaata cttaagatat taaaagttgt atcaaaatca     80220
     gccttcttca aattagcaat ttcagccgga gttaaaccta aagataaaat caacaaagca     80280
     atcaaacgac cactcggata atctgtatct tgatagaaat ttgataaatc cattatttga     80340
     gactttgtct gagtcaaagt gattttttca gtctcttgta gtctgtaaaa ttccttcagc     80400
     gttcctctat tatacaaaaa gaaaagaaat tgattgactg cagataactt tcgcttacga     80460
     gctgttaact taaattcact tagagactgt tgatacaatg ccagtttttc agaatttaca     80520
     tgtccaccaa ttattttata aaattgcttt aaatcatagt gataggactt acgcgaattg     80580
     agagataatt tcttactctc aataaaatta ttaatatcat ttatcattgt ttttaggagt     80640
     gatagtatat tcgtctgtaa aatcatgtag gaggctatta atagctttta aaatcgattt     80700
     acgggttata atgcctctaa aatcattttg atcactgata acaggtaaaa atggataatc     80760
     tacaatctta tgcataattg ctgtcagagt agctgcctca ttaatcggct cgatttttgt     80820
     attaaccatc tcaacaatat cagtctgtgc catctcccaa tctgttaatt gacctttaga     80880
     ttggtaagcc ataatgtctg agatactaat agtacctaca tatttttttt ctttagtgat     80940
     aactggtaca cgtgaaaaac cattacttgc taatagtaac ataacgtggt ctgcattgtg     81000
     cgtatccaca aaaatagcaa cgtcttcagc tggaattaga tagtggtcca aatgacttag     81060
     caaaaacgac tcaaattctt tagcaatcat cttgaaaatt cctttgtcaa gttaggatag     81120
     ggttggtgtt ggcgagtata atactctacc aaaaccttac tatctgttat agttacaaca     81180
     gcgtaaagct tctcatttat tggtcctctt ggctgcaaaa cactacctgg attgataaaa     81240
     atagttttac catttttcca agcatctgca cgatgaagat gaccgtataa acaaatatcc     81300
     gcgtcttctt gctgagctaa taaatccaat ttatcccaag taaaattaat ttgatggaga     81360
     tgaccatggg tttgaacaat aacagtatta tctatttttg taaccaaaac ttccggataa     81420
     cctgaatcat aatcacagtt tcctgtgacc acatgaattc cttcccatat aggatctgag     81480
     ctaggaagtt cggaatcccc attgtgaaaa atagcatcca cttttcccaa ataatgattc     81540
     tttatatctt ttacaatgtc acgatctccg tgagaatcac tcattacaac taattttcta     81600
     attgccattt tggaaatacc tccatcaatt tacggacagc ttgcccacga tgtgatagat     81660
     tatttttttc ttgtgcgctc aattcagctg ctgtcctact accttctccg acaataaaga     81720
     gcggatcata accaaagcca ttttccccct taggttccgt accaatataa cctggccact     81780
     ctgcttcaac taccaaactt tctttatttg gagctgacac gactaaggtt gtatgaaact     81840
     gtgctgaacg tctttctttg tcaaatacca tggctaattc atgcaataat ttggcattat     81900
     tacgagcatc tgtcgcgtca ggacctgaaa aacgagcaga ccatacccct ggcaaaccac     81960
     ctaaagcatc tacttttaat ccggaatcat ctgaaatcac cattttccca gttaattttg     82020
     aaatagtctc tgctttaagt cgagcatttt cttcaaaggt cataccagtc tcttcaactt     82080
     ctggcaaatc tgggtaatca tttaaatttt caactttgag tcctaatttc ccaaataatt     82140
     ctctaaattc cttagttttt ccttcattgt gagtcgcaat taatatggta tccccaaaat     82200
     tattatcatt ctttaaatca aagaattttt ctaaagaagt gccctcttta ggtaagtgaa     82260
     ctaagaacaa ctgatcatct tcactaacta agatggcccc tttatgttga gtcactttga     82320
     tgtgccttga atactcttga ttaatcatat caacgaggaa tgctaataat tgaaaatccg     82380
     aagtcatctg cacaacgtga agctgtagac cttcaacttt caaagttgat aatagacgat     82440
     gaaaaacatc ttggatagct tcgtaagatt catcattacc aaaacaagta aaataattaa     82500
     aagcttggaa actacctaaa aaccaattgc cttcagtttt actttcaaaa attgtttttg     82560
     tcataatact atacgctcca catttatttc ttgactaagc cattgttctg caatttcttt     82620
     aaaacctttt gggctggcgg ttgtgtaaaa gtgatgacca ccgtgtttat tttgccaatt     82680
     atggtttatc tcaaaatagt tcaataaaac agaaatatca cgaacggttt ctgcgccact     82740
     atcaattaat ttaacctcag cccccataac attttgaatg atgggacgta ataagggata     82800
     atgcgtgcaa cctaaaatta aagtatctaa tttaccaact aatggggaca gcgtttcata     82860
     aaccaccttt ttggctaaac tagaagacat ctgatttgat tccacaattg gaacaaattt     82920
     cggacaagca agggatacca cagcagtatt tggagacaaa gcttgaattt tttgacgata     82980
     agcatctgat ttaacagtca tgggagtacc tataatacca actttccctg aattagttga     83040
     tttgatagct gcgctagctc ctggtaaaat aacgcctaaa acaggtatgt ctagtttttc     83100
     tttaatttct tgccaggcaa ctgcagttgc tgtattacaa gctataacaa tcatcttaac     83160
     atttttagtc aataagaaat taaccatctg ccaggtaaac tctctaatct gttgagcagg     83220
     tctaggacca tacggagctc tagcctgatc tccaatgaag attacttcct cttctggaag     83280
     ttgacggaac atttccttaa caaccgttaa accacctaca ccagaatcta gaaagccaat     83340
     aggcctacta tccattttta ttcctccaat attagtgact aaaagaggct ggacaacagt     83400
     cctagcctct ctatacaata accaatcagt caaatctaca cttgaccaag tttgcccaaa     83460
     tcttgtctag aaatctgatg gactatcact cactatttca tcactaaacg cttcaatgct     83520
     aaaacactct tattttttag ttttgatagc tgtttttgcg tgttttacaa tattacggta     83580
     tgtttgttga actttagctt cactaggttt ttgtcccatt tgactcatca tttcacgaat     83640
     agcatccggt gttaaacgag ggtgctctcc aatctctttt tcaatttgtt tacgagcaat     83700
     aaaaatgcct cccacgagac caccaaacaa agcgacgata attaataaaa tccaaatagt     83760
     tgttgacatc tattcattct cctcatttat ttacatgact cattatagca aaaaaagaaa     83820
     gagtttacaa atatatgtaa acaaaatcaa agcctctatc gtccttgtca cgtcaataca     83880
     ctattaaatt ttcactagag catgattaag cacatagccg attcctttat cttatcctaa     83940
     gtgttttccc caacttttgt gtcatccatt tccaaatgaa gagagctata taaaaatcta     84000
     ccaatccatg tagcagagag cctagcccta tcaaagaaaa tagtgaccat aaataagttg     84060
     aactactgtt agaagtcatt gtgattatat aaacagtaat aaattcgagc agaccatgaa     84120
     ttatgttaat agctacagca aataacaatg tttgccattt actcatcaat aaagagggct     84180
     ttgacttaat caagaaagcc gcaattaatg caaatccgat atgtgataaa gctctaagaa     84240
     cgattacaat cggaaaacca gctagtagaa atccaagtcc tgtccctaaa gctaccaata     84300
     ttgcaactgg aacagatata aaaatactta aaaataaagg tacatggctt gctaaggtga     84360
     aagaagcagg cccaataatt attttagcag gcatgattat aggaatcatg attgcaaaag     84420
     ctactaaaat agaagtataa gaaaccattt gtgttgtttt ttttgacatt tttatctcct     84480
     ttgaagctat tatacaaaat aaccttacag gtgtaaagac acctgtaagg ttatttgtct     84540
     atgtataaaa ttcctgcttt ttttagagcc tcacatattt ggtcaaaaac tgactgatct     84600
     tgacaagaaa tcatatgtgt atgtaaacca tctgtcaaag aggatagcaa ttctgcattg     84660
     gaaactttta atttagcagt aaaattatca atgtcttttt ggctttgaat gtttaaggga     84720
     gcagtcagca tcccataaat agggtgctct acctccacat tcataatgat tccttgatac     84780
     cgcaaaataa ttttcagttc ttcttctgtc tgttctatgc catgctgaca aaccaatcta     84840
     gctgtgaatt gatgagtact tagagcactg gacataaggt atccttttgg ggtagaaata     84900
     atatcacatt gttgtgcacg caataaggca atatctccaa caatcacctg cctactaaca     84960
     ctaaaaatct ttgctaatgt gcttgccgat atagcttctt ttgttccttt taaagtcgtt     85020
     aaaatatttt ctcgacgctc ctgtgccttc atataacaaa ttccttcttt ggtgttattt     85080
     cacaattaaa aactggctag aatatctaac cagttagcct caatcatttc gtgcaaaaag     85140
     acgaagaata tttaagaata gattaataaa atcaagataa aggcttagtg ccatcgaaac     85200
     tgcccaacca tctgcgactt ggccgccttg gctattgtag acatatttaa tcatttggtt     85260
     atcataagca atcaatccag aaaagatgat gacacatacg atactaatga tataactcat     85320
     acccccacta ccgataaata aattaacaag acttgcaatt aaaatcccaa ttaaagcagc     85380
     cattaacgct ttacgcatac ctgataaatc ttttttagtc ttagctccaa tcaaagccat     85440
     tgcaaagaaa acagctgcag atgttataaa agcttgaaga actgttgttt gcgtgtacct     85500
     tgcgataatg aaacttaaag taaacccatt caaagctgaa taaatcaaaa ataatggtaa     85560
     tgcagctggt gtgtttcgac gcgccgctcc actagcaaca aagactaaaa ccaattctaa     85620
     gatgattgct ccaaaataca accctggcat tttttgcatg atggcaatca tattttgtgg     85680
     aaacatatac agcataatcg cagaaacagc agctgacaaa cctactccta tccctacaag     85740
     accgtaaatc ttagcaaaaa attgattcag ccctgaatca gattgtgtgt aaatgacgtt     85800
     atcattcata tgtattttcc tattctaaat tttaatgatt gtgactacct aagaatttgc     85860
     gactaaaacg gataggtttc ttaaaaatac gtttgagtgg acgagaagcc tctcgtactg     85920
     cccaatactt atcaaccata gtcacaatat aactttcttt ataacgtggt ggtgcaatag     85980
     tcgctcccca catgtgtttc aaaataatat cttcttctct agcgtttaaa tcagttaatt     86040
     ttcgcgcatt acgaaccgct atccttggat gaacccaagc atggctcttg ttaaatttcg     86100
     ttacacgcca atcgtaataa aagaaatcat gtagtaaacc acctcgagca gtactactcg     86160
     catcccaacc aaacttctta gcaattttat aacttgtata actaacattt atagaatgct     86220
     ctaagcgagt tgagtgatga tgttggacaa tagcttcgag tttttggaaa cgtggatggt     86280
     caataaggtg accgaccaaa tccatgaagt ccttatcgtc ttgatacttt ttcattataa     86340
     tcacccctct ggggatatta taacatatga acttaaatta agctgaaaat gactactccc     86400
     gcagctactg ctacattaag actttctgct tgtccaggca tttcaatatg tgctagaaca     86460
     tctgcttctt ctgtcatagt tttggaaatt ccctgtccct catttcccat gattaaagca     86520
     aaatgatcat atttagggag atttttataa tttaccgatt gttcagataa agttgtcgca     86580
     atcatagtta tcccttctgc tttacaaaag ttaacaaact gctctatttc taccctaaat     86640
     actggtaaat gaaagtgact gccttgcata gaacgaagtg ttttttggtt atacaaatca     86700
     gcagatttct gagataaaaa aacagcatca aaattcgctg catctgcagt tcgaaccatt     86760
     gtccctaggt ttcctggatc ctgcacatct tccaatacaa gaaaacgccc ttttttaata     86820
     tctgtccatc ttgtctcttg aaaggcaatc tcagctacaa tcccttgagg agtctgtgag     86880
     tcagttaatt ctttcaaaac atcatctgta acaacaatag cttcctcggg ttttctcaaa     86940
     cgatctattg ccgtttctgt cacaaaaata tttaaaaatt gtgcaccata tttttcagct     87000
     tcctcaaata aatgccagcc ttcaataaga tatgaagatt tccgatattt tttttgtaac     87060
     aactttttcg tttttttaat gagattattt gattttgaag ttataatagt agtcataaac     87120
     ctattatatc agaaaagagg tcaagttatg aaaaaagttc atttaattgt ctcagggcgc     87180
     gttcaaggag tcggatttcg ctatgcaact tattccttag ctttagaaat aggtgatatt     87240
     tacggtcgcg tttggaataa cgatgatgga actgttgaaa ttttagcaca atccacagat     87300
     tcaaataaaa tgacacaatt tattcagaaa attcgaaaag gaccttcaaa atggtctaaa     87360
     gtaacttatg ttgatattaa actagataac ttcgatgatt ttaacgactt taaaatgagg     87420
     aattaaaaat cattctgcag aagtattgtt taattcttaa aaaaaaagta aaatagatag     87480
     gtatattaaa aattagagga actaaaaaca ttgaaaaaaa cattgaaacg tatcttattc     87540
     tctagcttat ctttgtctat attattatta ttgacaggat gtgttagcgt tgataaggct     87600
     ggaaaaccct atggagttat ctggaatact cttggagtgc ctatggccaa cctcattact     87660
     tatttcgctc aacaccaagg gcttggtttt ggtgtcgcta tcattattgt aaccatcatc     87720
     gtacgtgtca ttatcttacc acttggactt tatcagtctt ggaaagctag ctatcaagct     87780
     gaaaaaatgg cgtactttaa gcctttattc gaacctatca atgaacgact acgcaatgct     87840
     aaaacacaag aagaaaaatt agcagctcag acagaattaa tgacagctca acgtgagaat     87900
     ggccttagca tgtttggcgg tattggctgc ttgccattac tcattcagat gccatttttc     87960
     tcagctattt tctttgctgc acgctatact cctggagtct ctagtgcaac cttcttggga     88020
     cttaacttag gtcaaaagag tctgacactt actgtcatta tcgccattct ttattttgta     88080
     caatcttggt tgtcaatgca aggtgttcca gatgaacaac gtcagcaaat gaaaacaatg     88140
     atgtatgtga tgccaatagc gatggtattc atgtcaatta gtttacctgc tagtgttgcg     88200
     ctttattggt ttattggtgg tattttcagt attatccagc agctagttac cacttatgta     88260
     cttaagccta aactacgccg aaaagtagaa gaagaatata ctaaaaatcc tcctaaagcc     88320
     tacaaatcta ataacgcacg aaaagatgtt acaagttcaa ctaaaaccac tgaatctaat     88380
     caagcaatta ttacatctaa aaaaacaaat cgtaacgccg gaaaacaaaa aagacgggga     88440
     taaaacaagc atactaaata atggtgtgtt gtcctaaaca gttaaagatt attatgtaat     88500
     tcaagtaaaa aagacttagc tatgtagaac atagactaag tctttttagt tttgcctaac     88560
     ttttcatata aaaagcaccc taaaagtcag ataaaaatct agcttttaaa gtgcaagtaa     88620
     tctagctaac agactacctt attaataaag taatcgtttt tcccaccagt cttgaataat     88680
     tgcataaagc gtacaaatta cccaatagat aagggctact aagatatagg cggtcatata     88740
     gtcggagtag gttcccccaa ctattttagc attattaaag atatcaggta ccgtaatcat     88800
     cgcagtcaat gatgaaccct tgaccatatc tagcaaaaca ttacttaaag aagggagtgc     88860
     aattcttgtt gcttgcggaa taataatgcc tctataaatc gtcggtgttt ttaaccctaa     88920
     agctctagca gcttcccact gaccatgatc aacagctaaa agagctgctc tgataatttc     88980
     tgatatatat gcactagaca tcatggtaaa acctacgata gaagcagtca cagcatctaa     89040
     ctgtatccct ataaaaggca aaccaaagta gataagaaag agtagaacca ttaaaggaat     89100
     cccacgcatt aaggaaatat gaatattagc tagatacctc agtaagcgga gatgagacat     89160
     cttcattaga gctacaaaga atcctacgat agctcctaaa ataaaaccaa ccaaggataa     89220
     tccaatggta tatggtaacc cctgaataac acttggaaaa gccttaacag ctagttccaa     89280
     attaaaaatg gcatcccagt ttatcactta tctactcctc tcgaaatatt ttatttaact     89340
     ttaattactg gaattttatc tgttccagca ggttcttttg tgagatcttg accagcataa     89400
     tatttttcag agattttttt caaagaaccg tctttcttca tatccttgat agctgcatca     89460
     atttttgttt tgaggctctt atctttttta ctcatcacaa taccttgctc agtcggatta     89520
     tatttcacat cacccatttt tactttgata tctggatatt gttttgttac atattttaca     89580
     gcaatgactt gtgtgtagta atcattcgga ataaaatctg tacgtccagt tgatacatct     89640
     cgaaggtaaa cgtcattagt tacgttgtca taaataacag gttcagcgcc ttgctgtttt     89700
     gcaattttca tatattgcgt tccagcgcca ccaccagctt ttttaccttt ccagtcagat     89760
     aaatcttttg ctgtgatctt tgaagagcca tctgcacgta caatcatacc tccaacagaa     89820
     tatttataag gttgagagaa attgtatttt ttcaaacgct cgggagttgt gtcgaagtta     89880
     ttgacagcaa catccacctt gccactatct acagaagtaa atgattcagc aactccaact     89940
     tcaacaaact taacttttat cttaagtttt ttagcgatcg ctttcatcat atcaatctca     90000
     taaccagtca attttttatg gtcatcataa taacttgttg gataaagcgt tgcaggggta     90060
     gcaaccttaa ggacaccatc ttttttaata ttgtcccatg ttgtttcttt gctagattga     90120
     ccatttgagc aagctgctaa tgtcattgca gataaaccga ctaaaccaag taaaattgtc     90180
     tttttcataa gtactcctgt agattaaatt atattaaaat ggtttggcgt actctatcga     90240
     aaattaaatt taatgaaaat taatacataa atttacgata ataatacaac cattgttaag     90300
     agtaccatat tgtatccgtt ttcgcaaaaa tattgtttac ttttcaaatt aatggcaaac     90360
     aggccctttg aattgcttct ctttttcaaa caactctgca acagcaagca ataaatcttc     90420
     tctcccttta gccgctgtca attgtacacc taaaggtagc ccctctttag ttagatgagt     90480
     tggtatggct aaagaaggtt gcccagtcaa gtttggctga tgtgtaaaag gtgtccaggc     90540
     cattgagtct tcaaacattt tccaaattaa atcctgttgt tcacttactg agaattctct     90600
     catatgcctc aattgtttct ggagtgtctc gtctaaatca aattgtccat gaaaaggagc     90660
     tggttgatta gttgctgctg ttaaaattaa atcataattt tcatgaaacc tcgccatggt     90720
     ggctgcaaat tgatcccatg aatctaagag tttactgtaa tctttagcca ataccctttg     90780
     tccactctga tacatagccc aggtcattaa ttccatatcg ctaaattcca ttgaacgccc     90840
     taaactcttt tcgatgccat caaacattgc tgctgtttca acgctattca tcatacaata     90900
     agttttcata gaatgaatac catctaaagg ttgttctact aattctaaat gattcccttt     90960
     ttgagacaga aaatctgcgg cttctttaat agctgcttta gcctcacttg atacctttgt     91020
     ttttaaggga gaatccatca atactgctat ttttaggggt ttactaacgc taaactcgaa     91080
     aagactctct ttgctgagtt ttttcagggg aaatggactt tctacttgat atgattgtaa     91140
     ataatataat agtcgttttg tatctctaac tgactttgtt aaagcaaaat gactagaagc     91200
     cccttgccaa cctctatagg atgaaggtcc aacaggtata cgtcctcgac tcggttttaa     91260
     accaatcaaa ccattaaaac ttgctggaat tctgattgac cctcctccat cactagctcc     91320
     tgcaattgga accattcctg aactaacagc tgcggctgca ccaccactag agcctccagc     91380
     atttcttgaa tggtcaaatg gaagattaac attcccgtga agttgactat cactaatatt     91440
     cttaaaacca aattcagggg tatttgttct tcctaaaata ataaacccta atttttcaaa     91500
     ggactgcact aaatagtctg tttgtttagc ataatagtgt ttaaataatt gtgaacctga     91560
     ggttgagagc tgtccttttt gattctgtcc caaatctttc agaagaatag gaactcctgc     91620
     aaaaggagca tttgatgcat ttgcgtattt ggctgcttga cgcgcctcat tatattgctt     91680
     gctgacaaca gcattaacgc ttacattctg ttcctcgatc ttgtagattg cttgctctac     91740
     taattcttgc gacgaaacct tatgctgttt tatcgcttgt gccatagcgg tagcatcttt     91800
     aaaaaccata taaacacctc ataaaatgta tttttattat aagataacaa aaaatactta     91860
     aaaaaaatag aataacgtct agactctaga tattattcta tgatttatac tattaatttg     91920
     ttttttcaac actaatgatt tcaacttgat agctaccagc aggtgattca attgtagcta     91980
     agtctcctgt ttttttacca attaaagcat gagcaattgg gctttcattc gaaatttttc     92040
     ctgaaaaaat gtcagctcca gcagcaccaa cgatatggta agtatcttta tcatttgtac     92100
     caacttcttg gacaaggaca gttttaccaa ttgcaacctc atctttagca actgcatcac     92160
     tatcaataat ttcagcataa cgaatttttg tttctaaaat ttgaatttgg ccctcaacaa     92220
     atgcttgttc gtcttttgct gcatcatatt cgctattttc tgataagtcc ccataagaac     92280
     gagcaatctt gatacgctct acaacttctg gtctacgaac taattttaac tcttcaagtt     92340
     ctttttcaag ttgatctttt tccacttgtg tcattgggta agttttttct gccattttat     92400
     ttctcttttc ttttcatttt ttcaagtcaa agatataaac atgatgactc gcaccatgtt     92460
     tataagctta gttaatttga ctattgatat atttttcaac gttagccttg tgtgtttcaa     92520
     agtctttagc gtagtataca tttccggtct tcacatcagc gacaaaataa agataatctg     92580
     ttgaagcagg ttttatagtc gcttcaattg ctgagatact tggactatca actggtccag     92640
     gcatcaaacc agtattagta tagatgttgt atggtgattt aattgaagta ttaatttgag     92700
     catcttcagc taaacttgtt ttatcaccta atttccccat agcatacaaa attgcaatgt     92760
     tactttgaag agcttgaccg gctgataatc ggttataaaa gacacttgct attttacggc     92820
     gatcttcgtc tgttgatccc tctttttcaa caagagatga taatgtcaaa acatcattta     92880
     cagacatatt cttcgcttta atagtgttat agtaaggtgc catcttagta ttcattgttg     92940
     aaatcatatc ttcaacaagt ccttctaagg ttgtatcttt ataatagttg taagtagctg     93000
     ggaataaata tccttccaat tgataaatag cttttgattt atcaggtaga cttcctagta     93060
     aatttggata tttagctacc atttttttaa taaacgtttc atcttgaaca agtttcaaga     93120
     aatcatcagc tttataaggt gtacttgtag tctttgtatc aattttatta gactcaatag     93180
     ctttagcaat ctgtttaata gtgtaaccct cggtaattaa tatcttacct aaagctggtt     93240
     ttgtcggttc tgcagttccg cctttttcca attcagcagc aatctgatct aaagtcatac     93300
     tttttttaag attgtagtat ccactttgaa aattactata gtttttgaac ttggaatagt     93360
     aattaaagac tgtggcgctc ttaatgactc ctgctttttc taaaatttga ccaattaatt     93420
     tattcccaga tcctatcgga atttcaactt gtacaaattt atttgaattg gaatcaacag     93480
     gtttaatagc actatctaca aaacgataac ctacaaatgc tgtcaagagc aatacaagta     93540
     tgataattga tatcagaata cgtgcaattc gttttgccac attatctgct ttctgacgtc     93600
     tttcacgctt gttatgtttg ttcttggctg acaaagctat atcctcttct tcttttgaca     93660
     aatcctctac tcggataggt tcctttgcta cgggctctaa ctctgatgtc tcaccaagtt     93720
     ttacattttc accttctgta ggaatatctg ttgctctcac aagaaagatt tcttccgttt     93780
     cttgattagg cacagcagtt gcaacatcag tcttatctgc ttttaaatct atgtcaggta     93840
     cattttcagt tgtcctaaat tcactagatt tggagccgct atcaagctct cttgaaggtt     93900
     ccatcccttg attgataact tgttcttctt gggaagctaa tgcttgttcc gcctgacgtc     93960
     tttcttcttc tcgagcagct tctgccagaa gtttcgcctc aatccgagcc ttctcttgct     94020
     cttctaagcg ttgcttagtc tctagcgcct ttgctctagc ttcttgttcg tctttcaaac     94080
     gttgcgcttc ataatctgcc atcaattgtg ctgttctgcg agcagcttct ttggcttctt     94140
     gctctttttg atagagttct tcttcacgca actttctcaa acggttagct tcttctaact     94200
     ctgccagaat ttgttcttta aaacttttct gatcatggtt agaatgctga tcgtcattaa     94260
     attcggtcaa agagatttcc tcctaataat aatcacaggc aattatatct taaatagtct     94320
     ataaaatcaa caaaactttg acaatgttat ctacttttaa caaattgatc gtgttggatt     94380
     attccaaatc atattatacc aaagcgaacc accatgttgg gagtcagatt ctccctcatc     94440
     tttaaatcca ttcatttcat agaaggaaat taaatcatca tggcaagtta aacttatacc     94500
     atctcgttct tgagaaacaa ccaggtcttt catcgctgct aataatgctg taccaatccc     94560
     ctgaccttta aaatcaggat gtattgatag actagtaatt cctataaaac caccttccct     94620
     tacagggatt tcagaaactt tatggaataa atcgtccgtt aagtaccgac ctttaataac     94680
     cggtccttca atgtaacctg ctaaacgacc attaatctct gcaactaaaa aagtatcagt     94740
     cattatcatt aaacgttctt gcattgcttt tttactcgca gcctctgctt ctgaaaaatt     94800
     tattcgttca atactaatga cttgctgtaa atcctctagg caaccatttc taataatcat     94860
     actcatctcc ttaatttctt tatgaaattc tcttgataaa gtcagataga ggactgagaa     94920
     acttctctca gcccttacta tcaacttatt gtgtattttt agttaggtta gctaataatt     94980
     cttcaaaaga gcgctcatac aattgaatgt ctccagcacc cataaagaca tagacagcat     95040
     tatcatgatt gagtaaaggc gagacatttt cgactgtcac taaatctgag tgtttgacaa     95100
     tcttagcagc taaatcttct accttcacct caccattatc tacttctcta gcagaaccat     95160
     atatttgagc aagataaacg ctatccgctt gactcaaagc atgggcaaaa tcgtctaaaa     95220
     gagctatcgt acgagtgaac gtatgcggtt ggaaaatagc tacaatttct tttgacgggt     95280
     atttttgtcg agcagcatct aatgtcgcaa taatctcagt aggatggtga gcaaagtcat     95340
     caataatgac agtatcgtca ataatcttct cagtaaaacg acgttttacc cctgaaaatg     95400
     tcttcaaatg ctcagctact aatgccatat caattcccat tatgtaaagg ttagcaataa     95460
     cagcagttgc atttaagata ttatgtttac cgtatgctgg tacatgaaac tgaccaattt     95520
     cttcttggtt atagaaaacc ttaaagtcag aaccattaac agttcgagtg atgtcttttg     95580
     ctataaaatc atttgaatct tcaaaaccat aataatatat tggtgcctta gaagtgattt     95640
     catgaagttt tgaatcttct ccataaatga ataaaccttt ttgaacttgc ttagcatagt     95700
     cattaaaagc attgaatacg tcctctaggc ctgtaaaata atcaggatgg tcaaaatcaa     95760
     tattggtaat aattgagtat tctggatggt acggcataaa atgacgttcg tattcatcag     95820
     cttcaaacac aaagtaatta gcattagcag aaccacgtcc tgtaccatct ccaattagga     95880
     aagaagtgtc tgtaatattt tttaaaacat gagctaataa acctgtcgtt gaggtttttc     95940
     catgtgcccc agctacacct agactagtga actgacgcat aaaatctccg agaaattcat     96000
     gatatcgttt aaaatgatag cccttttcaa taacataagc caactcttca ttgttatctg     96060
     gacgaaaagc atttcctgca ataatctcta aatcctcact gatattattc ggtgagaaag     96120
     gtaatatagt tacacctgct tgctctaaac cacgttgggt aaaataatat ttgtcaacgt     96180
     cacttccttg gacgttatgt cccatttgat gaagcatcag tgctagggca ctcattccgg     96240
     atcctttaat accaataaaa tgataagttt ttgacatggt ctctccttaa ttaatgtctt     96300
     taaaacgtgt cagatttaat tcttgagcct tggctctttc tttgtgaaac tgattgtctt     96360
     gtttattgta aacttgactg cgtttcaaaa aatcaaaatt atttttcttt gtttttgggt     96420
     tcggtgtatt atcaggttct tgaaatatga ttggaatttc tgctaatata tagctttcct     96480
     gctgtaaacg atcagaaaga tgacttagtt cagtcacctt tcgctgagtt tgttttttcg     96540
     gtactgttgc cttcaattgt tgctgaaaag cttcctttga tggcgcctta aattcctgtt     96600
     tcgcatagta agcttgtcgt ttctcccgaa cagacctctt tgcctcttgt cgagatttgc     96660
     tcaactctgt cgcttttttt acaaaactct gcggtggtac aggatcattt tcaattacct     96720
     taggatgtga tatttcttca tgttcataat tgcttttgac catgctttga tatgtttttt     96780
     cttgataaaa gcctcgaatg ttgttaatta aatcttcatt atcataaaga ttcatcttta     96840
     caagcggaga cattactggt tcatcatctg ctatcaacgg aaatcgtcta gagcctctat     96900
     tcacattatc acttcctttc tacaacagac ctattataaa ctaatttttc tgttttttca     96960
     aagttttcaa ctaagtaaag cttatcagat tggtattttt cattcattta tataaaaaag     97020
     aaagcgagag accactttct tttttatatt atagtcacat tatcatattt atttagaaac     97080
     tccaagtatc tctcgaatat catctacact catgctagca tgggtttcat ttccatccag     97140
     aactgttgta accaaatgtt ttttagtttc ttgcatttct agaatttttt cttcgattgt     97200
     gcctctagta atcaagcgat aaacctcgac attctctttt tgccccaacc tatgtgcgcg     97260
     actaatcgcc tgcatttcaa cagctggatt ccaccacaag tcaatcagaa caacggtatc     97320
     agctcctgta aggttgagac caacgccacc agcttttaaa gaaatcaaga aagcatcttt     97380
     tgatcctgca ttaaatgctc tggtcatttc atgacgttca tttgctggtg tagaaccagt     97440
     aattttataa gttgtaagcc ccatagctac catctcacgt tctgcgatat ctaacatacc     97500
     cctgaactga gaaaaaatca gagcacgatg tccattttcc ttaatttgtg ttaaaagttg     97560
     atgtaggctt tctaacttac cgctttcacc atcataatcc ataaaaagac gtggagtgtc     97620
     gcaaatttga cgtaatcgtg tgatgccaga taaaatttca attttacgac gatttaagtc     97680
     agcgtcacta gaatgttgga tactttcttg aatttggcgt aattgcgcca aatagataac     97740
     tttttgactg tctgtcattt catttggata gttcatttca atcaaatccg gtaattctgg     97800
     gagaacttct tcttttcgac gtctcatcac aaatggtttg atataacgag caacttgttt     97860
     agggttcaac ttcaaaaact ctttcttacc aggtaataaa ccaggtaaaa tgatctggaa     97920
     aatggaccaa atttctaaca gtttattctc aataggtgtt cccgataatg caaaacagtt     97980
     tttgacctca aaagatctca agctatgggc tattttagtt tgagcatttt tcataacctg     98040
     tgcttcatcc aaaattaaat aatcataatt tccttcagaa taagtctcaa aatcctgcct     98100
     aaatgatgaa taacttgtaa tgattacttg atgacgttca gcaataattt catctctacg     98160
     aatcttagaa ccataggcaa ctgctacatc tacgtctggc gcaaatttgt ggaattcatc     98220
     ttgccaatta taaattaaac ttgatggtga taaaataagc acacgagaat ctctagttag     98280
     ttttgtactt aaaaatgaaa tcgtttgaag tgtttttcca agccccatat catcagctaa     98340
     aatccctgca aagccataat gatctaacat acttaaccaa cggacacctg taagctgata     98400
     atcgcgcaag gaagctgaaa cagatagacc aggtatttta aacttttctg ggtgtctcaa     98460
     atcttcaatc aattggtaaa aatgttgtga aaagctaaca ttatcttgat ttgcaaacag     98520
     ttctgataat tgaaatgctg caatattatc taattcaata tgcccattct ttgctcgtct     98580
     agctctcaac ccttgcaaag ttgcacttac tttcttagtc tcttcatcaa aaataactaa     98640
     ttgccctgat ttattcacaa aataaggatt attgtcaaac aaagctacca gagcttgatc     98700
     aacatcgttt tccagtaaat cagagaaatc aaaagaaata tctagcaggc ttcccttagc     98760
     ttcaatatca atttgcggtc gttctatgag acgataactt tccaattttg cggataagct     98820
     cactgttccc atttttttaa attgtggaag catataggta taaaaatcgt ataattcttg     98880
     tgcactgtat gctggatggc tggttgaaaa gtggggtgca aagccatatc tttctaagag     98940
     tttaaatatt ttttcttcat gtttgaagtg actagcaaat gttaactgtt ctagttcttg     99000
     acgattatga acagttaaat cattaccata atcaaatacc atttgcaata aaatttcatt     99060
     ttgactatta atatcgaact caaaatttac cttaaaatca tgaatagaga agctccgtgg     99120
     agcatctact agtccaatct ccttaaaatc cagtaaatga gctgctaact tatcttgatc     99180
     atctaaatca aaatggatat gttttgctaa atctccctca atgggaagac tacgaatagc     99240
     cgttaccatc ttttcttgct tcaaattaag atggtagaaa gtatcgcgat aaaacaaata     99300
     agaattcgca aatagtggtt ttaagtcttt ctctttgatt tctaattcaa ttgattgcct     99360
     atggacaata accttaaatt gataaagatg atcctcacct tctaattcct taaagtagag     99420
     gtgattaaat tgatgaaaat cactttcaaa tgaaaaattt tctaaagcat tcatcaaagt     99480
     aacgccctct tcaaaaaaac cacgagtgag actaaggtga cgaccttgat ttggtaaaat     99540
     aaactctaga tcaattttgc ttgaatgact tggaatgagc ctccataaaa attctatcaa     99600
     ttcttgactg gtctcatcaa actgtatcaa agacaaagtt tcaaagtatt gttttccaat     99660
     ctgataataa gcttcttttc gaacagtatt taaaaaagct ttgatgtcac gaataacata     99720
     acttctatca tcaggcagtc gtctaatttt taaagtccac cagatatcat tagcataagg     99780
     attttgttct ccttgagccg atagttgata ttttatagta tcatcttcat taataattag     99840
     actatctaaa aaaacactac caaaagaggt tttcttctta gtttcttgtt gactttcttg     99900
     ttgaacttga actttagata agattgcttt accctctggg tcgtttttca agaaatgctc     99960
     cagagcagct aaatgttgac aatagccttt tcttgcaaaa aaatcacaag aacattttgt    100020
     ttcttctgtt actaatgaat attcaatctg acaatcccca actttagctt ttaatagatt    100080
     accttcttga gaaatcaagg acaccaaacc ttgttcgtag agttctatac cttgatttcg    100140
     aatacgtcct ggaatcattc tactcattat gctaccacct tcatcttatc cctcaattat    100200
     aacaaaattc aagtccaatt tcttgtaaaa atactaaatt gattgttttt tgatacagta    100260
     acaaataaaa aaaggctaaa acaactgtcc taaccttcta tttcaatttc aacaataaga    100320
     tgttatttac gtttacgtgc tattagatta attggtgttc cttcaaaaac aaatgcttca    100380
     cggatttgat tttctaagaa acgaagatat gaaaagtgca tcaattcttc ttcgttaaca    100440
     aaaacaacga aagttggtgg tttaacagca acttgagttg cgtagaaaat cttaagacgt    100500
     tttcctttat cagttggtgt tggattaata gcaatagcat ccataatcac atcatttaat    100560
     acagcagacg gaatacgttt gttttgactt tcgctaatac gtttaatcat atctggtagc    100620
     ttgtgcaaac gttgttttgt ctctgcagaa acaaagataa ttggcgcata agacaagaat    100680
     tggaagttat ctcgtatatc agcttcccac tgactgacag tatgactgtc tttttcgata    100740
     gtatcccatt tattaactac aataataata cctttaccag cttcatgtgc aaaccctgca    100800
     atacgcttgt catactcacg aataccttcc tctgcattaa tcaccataag aacaacatct    100860
     gagcggtcga tggcgcgcat agaacgcata acagaatatt tctctgtgtt ttcatatacc    100920
     ttaccagatt tacgcatacc agcagtatca atcatagtat actcttgccc ctggctatca    100980
     acgaaattag tatcaatagc atcgcgcgta gtaccagcaa ctgggctagc aataacacgg    101040
     tcttccccaa ggatggcatt aattaaacta gatttcccaa catttggacg tccaatcaaa    101100
     ctaaaacgaa taatatctgg attttcattt tcctcttcta ccggaagatt ttccacaata    101160
     gcatccaata tatcaccagt accaatacca tgaactgatg acaagggata aggatcccct    101220
     aaaccaagag agtagaaatc gtaaatatca ttacgcatct caggattatc taccttatta    101280
     acagctaaaa taaccggttt attggtctta taaagaataa gtgagacata ctcatctgca    101340
     tcagtcacac cttctttacc cgacacaaca aacacaataa catcagcctc tgtcatagca    101400
     atgtctgctt ggtgcttaat ttgctccata aacggtgcat caacatcatc aatcccacca    101460
     gtatcaatta atgaaaactt acgatttagc cactcacccg ttgtatagat acgatcacga    101520
     gtgactcctt caacgtcctc aacaatggaa atacgttctc ctgcaattct gttaaataat    101580
     gttgattttc caacattcgg acgaccaaca atagcaactg taggtaatac cataattctc    101640
     ctctcactat tgggaatact cccaattcca ttctatttta ttaacggcga ttcggtcctt    101700
     ctaagtggaa ttctatcgct aaataccgta cgcgctccat aactcgtttc gcttgccaag    101760
     tttcgtcgct tccttttata ttagcccatt ttctttccaa atcgttaaaa ctataatttg    101820
     acgtaaagaa agtgggcaac tcttctagca tacgatgttg taatataact tgtaaaatct    101880
     cgtcacgaac ccaagacgtt gcctgttcag ccccaatatc atctaaaatc aaaattggaa    101940
     cacttttcac agcatcaatt tcatctttta cagttccgct tgaaatagca tttttgacat    102000
     caatagcaaa actagggaaa tgaagaagag tcgttgacac accctttctc tctgataatt    102060
     ccctcgccat tgctgccatt aaataggatt tcccaacccc catatctcca tataaataaa    102120
     gccccttatg attatatgaa ggataagtct ctacaaaatc aagcagttgt gacatagctt    102180
     tcattcgact ctcgttatta atatcaaaat cagtcattct gatattccga taggacttgg    102240
     gtagattaac taaattaata cgatcactga tagcttgttt tttttgtgct tcaattaact    102300
     ctcgtgtttc taaataagaa acatctgcat aaccttcatt cataaccaaa ataggctcat    102360
     agcctttagc aatatattga ctatccttat ttttaaattt ctgacgctca atcaaaaatt    102420
     gattaaattt agacatgctg atatttattt cacgctgaga aagttggtgg gttttaatga    102480
     actccgctac ctgagcatct gataaaatca tttgaataag ctcatcattt gtattgcgag    102540
     gcactctccc ttgattttct aatgcttgtc ccactgattt catgattcac catcctttcc    102600
     taatcgttct aaacgcttga gggcatccgt tttaaactgt tctaattcaa tttctttttc    102660
     tgggctaacc tcatctttat aatcaggatt actccattca ggaacattcg attgtttctt    102720
     cttcgtttct gttttagtcc ttactttttg atctgaaaaa tcacgaattt taagcacagc    102780
     atcttcggcc gtcataacat tctgaaaggc aaaatcatta gcaactttca tgatataggc    102840
     cttatttaag ttagcagatt ttgtcttatt caaggtatat aaaaccataa cattaatgac    102900
     ttcgtctagg aaattcattt ttgccaaatc ctcaagtaaa gtcttctcac cacttgttgt    102960
     cactgcctta cggcttctct tgattttttc aaggaacact agagcactat catttttaga    103020
     ttcccttagt atgacctttt cattatttgt aaaactctga ttatctttaa tatgctgccc    103080
     ctcattttgt tgaactttca ttcgctgagg cgcaatcatt ccattgatag ctgtttgttt    103140
     tgctaattga taggtatcat accaatttaa atgataaagt tctgatacac tataaatacc    103200
     taagacatca tctttttcat tgttaaagcg taagccatct cgcatcatca aacgtttgaa    103260
     actttccaag tcaaaaacat ttttactccg gtttacctct tgttttggtt gtcctaaatc    103320
     cgagaaaaca tctgtaaatt ttttagagat atctctagca tttttaggta ttttcatatc    103380
     taattctgcc actgctacct ctcctatacg tttttctaac aaacgacgat agatgggatt    103440
     agataaaaat aactcatttg acatagcttg attcaactta acaaggtaag tacctgtggc    103500
     ttggtaaaca gtcaacaaat ccaaagctgt taacattacc aatgcatctt gaaatcttgg    103560
     catcccgtat tgcagatgat tgagaacctc tgaaaattta tgacgtcgta ttccgtcatc    103620
     aaaaaaatga acaaaataat catagagtgc catggcatca cttcccataa ttgggaaata    103680
     caattgtatt aaactattac tatcataaac aatcttattt tgcttaatat atgtaaactc    103740
     atctattgga ctcatcacac gctaccactc tttttactcc gtacgcgctt tgtaatttgt    103800
     tgaagtagtt cttcaatttc gtctacatct ttaaaagatt tataaacact agcaaagcgc    103860
     acataagtaa tctcatctaa ttcggcgagt tcatccatca ctaaatttcc gatagtgata    103920
     ctagaaacct catcttcata ctcactccta attttacgtt cgatacgtaa aatacaattt    103980
     tcaatatctt cgctcgaaac agggcgtttt tgagcactct gaataatacc attcaaaatt    104040
     ttatctcgag aaaattgctc gcgagtacca tctttcttta tgactaaaag aggcaattct    104100
     tccaaacgtt caaatgttgt aaagcggttg ccacattttt cgcactctct ccggcgtcta    104160
     atagtcgtac cttcttcagc ttgtcggcta tcaaccacac tagatttatt atagccacat    104220
     tttggacaac gcatgtcaac acccctattc tatcatatca tttaatcatc ttattttaac    104280
     acaaattcag taataacaaa agaagcgcct ctcttatcac ctcatcatat caaaacacaa    104340
     aataatcctt atgcctttta tcattaagca taaggatttt tcttatattt ctttagtttc    104400
     ttcaaatttt tttataggaa tgcgaacaat gaattcagtc ccttgattta gttcactttt    104460
     aatatccacc tttaaatggt aagcatccat aatttgttta aacactgaga gcccgatacc    104520
     taaaccagct tgtgtacttt ctctgttacg tgatttatca gttcgataaa aacgatcaaa    104580
     gataaactca atatcttcat ctgagatacc ttctccttta tcttttacaa ctactgtcgc    104640
     aaaatcattg tctactgata aaacaacact gacttcttta taactaggag aatacttgat    104700
     agcgttatca attaagatca tgagagcttg ctcaaaatgt atcttatata tctttcccca    104760
     aacgatatct gaaatattat tttcaaaaat aaattgaaaa tcttctctca aaatacggaa    104820
     attttcaata acaactgata tagagcttga taaatctgtc acttcatctt gatgaagttc    104880
     caagcttcct tggacacgga tcatatttaa catgtcatta atcattaagg acatacgatc    104940
     tgcctcatgg tatgccgctg ctaaactttc ttcaagaatt tctggatcat ctttccccca    105000
     acgttgtaat aaaccaatat gaccctttac aacagcgaca ggcgttctta attcatgact    105060
     aacatcacta atgaattgtg attgtcgacg agtatagtct tccaactgat ccaacatccc    105120
     atcaaaaatc ctagacaatt ctccaatttc gtcttctgaa cggaccttac ttctaatttc    105180
     taagttacta ggattttcag atatctgatg cattaagtcg tgtaaatttt taaccggacg    105240
     aacaatacgc ttagtagcac tattaataac gaccaaggct aaaacagtcc ctaaaacttc    105300
     catcataatc aagaaaacaa tgatgttttg cctcatacta taataacgac ctaaattata    105360
     gaaaatttga acgtatccaa gcaactgtcc tgttttttga gagtagattg cttttgtacc    105420
     aacaaaacct tccatatctg caactttaga gatgataact tttcccatgg atttaccaat    105480
     agttggcata cccgttctca gtgtagaaaa aactggtttc ctgttgacat cgtatagggt    105540
     catttcttga ttagcataaa gaatactatc gattgactcg cccgttctaa caattccatt    105600
     ttgacgctta tgaggataga tgtcatccgc aaaaacctgg ttgtacagga tctctaaaat    105660
     atcatcggat gtcaaactag agttcgcttg cgacaaacga actctagttt tttctaatga    105720
     cctaccgaca ttaatttttt ccctgtgaag gacgtatctt gttgccgaag tataaactaa    105780
     aacagaaaat actgtaaata ggctaaaaaa taagataaaa actaattgcg ataatttttt    105840
     tgacagaggt tgttttaccc ctataaactg atctttttta tttttcacga atcacatagc    105900
     ccattccgcg aacagtttga atatatgatt cacgacctgg gatatcaatt ttacctctta    105960
     ggtaacggat ataaacatca acaacgtttg tctctgctgc cacatcgtat ttccaaacat    106020
     gttctagcaa ctcttctcgt gtcataacac gattcatatt tgtcatcaag acattcaaca    106080
     aatcaaattc acgttttgtt agtgaaattt cctcatcacc acgcatcgct gaacgattat    106140
     gagtatttaa tgacaaatca cggaaactac cactatcacc tttttctttt gtcttcgttt    106200
     caatttcttg gcgtcggaaa atcgctctaa cacgtgctaa taattcttcg attgcaaacg    106260
     gcttaacaat ataatcatct gctccacgat caagaccagc tacaatatcc ataacagaat    106320
     cacgtgctgt catcatcatg atataggttg ttttttcagc ctgcaggcga cgtgtgattt    106380
     cgaaaccatc catctctgga agcattaaat ccagtagaat caaatcaaaa tctttttcta    106440
     atgctgtgtc caatccttca cgaccgtttg tttcaacaac aacatcatat ccttcatgta    106500
     gtagttctaa cgagacgaag cgagctaaat ttttctcatc ttcgattatt aagatctttt    106560
     tacccatcta caccaacctt cttattcttt acttaacact atcaattatt ttttagaata    106620
     tctagataaa aaacaagata gcccacattt tactaacgtt tctttaaata aataaatcgc    106680
     catcccaaac aattgttcga tagcgagact taatttttat tattgagtag tgtcctctgt    106740
     cacttttcaa ttctactaaa aaaaaattaa aatatcaact gatgttatta ataattttta    106800
     tctaatcact atcaaacata ccttctaagg ctgcgaaagg attagatttt tctttttctt    106860
     tagcttgttt ttcttcatac tgcttttcag tcattaacga ccaattttta cctgataaat    106920
     ccgcttctac cccaacctca tcagctgcca gaacacgaag aggtatattt aacaagatat    106980
     tatcgataac gctttcttct aaattaatat catcttcctc taatattaag accaaatcct    107040
     gatcaacgag ctctttttta gtgctaacat tttcagcttc aataaaaact tcattaatag    107100
     tttgcttttc agataaaaca actggtttca tagaacgact agacggtaat gtaatatcgt    107160
     aagccatatt atagtcaagt agatagagac catcttcata caccacatga cctgaaactt    107220
     gaatatcaga aatatccatt atctctgaat gacgctccat aagcgactct ttgatatcta    107280
     tttttttatc aaaataaagc ccctctggtg attttttgat ttctgtaagt aacacgtgcc    107340
     atctcccttt atagtatatg tcatattata tcaagtttta aaggctttgt cttaaaaaaa    107400
     caaaacgcaa ggcataacta ccctacgttt tgttaacagc tacatatgac gcaaacgctc    107460
     aatacgatct gcaattggtg gatgcgtata aaataaagac tttaaccctt cttttttcgt    107520
     tgggtcattg atatagagag ccgcactagc atcatctact ggatgcccca taggttcaga    107580
     acgatcaagt ttttctaaag cagagatcat cccttgtgga tttcttgtta actcaacaga    107640
     actagcgtct gctaagtatt cgcgctgtct tgaaatagct aattgaacta aactagcggc    107700
     taatggtgca aggattagtg ataaaataga gaaaatcaaa accaagatgt ttcctccatc    107760
     ttctctgtca tcatcacgcc tacgacctcc gccgtaaaat aacatacggc taccaatgct    107820
     tgatattaga gttacagcac tcgctaaagc tactgcaatg gttgaaatac ggatatcata    107880
     attacgaata tgactaacct catgtccaat aacaccctct agctcttcgc ggttcataac    107940
     agctaatagg cccgttgttg ctgcaacagc agcattttct ggcttagagc ctgtggcaaa    108000
     ggcatttagg gagtcatctt caacaatgaa aacgcgtggc ataggtatct gagctaccat    108060
     tgccatatct tcaacaatat gaaaataatt tggcgcctca tcttctgtaa cttcacgcgc    108120
     attgttcatt gacataacaa cattagttga ttgaaaaatc atacttactg catagataac    108180
     cccaataatt agagctagaa caagcccaaa ttggtagctg cctaatacca aataacctac    108240
     agctgctcca atagctgcta aaagacagaa gaagacaatt aacaagacaa ctgtttttct    108300
     cttattactt gcaatttgtt gatacagcaa aagcctctct cccttctcaa ttaaaagtca    108360
     aaggaaactt ttggcacttc tttttcttct tcaggagttt ctaagaattg gcttggtttg    108420
     aacccaaata gttttccaac aatattactt gggaaagttt ctaattttac attataatta    108480
     gatgttgttg tgttatataa ctgacgtgaa taagaaattt tattttccgt attagttagt    108540
     tcttcttgaa gtttaacaaa gctattgttg gcttttaaat ctgggtaatt ttcagcaacc    108600
     gctaaaatac ttgaaagctg tcttgttagc tcattacttg ctgtcattgc ttcagcaggt    108660
     gtgttagctt tagcaacttg agcacgcagt tctgcaatct tctcaagtgt tttcccttcg    108720
     tacgcagcat agcctttaac agtttcgatt aggtttggaa ttaaatcgtt acgacgtttc    108780
     aattgaacgt ctatttgact ccatgattct ttagtatgca tgcgacttct aactaaactg    108840
     ttataagcaa caatcaacca aataacaaac aaagcaataa ttgctattaa aatcatagtt    108900
     cccatagtag tagctccttt acattttttc cattatagca attttcttta gattaggaaa    108960
     gtcctgttat tcccattatt agtatttgtg ataaaataga gtcattatac gatatagaaa    109020
     ttgaggttta ctatgacacc ccaagcattt tatcaagttc tgatagagca tggtattaca    109080
     cttactgaca aacagaaaaa acaatttgaa acttatttta gacttcttgt tgaatggaat    109140
     gagaaaatta acctaacagc tattacagat aaggaagagg tttacttaaa gcacttctat    109200
     gattctattg cgccgatttt acaaggttat attgacaata gtcctcttag cattttagat    109260
     attggtgctg gtgcaggttt tcctagtatt cctatgaaaa tcctttatcc tgaaattgat    109320
     attactatta ttgattcact gaataaacgc attaattttc taaacatatt agctaatgaa    109380
     cttgaacttt caggagttca cttcttccat gggcgcgctg aggactttgg tcaagataaa    109440
     gtatttcgag ctaaatttga tatcgtaaca gctcgtgcag tagctagaat gcaggttcta    109500
     gcagaattga caataccttt tcttaaagtt aatggtcgct tgattgcact gaaagctgca    109560
     gctgctgaag aggaattaat ttctgcagaa aaagctttga aaacactatt ttcacaagta    109620
     actgtaaata aaaattataa gttacctaat ggtgatgacc gaaatatcac aatcgttagc    109680
     aagaaaaaag aaacgcctaa taaataccct cgtaaagctg gtactccaaa caagaagcct    109740
     ttgtaaagtt gggagctagt atgaaacatt tctttgatta caagacaatg tctgtcgcac    109800
     gtaaactcag cattagtttt atcgctgtta tcctattggg aagtatttta ctttcacttc    109860
     caatttttca atatgctaac gcccctaaaa cacattacat tgatcacctt ttcacgactg    109920
     tttcaatggt atgtgtaact ggtttatctg tttttcctat cagtaaggtt tataacggtt    109980
     gggggcagat tgtagctatt ttactcatgc aaacaggggg acttggttta gtaacactaa    110040
     tgtcgttgtc ttactatacc ctaagacgta aaatgtcgtt aaatgatcag acccttttgc    110100
     agtcagcgat aacttataac agttcgacag atttaaaaaa atatctctat atgattttta    110160
     aagtaacttt aactttagaa gttttagcag ccagcatttt agccatagat tttattcctc    110220
     gatttggttt gggtcatggt atctttaata gtatattctt agctgtctca gccttttgta    110280
     atgccggttt tgataatcta ggggcaacga gcttagctca atttaaacta aatcctttgg    110340
     ttaacattat cgtttgtttc ttgattattt caggaggact tggatttgcc gtatggaaag    110400
     atttaattga agctactata caaacatctc acaagggacc aaaattaatc aagacatttc    110460
     caaaacgcct cagcaaccat tctaaactgg ttttaaaaac aacaaccatt attttactaa    110520
     caggaacttt gctttcttgg ttgttagagt ttggaaattt tagaacaatt gctaatttat    110580
     ctctacctaa acaactaatg gtcagctttt tccaaacagt tacgatgcgt accgctggat    110640
     tttcaactat tgattatacc caaactgatt tcgcaaccaa ccttgtttat attatccaaa    110700
     tgttaattgg aggagctcct ggtggaacgg caggaggatt taaagtcact gttatcgcca    110760
     ttttactctt actatttaag gccgaactga gtggccaaag ccaagtgact tttcattatc    110820
     gaacaattcc ttccagtatt attaaacaaa cactatcgat tttaactttc ttttttatca    110880
     tacttattag cggctatctc cttcttctgg aactcaatcc ccatatagat cctttttctc    110940
     ttttctttga ggcatctagt gccttagcaa ccgtgggtgt gacaatgaac actaccaatc    111000
     aattaagtct gggcggtcga attgtaatta tgttcctcat gtttattggt cgagtcggtc    111060
     caattaccgt actgctatca attcttcaga aaaaagagaa ggaaattcac tatgctgaaa    111120
     cagaaattat tctaggttag aaaaggtctt ttatgaaaac aaaaattatt ggtgtacttg    111180
     gtctaggaat atttggacaa acactcgcac aagaactaag taactttgaa caagatgtta    111240
     ttgctattga cagcaatcct gaaaatgtac aagctgtcgc tgaagttgtt acaaaagcag    111300
     ctatcggaga cattactgat ttagctttcc taaaacacat cgggatcagt gactgtgata    111360
     ctgttattat tgctacagga aacagtttag agagctcagt attggccgta atgcactgta    111420
     aaaagttagg cgtccctcaa gttattgcta aagctcgaaa ccttgtatac gaagaagtac    111480
     tttatgaaat tggtgctgat ttggttatct ctccggagcg agaatctggg caaaatgttg    111540
     ctgcaaacct catgagaaat aaaattacag atgtcttcca gattgaatct gatatttctg    111600
     tcattgaatt taaaattccc aaatcatggg tagggaaaac tgtcgaacaa ttaaatatcc    111660
     gtcacaagtt tgatcttaac ctcataggta ttagaaaagc aaaaaacaaa cctatcgata    111720
     ccgaagttcc aatcaatagt ccacttgaag aaggtattat tctagtggct atcgctaact    111780
     cagatgcctt ccaacgctat gactatttag gatactttaa ctaaagaaaa taaaaaactg    111840
     actattaagg tcagtttttt attgccatgg gttatagaaa cgtccatgat taaggtgaat    111900
     taaataaagg cttacaaaca gactagctag agcaagtatg attaagacaa tgtcactttt    111960
     ttccaaagat tgcttagagt accaagtacg tcttttattt ttaccaaatc gtcgaagttc    112020
     catagcagtt gctactgtat caatacgttc tagagagcta aaaattaatg gtgtgacaat    112080
     ctgtaaattc cccttaatgc gtgctactaa gttcgatttt tttgataatt ctattcctct    112140
     tgcctcttgt gctcgacgta ttgtataaaa ttcttcttga acatcaggta tatatctaag    112200
     ggtcaaacta acagcataag ctattttata tgataaacct aattgattta aacttgatgc    112260
     gaactgacta ggattagttg tcatcaaaaa caaaagagct aaaggcactg tacaaaagta    112320
     ttttaaaatc agattaaaga ggtaaaacaa ctcttggcta gtcacatcat acgggccaat    112380
     tccttttaac aataaagaag aactaccata aatcttatca ccataatggg gagcaaaaag    112440
     atagaccatt ataatattta aaacagcgaa tacaacaact aaagtcataa caaaggacac    112500
     ctgttgccat ttgatttttg ctaatctaaa taagactagc gatcccaatg aaacaagaat    112560
     taaaaatctt gtatcataag tggtcatgca agcaacagaa actaaaataa aaaatagtaa    112620
     cttactggca cctgatagtc tgtatagaaa gccataaccc tcttgataac caattaattg    112680
     attagccatt cttacctcct tgattatcaa tgtaccattg tgttagtttc tgtggagata    112740
     tccctaatct gtctgctaaa gcaaataaac tcgttttctt taaatgagtc tttttcaaaa    112800
     gctctgtatt tgaaaggatg ttaataggat gatcatctgc agcaataaga ccattgtcga    112860
     ttacaattgc acgatctgta tactctaaca taagctgcat atcatgtgta atcataacaa    112920
     tgctatgtcc atcacaactt agtttgtcaa ggaaagacat catttcagta taatgcttca    112980
     tatcttgacc agctgttggt tcatccaaaa taataacttc tggatttaaa atcagtatcg    113040
     aagcaatcgt aacacgtttt ttctgaccga atgatagagc cgatataggc caattcctaa    113100
     attggtagag cccacaaacc tttaatatat cgtagacacg actttctata tcattatcac    113160
     taaaacctct taaacggaga cccagagcaa cttcatcaaa aaccatcgct tgacttatca    113220
     tctgattggg attttgcaaa acatagccaa ttcgttctgc tctttctttt atagagtctt    113280
     gactgacatc ttcattatta taaattagag tagcattatt agggataaat tgacataacg    113340
     ctttagctaa agtagattta cctgcaccat ttttcccaac gatagctaac cgctgacctt    113400
     tatataaatc aaacgaaaca tcatctaaag tattattctc taaatcatat gacaccgaca    113460
     aatgctgtac tgataataat ttatctgtat gtttatctaa atctaatgct cgcattttag    113520
     gtatcaatag ttcactgaaa tcaaagtcat caatagacgt cattgtattt tgtttttcaa    113580
     agtcatatcc taaatttttg agggcagaaa tatacagtgg ttctcgaata ccatattcag    113640
     ataaaaaatt agtttttaaa agttgatccg gctccccatt ataaataatt tgtccatcac    113700
     taaaaagaac tacacgatct actcgctcat aaagaacatc ttccaatcga tgttcaataa    113760
     taatagtggt cgcatcttgc tcttgatgaa tacggtcaac caatgccatg atatcttgtc    113820
     ccgattgtgg atctagatta gccaaaggct catcaaataa tagaattggg ctatcgtcta    113880
     ctaaaactcc agctaaacta acccgttgtt tttgtcctcc cgacaagtct tgtggacgtt    113940
     tagacaaaag aggagctatt tctaaacgtt ttgcccacat ttcaacgata gaggtcattt    114000
     cttcctgtgc tacaacgtca ttttctaatg caaaagcaat atcttctgct actgtcaatc    114060
     ctataaattg gccatctggg tcttgtaaaa ccgtagaaac taaatgagac ttgtcatata    114120
     ttgacaagtc aaaagcattt ttatggttaa tcgtaaaaat accactatat tggcctttat    114180
     gagtatttgg gataatacca tttaaacaat gaccaagcgt tgacttcccc gaccctgaag    114240
     gtcctaatat caagaccttt tcacctttag gaatgcttaa gttaatccct tttaaagttg    114300
     gttcagattg aacgtcatat tgaaaggtaa aatccttcca ttcaataaaa tctttcatag    114360
     attactctct tatcctaatc tttggataaa ctaccttttt gtggtcgtga tttagcgtat    114420
     gctagcaaca aaagcgtacc acctactcca atagtaatgg aattcacaag acttgataag    114480
     aaaccttgtg caaaaacttt gcttgcaggt tcgctataaa agaaaatatc accatacggt    114540
     gcaacgacag accaacctat aaggttagca ataacttgaa ctacattaaa tagaagcaaa    114600
     tccttcttag tcatgccaga taattgaata gctaattttt tagcaaaaaa gcctatcatc    114660
     aaacctaaaa gaccactaac taaaacccaa gtccaccacg gagaaccata ttgaatcgaa    114720
     tctttcaatg cgtgtccgat aaaaccagta aaaaaaccaa ctcctggtcc ataaataact    114780
     gcaaataatg ctaaaaccgc atactgcaat tgaatattag tatttggaat tggtgttggt    114840
     atattaacta gcatacctat aatgataaaa agtgcagctc caattccagt cgctacaacc    114900
     ttttttattg tgtttgtatt cataaaaacc tctctgaaaa acaagcttaa acagtcactt    114960
     acaatctgtt ttattttatc atatttcaag ctgatttgaa accttattga caagaagaac    115020
     tgaaaaacga ttgaaaataa tattaaatac caaaaaagat ctcagataga atacctaaga    115080
     ccttcattag tttatttttt tccaaaaact gatttttcag ctacagccgt gaacagaaca    115140
     tctgtcgatg aatttaaggc tgtctcacac gaatcctgta tcacccctac aatgaaacca    115200
     actcctacga cttgcattgc aacgtcattt gaaataccaa ataagctaca tgccaccgga    115260
     atcaataaaa gtgaaccacc agttacacca gaagctccac atgctgatac agcagcaacc    115320
     acacttaata agaatgctgt tggaaaatca acagtaattc ctaaagtatt tactgctgct    115380
     aaagtcagga tattaattgt aatagctgca ccagccatat tgatagctgc accaagcggg    115440
     atagatactg agtaagtgtc tttatctaat cctaaatcct cacatagtct catattaaca    115500
     ggaatattcg ccgcagaact acgtgtaaag aaagctgtaa tacctgaatc ctttaagcat    115560
     cgtaatacca aagggtaagg atttttacgc atcataacaa aagcaatgat tgggttaacg    115620
     acaagagcta caaataacat cgtacccacc aaaactaata ttaaaagacc ataatcacct    115680
     agtatagcaa taccgttttc tgaaatgcta gtgaaaacca accccataat accaattggg    115740
     gccaaattga taatccattt gacaacttgt gaagtagcat cagcaaaagt ttgcattaaa    115800
     tcttttgtac gctgattact gcttcgcatc gccaaaccaa aaataaccgc ccaaaataga    115860
     atactcatat aattggcctc ggtaatggca tgaatgggat tatcaacaat tttcaacaaa    115920
     agagattgaa agacttctga aatccccttg ggaggtaata agtctgtctt tgctggcgtt    115980
     ttcaatatca gtgtcaaagg gaaaatatag ttcacaacaa cagcgattag ggccgctgca    116040
     aaagttgcag tgatatacaa accaattatc gttgacatat tggtcttacc gccctcacgg    116100
     tgttgcgaca aggcactaat aactaaagtg aaaactaaaa gaggggcaat agctttcaac    116160
     cctcctacaa aaagttgacc aagtaaacca atcgcagagg ctttagggac taaaataccc    116220
     aagaataagc caataacgac tccaattgtt atttttttta tcaagcttgt ttttctccaa    116280
     gcttttaaaa atcgtttcat actaaactcc taaaaaattc ttaaactcta tgatatgata    116340
     aaaaaaaaga ttcgtcaaat acctttttta ttttttagag gttgacgaat tctaaatttt    116400
     tctgatatat aattactttt tgaaatattc aatcaatttc gaaaataaaa tatttttttg    116460
     tacagaaagg tacattgatg aaactaaaaa acacttatat cattatcggc ttgatgcttt    116520
     ttgcgctgtt ctttggagcc ggtaatctta tttatccagc ctacttaggt atctactctg    116580
     gttctaattg ggcgtgggct atcattgggt tctgcttaac aggcgtaact ttacccctac    116640
     ttggtgttgc agctgtggcg tactcaggat caaccgatgt tgaaagcttc accaaacctg    116700
     tctctaaaac atatgctatt ttctttgcag tagcactata cctatctatt ggacctttct    116760
     ttgccattcc tcgaacaggg gcaacctcat tctcagttgg tattcaacct atcttaggcg    116820
     acagctcctt agtcaaaatt atctatggtt taattttctt tggtatttct tatttcttag    116880
     ctattagacc tagtcagatt gtagatcgta ttggtaaata tctaactccc tttttactaa    116940
     ctgttattag tattttaatt attgcctcac tcatccatcc agctgctatc gttggaacac    117000
     cacataacgc ttcaacgaat gtcagcgatg ctttcaagga tttaccattc ctagcaggac    117060
     tgattcaggg gtatggtaca atggatgccc ttgcatcaat tgcttttgct attatcgtta    117120
     ttcaagcaag taaacagtac ggagcaatta ccaaaaaaga aattacttct atggcactta    117180
     aatctggtgc tatcgctaca tttcttttag cttttattta tatttttgta ggacgtattg    117240
     gtgcaacttc acaaagcttg tttaaatttg caaatggttc cttcttactt cacaatactc    117300
     caatagacgg tgggcatgtt cttagtcaat cagctaactt ctatttagga attgtgggac    117360
     aagctatttt aggtacggct atttttcttg cttgcttaac aacagctact ggattaatca    117420
     ctgcttgtgc ggaatacttc cacaaattac ttccaaagat tagtcacatt acttgggcta    117480
     caatctttac tttaattgct attacgttct attttggtgg tttatcagag attatccgtt    117540
     ggtcactacc agttctctac cttctctatc cattaactat agtcttaatt ttcttagtct    117600
     tttttgatca aaaatttgaa agtagctgca ttgtctacca aacttctatt gccgccactg    117660
     ctgtcgctgc tttatacgat gccttatcaa aactcggcga aatgactggt ttatttacca    117720
     ttccatccgc tttgaccaca ttctttacta aagttgttcc tttaggtgaa tattctatgg    117780
     gatggattag ttttgcaatt tgtggtgtct tagttggtct tattctaaaa aaagtaaaag    117840
     cataataatt taaagcagta cgaaaattac tgcttttatt ttaaaataat tattgtaacc    117900
     gctttctttt ggtggtataa tagccttgaa aataaataat ttttgaagga actctaatat    117960
     gagagctgca acttatcttt cagctaatga attatcactt actgataagg ctaaacctca    118020
     agtaataaaa cccacagatg cggttgtaag acttgtcaaa acaaccattt gtggtactga    118080
     tctacatatc cttggtggcg atgttcctgc ttgtaaacca ggaacaactt taggtcatga    118140
     aggcattggt atcgtcgaag aagttggttc tgctgtcaat cattttaaag tcggagataa    118200
     agtaattatt tcttgtgtca ctgcctgtaa tacttgctat tactgtaagc accagttgcc    118260
     ttcacattgt gaagatggcg ggtggatttt aggacatctt attgaaggta ctcaagcaga    118320
     atatgttcat attccacatg cagatggtag cctttatcat gcacctgaag gtgtttgtga    118380
     cgatgcattg gttatgttat ctgatatttt accaacttca tacgaaatcg gcgtcttacc    118440
     ttctcacatt aaaccaggtg atactgtttg tattgtaggc gctggagcaa ttggactatc    118500
     tgccttacta actgcacaat tctattctcc tgccaaaatt attatggttg atttatctca    118560
     aaaacgactt gaagcctcta aaaaatttgg tgcaacacac accattctat caacgtctac    118620
     tcaagaagtt aaagaagaaa ttgataaaat taccaaaggc cgtggcgttg atgtcgtatt    118680
     agaatgtgtt ggttatcctg caacatttga tatttgtcaa aatgtagttt ctattggagg    118740
     acatatcgca aatgttggtg ttcatggtaa acctgttgaa tttaacctcc aagatttatg    118800
     gataaaaaat ataaccctta atactggatt agttaatgct aatacaactg aaatgctcct    118860
     tgaagttctt gagacaggca aaatcgatgc aacacaacta gtaacacatc acttcaagct    118920
     atctgaaatc gaagaagctt ataaggtatt taaagctgct gaagaaaaca atactctcaa    118980
     agttatcatc gaaaacgata ttactccagc ctgataattt ttaaacaaat gaaaatgtga    119040
     gaagaatagc cttctcacat ttttatttat gactcaagcg acgtgttaaa aaatcaccta    119100
     aaaattggat aaagaaaatt aataataaaa tcagaatagt cgctactaaa gtaatatcat    119160
     cacgagaata gttatatcct ttagtaatag caacagaacc caatcctcct gcaccaatag    119220
     cgccagccat agctgtttca cctactaaag aaatcaaagt aaccgttgat actcgaatta    119280
     aatctggtag accttcacga agataaacta caataatatc ccaaagtgtt ccacctgagg    119340
     cttgtgcagc ctcaataact ccaccatcaa gttcagctaa aacaacttga acttgacgag    119400
     caaaaaatgg gaaaactgcc aaagaaagag gtaccaaagc tgctggtgaa ccaagtgttg    119460
     ttcctacaat tacgcgagtt actggcgcaa tcaaagcaag aagaataatg aagggcagag    119520
     ctctaaaaac agaaacaact ttatctaaaa ctccaaatac taatttatta gcaataactc    119580
     ctctaggact agttaaaaca aggaataaac ctcctaacaa tcccattaaa cctccaataa    119640
     ggaacgacca aaaagtcata taaagggttt gtacaatagc tgtctgccag ccgtaagcac    119700
     cttcccaacc catttgatat acatttggta aatgtgtttg aatccactct atcatgcttt    119760
     accaccttct ttcaataacg ttaattgaac ttgcgaatct gtaattgctt ggcaggcttg    119820
     tcttaatttt tcttcgtcac ctgataagat aactaccatt tctccaactg gaataccatc    119880
     taaaatttca atattcccat agaggatgtt agcagttact tcaaattctt tataaatttg    119940
     atttaaaagc ggctcatccg tgctatgccc agcgtatttc agttgaacta atttgctacc    120000
     tactggtaga tttttgacaa cttcttgttg ctcaatctta agcattgcct catcaatccc    120060
     agtagctatt tttataaaat cttgtgtaag actctctcta ggatgtgaaa aaatgtctaa    120120
     aactgatcct tcttcaatca atttaccatt ttgcataaca gcaacgcgat tagcaatgtc    120180
     tttgacaatt tgcatctcat gtgtaatcaa aacaatcgta agtcccaatt ttttattcag    120240
     atcttggaga agggcaagta tttgttttgt tgttttaggg tcaagtgcag aggtagactc    120300
     atctgaaatt aagattttag gatcgttagc caatgcacgc gcaatggcaa cacgctgttt    120360
     ttgccctcct gataattgtg aaggatagtt ttgagcacga tcggataatc caacaagttc    120420
     taataattta gcaaccttag ctgctttcgc ctcttttgat aaacctgaat gtttaagagc    120480
     aaaagctaca ttctgctctg ctgtcaactg tgacattagg ttaaaatgtt gaaaaatcat    120540
     tccaatttca cggcgctgtt cgcgtaattg tgtgctagtc agtgtcacct tgttgtcgta    120600
     aataacttgg ttatcaatag taattttacc tgctgaaggt tcttgtagca aattaataac    120660
     acgaacaagg gtagattttc cggctcctga ataaccgaca attccatata tatcaccttg    120720
     attaatatgg atagtaacat ctttaacagc attaatctca cgtttctttt ggtggaaagt    120780
     aacatcaatg ttgtctaatt taataattgg ttctttactc atatgattct attaaagcct    120840
     ccactaattc aatatgggtg taataatcag caatactaac attttcatca acgccatggt    120900
     ctcgactatt ggcatgtcct atgccaaaag ctgcaattgg cgctcttaga gcttgatgaa    120960
     ctaaatacat tggtcctgta cctggtgagg tgggtaacag agatacccct tctggataaa    121020
     attgctcagc taaatcaaca acttttagga tagatggcgc tgacatatca ctacgataag    121080
     acatttcacc aagggtatag gttagctcaa tgtcattaaa gccattctct ttcaaatgat    121140
     tttgtattga atctagtaca cctttcgggg ttaaccctgg cactaaccta acctctgctt    121200
     tacatttagc ataagcaggt aaaattgttt tgacgccttc accttgataa cctgaggtta    121260
     taccttcaat ggctatagaa ggttcaaaat aaagctttct caaaaaagtt ttatgactat    121320
     ctgctaaact gggcaaaact aattggtaag catcttctag cgcctttgca gatctataag    121380
     aatatttttc aactaattct aactctctct tagtaggggg aataacttta tcataaatac    121440
     cttctaccaa tatatgacct ttgttatccc ttaacgtatt gagggcttga attaaatacc    121500
     atgtcgagga atcaacaacc ccaccaaagg atgaatgaat atcaacatcc gctgaactta    121560
     ctgataaatc aaaagtgaca atgcctttat ttccaccagc aatttccaac tgtcctttag    121620
     gatttttagg gccatcttcc cacacgatca aatcagctcc ttgtagctgc tcttgatact    121680
     tttctaaata ataatcaagg cctactgaag ctgattcctc cgctccttcc acaataaaag    121740
     tgatatctag aggaagttcc cctttgtgtc ttgataaata ttttttaact gctgataaac    121800
     gtgcggtaat gtgaccttta tcatcatcta caccacgtcc atacatctta ccatatcgaa    121860
     gtgaaagtgt aaaagggtcc tcagtccact gttctacctc atctgctggt acagtatcat    121920
     aatgattgta aaaaataata cgcttagcat ctacttttga tgatttgaaa tttgccacaa    121980
     taaagggagc gctatagctg tcatctataa tgacttctgc gccagctttt ctaaaaactt    122040
     ctccaagata gcttgctaag tcatttaaac caactttctg agcaaaaatt gacttaattg    122100
     caattaaatc tcttaaaata ttgatatcat cctgaacaat agtatcagat agaaactttt    122160
     gaatttgatt ttcttccttt gttaaagtca tctttcatcc accttccttc aaaaacaatc    122220
     caagagcctg gcacattgta ttcgtcccag gccctttatg gctatatggc tgataagttg    122280
     tatcctatta ggattccctg ttaaacttat acagtcaatt cacgttacca ttgtggaata    122340
     tcagctgaag tatctttgat aacttttttc acttcatctg tgtgataagc atccaagata    122400
     gcttggatag ctttagcgtt cttttgcttt ttccaatttt tacgtcccgc aatgatatta    122460
     atccattgtt ttgaattttt atctgatttc tcaacaaaga tagcatctga aggttttaaa    122520
     ttagcttgct caatgtatgt attattaata atagctgcat ctacatcttt gagtgcacgt    122580
     ggtgtttgac tcgcatctaa ctcctgaata ttaatatctt ttttattaga tgtgatatta    122640
     gcaactgttg caaccttctt accagaaaca ttcaatttga ttaaacctgc tgactgaagg    122700
     acatacaatg cacggctacc atttgttgca tcatttggaa ttgcaatagt ggctcctttt    122760
     ttcaattttt taagagattt taccttctca gaatagatac gaattggggc taagtaagtc    122820
     ttttcaagtg gaattaagtt tttcttattt tccttattcc agttttctaa gaaattgtaa    122880
     tgttgaaagg cattaatatc cacatcctta ttggctgtcg cttgatttgg ttgtgtataa    122940
     tctgtaaatt ctgtgaattt gattttagct ttatcgccta ctagcttttc aattttatcc    123000
     caacgtgctt tttcagtgtc agaaaaggtc ataacaccaa ctttaacaac tttacttgaa    123060
     gttgagcttg ctgaaacttc ttgattacta aatgtgactc ctaaaagtgt tgttaaggct    123120
     aatcctaaga caatatgttt taacttcata ataaattccc tcaatttttg tgataaagat    123180
     attatcccat aggaagttat tagaatcaaa ttgttataaa ctgtctcttg ttatagtttt    123240
     aaactatata acaaaaacta aggattgaca tctccttagt tttttattac tacttctcct    123300
     taggagtaac gagatctttc tcatttggta cgtaatcacc tccaaggtat tctttagcta    123360
     tttttgaaag tgtcccatct ttacgtaatt gtttaaggca attattcaca tacttttgca    123420
     agtctttttg atcctgacca aagatgaaat aaatataagg ctgatctctc atagtcaaag    123480
     ggatggtttt taaattcgtg agaccttgat tctttatgat agcgttaacc gttagtccgt    123540
     caaaaagttt aaaatcagct tttccatcac tcaaattcgt tagaatctgt gtaatatttt    123600
     cattagtata ttttagagta acaggatttt tctgatgctt tttattgaaa ttttctaatt    123660
     gcttggcagt tgtcgttcct tggacaacct gtgttttatg accagtaata tcattataag    123720
     ctttgatatt actattctta ggaactgcta aaactgaagg agtagagcct attgggtatg    123780
     aaaataaata tttttgagat ctctctgatg aataagaaat attatttcca cccatttgaa    123840
     actttcctga atcaataccg gtaaataccg atgaccactc tgttttttta aaagtgactt    123900
     tatagttatc tgaaccttta aaaacagctt tggctacttc aatatcaaag ccagtcagtt    123960
     tcccatcctt tacataagaa aaaggtgccg ttgttccgac agttgcaaaa ttaacttctt    124020
     ttttgcccgt cttggtagta tgagattttg agctacaagc agctagagac gctactgtca    124080
     ctaaaataat tcctgttaca cttaacactt tttttattgt catctttttt ctcctcttta    124140
     attgtacacg atatcataat atctttaagt ttttaactaa cacttatctt ctatcatctg    124200
     agagtttttg ctattatatg gatgctacgt ttcattaaca aaataaccaa ataaggtttg    124260
     gttttcaatt tggtgaagca ttaattctgg atgccattga acacctataa tacattgttc    124320
     tgttcgactt tcataagctt ctactgtccc atctctagga tctctagcac taactatcag    124380
     accttcagct aacagtttaa cactttgtct atgaagagaa ttgatcctaa aatcacctga    124440
     tataaagcct tctagaaaac tccctttttc cacatttaaa taatgagcaa atccaatgta    124500
     aggctcttga tagtgattat caatagattg attaagtgta ccaccaagtg ccacatttac    124560
     taactgcatg ccacggcaaa tcgcaaagat tggtttattt tgtttcaacg cttcgtcgac    124620
     taatgcaaat tcaaaaatat cacgcgcaag tgaataatca tcactctcaa ttatcttctc    124680
     ttcaccataa taggatggta aaacattttg gccaccagat atgatcagct tatctatcat    124740
     ctcaacataa gctttggcac tttctgcttc acttattggt aggataactg gtaacccgcc    124800
     tgcgttttta actccttccg aaatatgcct agataccgaa tcataataat aacctggaat    124860
     atctgacatt tctctttcat ttcctgtaat accaataata ggctttgtta acattttgct    124920
     ccctcatcaa ccaataactg tctaataatt atcattttac acctaaaaaa actttttgaa    124980
     taatattttt tacctatcac ttctttaaca atacctatca actctcacaa aaataaaaac    125040
     catagtatta atactacggt tttatttttt agaaatctgc tacattatga taaacttttt    125100
     gaacatcatc atctgattcg agtgcgtcaa taagcttttc aaaagtttca aggtcatcac    125160
     cttccaatac tacttctgat tgaggaatca tttcaagttc agtaacttgg aattcttcta    125220
     caccattatc gcgaagtgct tggatacctt tatgaagatc tgttggggcg gtataaactg    125280
     ttattgttcc ctcttctgct tcaacatcat ctacgtctac atccgcttca agtaattgtt    125340
     cgaagacagt gtcagcatca tcaccagcaa aaacgatgac acctttttta tcaaataagt    125400
     aggataccga tcctgaagct cccatattgc caccgttctt accgtaagca gtacgtacat    125460
     ttgctgccgt acggttaaca tttgatgtca aagtatccac aataatcatt gaaccatttg    125520
     gaccaaaacc ttcatagcgt ccctctacga aagtttcatc tgtgtttcct ttggctttat    125580
     caatcgcttt atcaataaca tgctttggaa cttgtgcttg cttagcacgg tccaaaacga    125640
     attttagagc tgagtttgac tcggggtctg gttcaccttg ctttgcagca acatatattt    125700
     caacaccgaa tttagcgtat acttttgagt tagcaccatc tttagcagtc tttttagcaa    125760
     caatattggc ccacttacgt cccattggaa aatctccttt gatttcattt ttaataacct    125820
     gctggctcat attggcaagc aatcttaatt ttaactctat tattatagca ctttgatagc    125880
     aattggtaaa atggaaattc tatcaccaag ctctagcatc tgtcttatgt tttaagtaat    125940
     caatccatct actatccttt acacgacaca aggtaactga taaaccagcc atatctaaac    126000
     ttgtaattag gtggcctgtt ttaataaaag gtaattgtaa atcgtctaaa gccagaaatt    126060
     ccatgacagc atttgtaaaa agtaattcct ccattttaga acttcctcca agattattta    126120
     tcaatagaat gaatgcttct ccatcttgcc aacgtaattt cattttcaat ttgttaacta    126180
     gttcgtttgc caaatgttcc atggacacga aaggcattgt ccggtatcct ggctcaccat    126240
     gaataccgat tccaaatgag atgtaacctt cttctaaatc aaaaacaggt tgatgctgac    126300
     ctaaaatagt ggctgactta cttgctacac ctaaagtagc cattgaagtt gtcaaagata    126360
     gtcctagctg ttctaattca tctaagcttg ctccttctaa agcagcttgt ccaataattt    126420
     tatgtagcaa cacagtacca gcaacgcctc gattacgaat tttaaaattt gatgtttcaa    126480
     cagagatgtc atcatgagaa acgatgtatt tgattggaat gccttcttga cgagcctgtt    126540
     caatcgcttg ggaaaattct tccaaatcag cttcgaaatt tttgataata acaaaaacac    126600
     ctttgcctcg attgataaat ctaatagtct ctagaatatc actagcacat ggtggtacaa    126660
     aaataggacc actaatcgct gccgatagca ttccctcacc aacatatcca aagtgagctg    126720
     gctcatgtcc gctgcctcct cctgataaaa tcggaattac ttgttcggat tgccctaaat    126780
     aatgaatagc gggcaaatct tttatttgct ctactttagg gttagtttta gtgattgctt    126840
     ttattgtttc aaaaacatat tccattttat gatgttctgt ttttctcata tctttgtcct    126900
     aataattttc tattgatgtt ctgataattt tttcaatgac tttcctatta aataattctt    126960
     cttttgagtt atttattaac tcatatttta taaaataaga gagggcttta ctatgataat    127020
     tgataaatgt aactctttct ttctgactaa agttagattt actataatca gaaagaagct    127080
     tatctactaa ctgctcacag taagactcaa aatacgaaga aaaatcattt tgatcttcaa    127140
     tttgaaataa tttaatatag aattcttgat tcattttaaa aaaagtcaac aactctgata    127200
     acaactgaaa acctgagata tagtctaaat tatccgtaac ttgttcgctt aattctgttt    127260
     ggaaaatcca ttctaataaa gcatatttat caacaaagtg attataaaat gtttgacgtc    127320
     taatacctgc atcttccata atatcactca ccgatatttt gtcaaaagct tgcgaaataa    127380
     ataaacgttt aaatgacttg gctatttttt tcttagtaat aagcgaagaa gccataattt    127440
     ctcctttatt ttatattgaa ttgctgatga tttattatgg tttagtgtaa catgatttat    127500
     gattattgaa aaccctaaca aagcggacaa acaagaaaat ctgtccattc cggaaaaggc    127560
     ttacaaattt tataataaaa gagaattaaa cataaaagga gtttccaaat gaaaaaaatt    127620
     ctcaatcaac caactgatgt tgttactgaa atgctagatg gattagcata tgttcataat    127680
     gatttagtac atcgcgtaga aggttttgat atcattgctc gcaatgaaga gaagtcagga    127740
     aaagtggctc tcatttctgg cggaggaagt ggacatgagc cttcacatgc tggtttcgta    127800
     ggcgaaggaa tgttatctgc agctgtgtgt ggtgcagtat ttacttctcc aactcctgac    127860
     caagttcttg aagcaattaa agaagctgat gagggagctg gagttttcat ggttatcaaa    127920
     aattattcag gagatatcat gaactttgaa atggcacaag atatggctga aatggaaggc    127980
     attgacgttg caagtgtggt cgttgatgat gatattgcag tcgaagacag tctttacaca    128040
     caaggaaaac gtggtgtagc tggtacgata cttgtccata aaattctagg acatgctgct    128100
     cgtcatggca aatcacttca ggaaatcaaa gctattgctg atgaattagt accaaacatt    128160
     cacactgttg gacttgcact aagcggggct actgttcctg aagtaggcaa gccaggattt    128220
     gttcttgcag aagatgaaat tgaatttggt atcggtattc atggtgaacc aggttatcgt    128280
     aaagaaaaaa tgcaaccttc aaaggcttta gcgacagaat tagttgataa gttaattgaa    128340
     tcgttcgatg ctaaatctgg cgaaaaatat ggtgtcctta ttaacggtat gggtgcaacc    128400
     ccacttatgg aacaatatgt ctttgctaac gatgttgcca aactccttga agataaaggc    128460
     attgaagtga attacaaaaa acttggtaac tatatgactt caattgatat ggctggttta    128520
     tcactaacct tgattaaact ggaaaatcaa gagtggttag aagcacttaa tagtgacgtt    128580
     acaaccattg cttggtaatc attcctgtta attagaacaa aagaaaggaa ctcttatgga    128640
     agtaaaaact gcaatagaat ggatgcacac ttttaaccaa aaaattcaat ccaacaagga    128700
     ctatttatcc gaactagata ctccaatagg tgatggcgac catggtggca atatggcgcg    128760
     tggtatgact gctgttattg aaaaccttga taacaatgaa tttagtagtg ctgccgatgt    128820
     tttcaaaacc gtatccatgc aacttttaag caaagtaggc ggagcatctg gaccactcta    128880
     tggttctgca tttatgggaa ttacaaaagc tgaacagagt gaaagtacca tttcagaggc    128940
     acttggcgca ggacttgaaa tgattcaaaa acgtggtaaa gctgaactta atgaaaaaac    129000
     aatggttgat gtttggcacg gtgttattga agcgattgaa aaaaatgaat tgactgaaga    129060
     ccgtattgat tccttagtag atgctacaaa agggatgaaa gcaacaaaag gacgcgcttc    129120
     ttatgttgga gaacgctcat taggacacat tgatccaggg tcattttctt caggattatt    129180
     atttaaagca ttactagaag ttggaggtgt ctaatgtctg atattggtat tattgttgtt    129240
     tctcactcta aaaatattgc tcaaggagtt gttgatctta tttcagaggt agcaaaggat    129300
     gtctcaataa cttacgtggg tggaacagaa gatggtgaga ttggtacttc ttttgatcaa    129360
     gttcaacaga ttgtagagca aaatgataaa aagacgttat tagctttctt tgatttaggt    129420
     tcagcaaaaa tgaatttaga gttagtagct gatttttcag aaaaaaatat tatcattaac    129480
     tctgtcccag tagtggaggg agcttacacc gctgctgctc ttctacaggc aggtgctgac    129540
     ctggatagta ttcaatcaca attagctgaa ttaactatca ataaataagg agatattatg    129600
     actcaatttc ttggggaatt tttaggaaca tttattttgg ttcttcttgg ggatggcgta    129660
     gttgcaggaa atgtgctcag taaaaccaaa gaagaaggaa ctggatggac tgctattgtt    129720
     tttggttggg gaattgcttg taccgttgct gtttatgttt ctggattatt tagtcctgct    129780
     catctaaatc cagcagtcac attagcaatg gcttctattg gagcaatttc ttggggacaa    129840
     gttatcccct ttatcattgc acagatgtta ggagcaatgg ttgcggcaac gattttatgg    129900
     ttacactatt atcctcattg gaaagaaaca aaagatagtg gacttatcct tgccagcttc    129960
     tcaaccggac ctgctatccg ccatacacca tcgaatctcc ttggtgaaat tatcggtact    130020
     gctattcttg tgattacaat tatggcaatt ggtcctagta aagttgcagc aggtcttggt    130080
     ccaattatcg ttggtatagt tattttcgca gtaggattct ctcttggtcc aacaactggt    130140
     tatgctatta accctgcacg tgacctaggg cctcgtctta tgcatgctat cttacctatt    130200
     gaaaataagg gcgactcaga ttggtcatac gcttggattc cagttgtagg tccaattatc    130260
     ggcggtgtcc ttggcgctat cttatacaat attgctttaa ctttaattta actaaaaaac    130320
     cagaaagtat taactttctg gtttttcgta gttgcagtat gctttcaaaa tagaaaaaac    130380
     accaaaatac ttagtgttct ttctggagat tttatgaaaa aagtttagga tgtttatagt    130440
     ataaccgccc ttacttaacg tttccttaaa agctcggcta tttaacatta cttcctaaat    130500
     tactatttat attctccaag aaatgactac tgttaagcta aaaagcgcta ttgacatagc    130560
     gctttttagt ctagtattat ttagtttcag aagtaactcc atcaaaatct tcttcatttt    130620
     cttcagcttc ttctcttgtg gcacggataa taccatcttt gtgatgagct ggactgtaaa    130680
     ttgtatagag ttttaacatc tcggtttcag aagtgttaat tacgttatgt tcagcacctg    130740
     ccggaactat tatagcgtct ccatctgcaa cttcatattc attaccatca atgacaacct    130800
     taccatgacc agcttcaaaa cggaaaaact gatcattttc tgcatgaatc tcgctaccaa    130860
     tttctccacc aacaggcagt gtcattaaaa cgagttgaca atgttctgcg gtatagagga    130920
     cttggcggaa atttgtattt cctagtgtca atttttcgat attcccatga aatcctttca    130980
     taacggtacc tacctttcta tgcctacagt ctactctttt tgccacttac tgtcaaaaat    131040
     ttagataaga gtctgacatt tttaataata tctactcccc cttgattcct atcatttcat    131100
     tgcaaaccta aaatatagcc tactgacaat agctatctat agctttagaa acaaataatg    131160
     ctgttccctg gcctccccaa ttatcaatag acctttggaa acgctcatct tggatgtaca    131220
     ttattccaag acttgctaat aaatcgttag tgcagttgta aaactgagct gtgatataat    131280
     cttgtaaaat ctgaacttgt ttttgaactt tctcatctgt cggagaaagt tctttcaact    131340
     gtccaaagtc tttaaaaatc tgactcatag cttgtgaaat cattgaaaaa tcattcttac    131400
     tatagctatt ttcaaattct ttgtaactat ctgtatcccc ccagcgtgtt ctagcttcct    131460
     cttgaaatgc ttctaattct tcttgattat aagctgtaaa atctgacata tttttacccc    131520
     tctggataga cttagcatgt tcaattactt cttctagtcg ctgtttcttt agttccagcc    131580
     acctaatttg atcaagaagt gcttgattac gatcataatt tggactatcc attatctctt    131640
     ttattttttt aagaggaaat tccagttcct taaataacaa aatttcttgt aacttaatca    131700
     gtgattcatc atcatagtaa cgataaccat tctctcctac aaatgaagga ggtaacaaat    131760
     ctatttcatc ataataatga agtgtgcgca cactaatacc agaaatgtga cttatttctt    131820
     taactgtttt cataataacc tctctaaaaa gagtataatg tataacgtta cgtaagggtc    131880
     aagggaaaaa tattattttg tgatgattaa tttataaagc ttaaatcaaa ggtcgctttg    131940
     actaacagat tgatgaaaag ggatacgtcc ccatgtttgc tctgctatat tagcatttcc    132000
     catctgataa acagaatctg ctcgttgcgt caaactatcc cacgtttgtg aaccaatcct    132060
     cgtcacgata tccacagact tcttcacaga ctttaaatgc tgttgacctt tttgtgtaaa    132120
     acctaagaca tgaatagcat ttggtatagg actttccaca gcatttatca agatataggt    132180
     taataaacgt cgaattcttg ctttggtata ccgtttagtt gcgactttat caactaactc    132240
     atccacagtc tccacataac gaatttgact ttttatacga ttggctatct cttcattcac    132300
     ttgataaatt tgtgtcaaat cagaatgcgt cattatctga tatttgagta aactaaaata    132360
     atcttgccaa actacttgtg gactattcaa aaacaagtca ctgttaggca tacctttttc    132420
     tacaaagaaa cgatcagatt gatgtttacg aagacttgtt gcggaagcaa atatctctgt    132480
     tttttctgat gaatgataac cagctccttg acgttgtatc ggatttaatc gaataccatt    132540
     ttggctagct gctttggtgt aggctaagcc taaaatgtga tttggggttt gtcccgaaaa    132600
     tgcaatccct gcaaattctt gccacatagc ttgcgttttt tgtggatagg aaagagaatc    132660
     cgattgtttt ttcaaaaaag cttccatctc ctctttttta ttcacataaa tatccccaat    132720
     acggtcataa tcaagcattt cttcggtacc gaagcataag ttatccacac ctaatcgtgc    132780
     caggatagac acagctccac tagcgaaata atccgctgac tgtaccgaaa ccaaaaaagg    132840
     gagttcaatc actaaatcag caccattttc tagtgccatc tgggcacggg tccatttatc    132900
     tacaatcgcc ggctcaccac gttgcataaa attacccgac atggctatta cttttattcc    132960
     ttgagcttgt tctaaaaggt acttatggcc attatgaaaa ggattaaatt cagcaacaat    133020
     tcctgtaact gtcatacttc tttctctttc aattgattat ttaaagtaac agcatcaata    133080
     atatctaggt gataagtttt acgaaggtat atgagacgat ctgtttcttt ttcaaatggt    133140
     tttaatgccg ataataaatc caaatgaagt ttagggttca tcaataatcc caaaataact    133200
     ttagactttt tctgacttac ccgacgttca ataatataaa gtatcccaaa tatcatcaga    133260
     caagcgtata agaatattat catcttttta cctccaaatt attacttatt tatgagctac    133320
     aaaaaaccag cgagcagaag ttgcagttgg ttttttatct tcaaaatctg catacacctt    133380
     aacatcttta aaacctgcct gttcaagtaa aatatcataa gtcaaaatat cataagtacg    133440
     ctcttcatga acttcatcat gacgtgtaaa tcgaccatct tcttcttgaa caaaaaatgt    133500
     taattcatgg acaatagaat gaggtgcatc atcttcataa gtatcccaca ccatagcaaa    133560
     gtcatctgca ttttcatgat aagaataacc aggaaatact ttatctgttt gataagtcga    133620
     atgaacatca aaaataaaga cgccattttc ttctaaggcc ttatagactt cgataaaaac    133680
     atcaccaacc tcgacttcat cttgcatata acaaatagag tctgaatagc acgtgatgag    133740
     atcatattta ccaacattag ataaatctaa catatttcct tcaataaact ggatactttg    133800
     gtgagcagaa gttgcacgtt ttttggcaag tttcagcata tcgccactaa gatcaagtcc    133860
     tgtaacagca taaccagctt gtgaaaatcg aacagactga attcccgtac cacatgctaa    133920
     ttccaaaagt tttttcttac cttttggaaa atgacgaagt gaaaaatcag tccatttatc    133980
     atataaagta tcatccatga cagcatcata aacagctgca aaagtttcat acgttgccat    134040
     ataatagttc tcaaatcttt cttgatatta catctctcaa aaagcagtcc caagactgct    134100
     tagctttatt ctgtcataaa gtcttcagca tcaagcaatg gtgcttcatg ccaaagtttt    134160
     tcaaggttat agtgctgtct ctcatcttca gagaagatat gaaccacgac gctattgagg    134220
     tcaagaagta cccaaccagc tttactatcg ccttcaaggt ggctagcatc cccaccattt    134280
     ccttttactt gttcacggat attgtctgcg attgcttcta actgcctact attacttgca    134340
     ctcataatca caaagtaatc tgcaacactc gttacaggct gtaaatctaa aattacaata    134400
     tcttctgctc gtttttcatc tgcagcctta acgactagct gtagtaagtc tttttctgtc    134460
     attttattcc tcgtttatta atttcaataa gttatctttt gctaccattg tcgcaaaacg    134520
     atgatgccaa atattctcgt aatgtttttt aatagaatcc ccacttaaag ttggtgtatc    134580
     aaatgttagg tgtccacctt gtggaataaa gatatcataa ccatattcaa aagcaacttt    134640
     tactgatgta tcaaaacagt attctgtttg aagtcccatc atgatcaatt gactaatatg    134700
     cttactttgc aagtaatcat gtaaatgagt atctttaaaa caactattgt aagttttatc    134760
     aattattttg tgatgcgtca caagatgtcg ccgttcccaa atttcccact gtggagaacc    134820
     ttgaggcaat tcctcatcat gatgccttat ccatatcact tcacaattag aacctttggc    134880
     acttaaaagt aaatcatcta aaagctctgc aaaatttgtt aaatgctttg gtttcttatc    134940
     cataatacct tgttggatat caattagtaa aagtgcacaa gtcatacttt cctccaaaat    135000
     gaccactgca tcgccaaacc tatcatgacc attatttcaa taaaagaatt agtcgagata    135060
     aggtatataa gcattatagg tttcaatcgt tttaggatag ataggctgag ccttacttgc    135120
     taaaaacgaa actgttctag cagtctcata agctactgct ttattaaggt caactttcgc    135180
     taactcacga gcttcttcaa ctcctggaaa atctcgattg tgttcaatgt aatctgctac    135240
     ataaacgatt ttatccaatg tggacatttg ggctgaacca acagtatgtt ttgcaatagc    135300
     agctaaaata tcttgatctt tgatagctag atcctcttgt attttataaa tgccaacaag    135360
     accatgccaa atattattac cccatttttt taggtcggga tctagttggt atttatcaat    135420
     taatctaaga aattcatcat cagatagttc tttagcataa tcatgtaata aagcagctag    135480
     gcccgctttt tccttatcat aaccataccg ttctgctaat tctattgcag cacgctctac    135540
     tcctaacaca tgattaaagc gcttgtcgga catcatatga cgcactttac tcaaaagttc    135600
     agtccgatct aaacctgtgt aatctttgta ggtcatttgt aaagaccttc tttcctgata    135660
     taatctaata cctctttagg cagtaaatag ttgggctgac gattactttt aataaattga    135720
     cgaatcatac ttgatgagat atccatcaat ggcagatcca cccaaataac aggatatgat    135780
     gtaccagctt tatattttgg acgttgaaca ccaacaaact gcaccatttt aacaagttca    135840
     tcaatacgat gccacttagg tagatattcc accatatctg ccccaataat gaaataataa    135900
     tcaacatctg gatttttttc aattagaagc ttcatcgtat cgtatgtata gctgatacct    135960
     ttacgttcaa tttcaatcgg ttcaatagat aaaccatcaa tgccttctat tgctaattca    136020
     agcatcttga gacgatgctg ttcatcaatt gtctcttttt tatcaatatg tggtggctga    136080
     aattcaggca tcaacagaac ttggtctaaa cacaattgct gacgtacttg atctgcaaca    136140
     acaaggtggg cattatgaac agggttaaaa tttcctccca taattccaat ttgttttctg    136200
     ttagtatctc gctttttctc ttctaattca acttttgtaa atggtgttag caattcgagt    136260
     gccataattc ctccatgaac aagtagtatc tctaaaaaaa caaacactga ttatcatgat    136320
     cagctatcat acggaagtgt aacttaggta aatcgttttt tagttctata ctctatttct    136380
     taatctattg tagtttagtt tgattttact gcttttactt taactgaaat tttacgattt    136440
     tctttgcgcg ctgactcttt ataaagaatc aagatacgtc ctattttaag gacagtatcg    136500
     cagccaattt catcttccag aacttcagcg acatcgtgga tatcttcatc ggtattttgt    136560
     aaaagggtta ctttgattag ctcacgtgca tcgagtgcat tacgtacgct tgttttgatt    136620
     tgatcattta aaccattttt cccaatttga ataatgggtt tcatagaatg tgcttctgat    136680
     tttaagaaag cacgttgttt agatgttaac atattagttt cctttttatc tattatagga    136740
     ttatgactgt atcatcagtt aaattagatg aaaaatcgtc atatgttgct ggttaattta    136800
     gttattaaat taaagctttg cgtaaaacaa ctgccacgcc ttctggagcc caagcagcta    136860
     ctactactgg attttctgct tctgatttca cacgtatcca accaaggccc gaataaacaa    136920
     tatccatttt attcttgatt gtaaattcat gacgaactaa tttaggaaaa tctgaaactt    136980
     ccttacctgt tggtggtgtt aataattttc caacatgttt agtgtaaaat tcatctgctc    137040
     caactagttt agtgcggtgt aaattcaggt tattatcaaa atatgccgta aaaccttgtt    137100
     tttgaccaga aataaaatca aaacgtgcta ggccagccaa gaataatgtt tgttctgaat    137160
     taagctgata agttttgggt tttatttctt ttttaggact aacatattta agattttttg    137220
     ctgtcaaata atgagccatt tgatgacgat gaataatacc cggggtatca aaaatatagc    137280
     taccatcatc aagaggtatt tctattttat ctaatgttgt acctgggaaa cgtgaggtcg    137340
     taataacatc acgactacca gtgatttcac gaataatagc gttaataaga gttgactttc    137400
     caacattagt aaccccaaca acataaacat ctcgaccatg acgatacttt tcaatcgtat    137460
     caatcaaatc cttaatagca tgatgatttt gggcacttgt caagatgaca tcaacaggac    137520
     gaagcccctc ttcatgagct ctctcagtta accattgtgt tacttttcca tctttaaccg    137580
     atttgggaag aatatctttt ttatttccta ctaaaagaac atcgtttcct gcaacgaaac    137640
     gactaagacc aggaataatt gaaccattga aatcaaaaat atcaatgaca ttcaccacaa    137700
     gggcatcact atctccaacc tcatgtagta atttcaaaaa ttcatcatca gtgatatgaa    137760
     cgtcagtaat ctcattatag tggcgcaatc tgaaacaacg ctgacagtat aattctcctg    137820
     tctctaaacc tttttcaagt gctgcacgag gtgtatagcc agcagcatct ttattttcag    137880
     tttgaatcct ggctccgcag ccaatacaaa ataactcttc cattaaattc ctttttgata    137940
     tacgatttta ccgtaattct cttctatttt tttccaaacg cgacgttcac gtaagcgatt    138000
     gaacttggta ttccaagcat cagatttaac aattggtttt accaatacgg actttattcc    138060
     tgcgcgatga ctagcacgaa tatctgtcat caattgatct ccaaccataa tcacctcgtc    138120
     acgatcaaag ccataacgct caattgccat gtttatacca cgagtaaatg gtttcatcgc    138180
     acgacttaca aaatccacac caaaacgtga tactgcacgt tctacgcgag catgattgtt    138240
     gttagacact actacaactg aaatatccgc tgttgtcatc tcatctaacc atgcacgcac    138300
     ctcagcagta ccatctggat tattccaagc aatgagtgta ttatctaaat caactaaaac    138360
     cgcacgaatg ccatgacgta ataaatcttc tgctcttaaa tcataaactg cctcaaccac    138420
     gaaggtcggc ctataatcat ctatactcaa tttcatctcc aaaaaatata ttttactatt    138480
     cattctacca taattctcaa gagatagcga gtaaagaaaa aaggtcttta aagaccttta    138540
     aattagggtt tcaaccccaa aagatactat tttactcgtt tcattttctt caatgcaatt    138600
     aaatctttgt aagagattag agttacagca aggaaaataa acaacatccc aagtaaatct    138660
     attggataaa aaatttctcc taaaacaagt actgtcaaaa acaccgaaga aactggctct    138720
     accgatgcta ataagctacc cttgacagca cctacaatac taaccccttt aaggaaaaaa    138780
     gtgtaagcaa aaatggtccc aataccaata atgccaatat aagcaagtat actcatcaca    138840
     ttaatttgta aggggtattg ccacgctttt gtcaccaaac taaataaaat cccacctata    138900
     aacattcctg aaccaataac aatcgtactt ccccattcat gaataagttt tacaggtaat    138960
     aaaatataaa tagaataagt aatggctgaa ccaagccccc acattaatcc tttcggtgtg    139020
     atagctaaac ttcctaattt cccatgcgtt gcaatcatat aggttcctaa aattgccata    139080
     gcaattgcta ttatttcaaa agatgttggt ctttgtctgt ttaggataca aacaatactc    139140
     aaaataagta ttggtgccat atattgcaaa accgttgcag ttccagcatt tgttaaatga    139200
     atcgctctga gaaaagcata ttgatttaaa actaaaccaa atatagaaaa aagtaaaacc    139260
     tgctttaaaa attttggctg tttccacgct gctactaaat gctccttttg ttttgatcta    139320
     gctaaagaca agagaaagat acctgttatc aacaatcgta aagaagtcaa aaggttaacg    139380
     tgtactccgt gcgacatcaa gtattgacca ctaattccag aaatgcccca tgctagtccg    139440
     gcagctaagg tcatcattgt tcctttttct tttttagtca tttttcccct catttttatt    139500
     tcttaaacac tgtagttaga gtcatctgat aaatatctta gcttcttaat tatttatccc    139560
     taggcgttcg tgctaaatta gcgaataaaa accagccaaa aggctgattt ctattcttct    139620
     tttaattttg ctaattcttg cgctaacagc ttcagagcaa cttgtggatt agcttgtcct    139680
     tttgttgctt tcattagata acctgtgaag gccttatcag cattgcgttt tcctgactta    139740
     aagtcaatca cagcagcttc attatctgca aagacttgat gaataattgg gattaatact    139800
     tcaggatctg aaatttgaac taaaccagcc tttttaacga attcttcagc tgaaccacca    139860
     tttttagcta aatgcacaaa aactttttta gcaattttgg atgaaattgt accgtcagca    139920
     atcaagctaa tcatctcaac caaattctca ggagtcagac caatttcttc gattgatttt    139980
     gattcactgt taagaaattg cgccacttct ccttgtaacc aattggaaac ttgttttgca    140040
     tcacccccaa tagcaacagc tttttcaaag aaatcagaag ttgcttttgt agctgttaat    140100
     tggctagcat cataagatga tagaccaaaa gacgatacat atttcgcacg acgttcctgt    140160
     ggaaattctg gtaattctaa acgaacttga tcaatccatt catccgagat atcaaatagt    140220
     ggtagatctg gttcagggaa atagcggtaa tctgatgagc cttccttgac acgcatcaaa    140280
     atagtctcac ctgttgtttc atcaaaacga cgagtctctt gctgaatttg accaccagat    140340
     cgtaaaactt gtgcttgacg tttttcttca tgtatcaaac ctttacgtac attattgaat    140400
     gagttaaggt tcttaagttc tgctttagta ccaaactctt cttgaccata aggacgaagt    140460
     gaaatattgg catctacacg catagaacct tcttccattt taacgtcaga aattccagta    140520
     tattggataa tctctttgag agctgtcaaa taagcataag cttcctcagg agaacgcata    140580
     tcagcttctg atacaatttc aatcagtgga acaccttgtc tattaaggtc aacataggaa    140640
     taaccatctg tcccatgtgt attttttcct gcatcttctt cgaggtgggc acgctcaata    140700
     cgaatttttt ttcgtgtacc atcttctaat tcgatttcaa tccaaccatt gtaaccaata    140760
     ggctcatcaa actgtgaaat ttgataagct ttaggattat ctggatagaa ataattttta    140820
     cggtcaaaat gcatgttctg atggatatcc atattcaagg caagtgctgc cttgattcct    140880
     gcatcaacaa ctcctttatt catgactgga aggacacctg ggaaagacca gtcaattaca    140940
     tttgtattag cattttgttc ctgaccaaaa tgagcggaag aaggtgagaa aattttagag    141000
     ttcgtattta attcaacatg gacttcaagt ccaatgactg tttcaaaatt cattagttct    141060
     cacctccaaa aattttaggt tgttgtttat gataatctgt cgttgcttcg aaagcagcag    141120
     caacctgata tattgtttct tcactgaatt tcggaccaat caactgcata ccaaccggta    141180
     gacctttatc aaaaccagca gggattgaaa tacctggtaa accagccaaa ttaactggta    141240
     ttgttagaat atcagctagg tacattgcaa ctggatcgtg atttaaagaa tctaagtcaa    141300
     aggctgttgt tggagctgtt ggacctaaaa tcaagtcata atctgcgaaa actttttcaa    141360
     aatcttgaat aatcaaacta cgaacttgac ctgctttttt ataataagca tcgtaatacc    141420
     cagaagataa actgaacgtt cccagcataa tgcgacgctt aacttcgtct ccaaaacctt    141480
     cagatcgtgt attgacatag atatcatcca agtttttata attttctgta cggtatccat    141540
     aacgaatacc atcaaaacgt tgtaggtttg aagaagcttc cgatgaagca ataatataat    141600
     aaacagcaac accgtattta gaatgcggta aactaacttc ctcaataact gcacctagtt    141660
     tttccagatg ttttgcggcc ttaataatcg tttctttaac tcctggcgct attccttctc    141720
     ccaaatattc ttttggtaaa gcaattttca ttccttgaat atcttgacca attttagcag    141780
     taaaatcgcc tacagtacgc tcagaagaag ttgaatctct tacatcatgc ccagaaataa    141840
     ctgtcaaaag ctgtgcattc tcttttactg tttgagacat cggtccaatc tggtcaagcg    141900
     aactaccgaa agcaaacaaa ccaaagcgtg atacacgtcc gtaagttggc ttcataccaa    141960
     cgattccatt aaatgaagcc ggctggcgaa ttgaaccacc tgtatcagag cccaatgaca    142020
     aacgtacttg tcctgaagct actgctgctg cagaaccacc tgatgatcct cccggaactt    142080
     tactatggtc ccaagcgtta tttgtctttt taaaataaga tgtttctgta gagcctccca    142140
     tggcaaattc atccatgttt gctttaccaa tcacaatcat atctttagca tataactttt    142200
     caacagccgt agcatcaaag attggctcat agttatagag cattttagaa gcagctgttg    142260
     taagaatccc ctttgttgaa atattatctt taactgctaa gggaatacct gacataacat    142320
     tatcagcatc aattccttta tcatcaattt ctttggcttg agctattgcc atatcatcag    142380
     aaatagtaat aaaagatcca accgcttgtt cacgcgcatg aatatcttcc aatgtagctt    142440
     ttgttaattc agttgctgaa atttcttttt taacgagaag atcatgcaac tgatcaattg    142500
     attgattatt aaacgacatt aggcatctcc tccatcctca agaattgcag gtactttaat    142560
     ataataatct tgatgctgtg gtacattttt aaataagtca tcacgattat tgcctggttg    142620
     agcaatatct tcacgcatca cggttttgcg atctgccatg gtcgttgtta ctggtacgcc    142680
     ttctgtgtca acttcattta agagttcaat catatcaaca atctttgaca aacttgacgc    142740
     aaattcttta gtctcttgat cagaaaagcg caattttgac agattggcaa catgacgcac    142800
     ttcttcttca gaaattttca tgagttctcc ttatctctgt atcattttcg ttttaagata    142860
     gtctctacta ttatagcata ttaaactctc aatgttatca cattatccca gcttttcata    142920
     ataaacgctt cttacctatg ataagaagcg tttactgttt atttatctat tgttatatca    142980
     tttctacttt gtttgatttt agcctgtgca gccgctaatt tagcaatagg aattctaaac    143040
     ggcgaacacg atacataatg taacccctgt tggtaacaga actcaataga tgatggttct    143100
     ccaccatgct ctccacagat acctatttta aggtttggct taacttcttt tcctaacctc    143160
     actgcctgct caataaacct tcctattcct ttttgatcta aagcttggaa agggtctttt    143220
     tttagaagtc ctttatcaac gtattctcct aagaattttc cagcatcatc tcgtgaaaat    143280
     ccaaagctca tttgtgttaa atcattggtc ccaaaactaa agaaatccgc aaactttgca    143340
     atatcatccg ctatcataca agctcttggt gtttcaatca ttgtcccaat aggaaatgat    143400
     aagttaattt ttttagattt actctcctca ataattgtct cttcaatcag atcacgtatt    143460
     atagagattt cttcatgcgc tgacactaaa ggaatcataa tttctggctt tgcctcatat    143520
     ccctctttca ttgcaagtat agcgccttgt acaagagctc tcatctgcat ttggtaaatt    143580
     tccggatagg taatcgcaag tctacaacca cgatgaccta acatagggtt gaattcttct    143640
     aatgtttgaa tccgtttttc aatagctaaa gtagatatcc ccatttgtct tgccatagat    143700
     tcgatagact ctttatcatg gggtaagaat tcatgtaaag gagggtcaag caaacgaatc    143760
     gtacaagttt tacctttcaa taccttaaaa atttgataaa aatcgtctct ttggaaagat    143820
     aaaagccttt ctagagcctt ccttcgactc aatacatcat ctgctaaaat catttctcta    143880
     acgactggaa tacgttcatc gtcaaaaaac atatgttccg tgcgacaaag acctattcct    143940
     tctgctccaa agtccaaggc cttttgagca tctctcggat tatctgcatt tgaacacacc    144000
     atcatatctc gattttcatc tacccatttc ataaatatct caaaatcaca atctacgcta    144060
     gtctctgcca tcggaacttg tcctatataa acatttcctg tagcaccatc gattgataac    144120
     atctcacctt cttttatcgt ttgatgccca atagaaattt ctcgtcttac ttcatcaacc    144180
     aataattgac tacagcctgc aacgcatggt ttccccattc ctctggctac tactgccgca    144240
     tgggaggtca ttccgcctct tgctgttata atcccgtttg cactaaccat cccctcgata    144300
     tcttcaggtg atgtctcttg tctgaccaat agcactggat ttcccttttt catctcttga    144360
     acaacatctt ctgcatggaa ataaactttc ccataagcag ctccaggaga ggctggaagt    144420
     cctgtcgtca aaagaatagc tttctttaaa ctttccaagt caaaagaagg gtgtaataac    144480
     tgatctaatt gtttaggctc gatacgtagt atagcttctt ctttactaat taggccttca    144540
     tttacttgat ctactgctat tttgatagct gccttcgctg tacgcttacc gcttctcgtc    144600
     tgaagcatat aaagattacc attttcaatt gtaaactcca tatcttgcat atcgcgataa    144660
     tgagcttcta acttttgggt aacgcttaca aactcttggt aaataatagg catttgttct    144720
     gccaactttg atatggattg tggtgttctg atacctgcaa caacatcttc tccttgtgca    144780
     ttaatcaaat actcaccaaa taaatttgct gctccagttg atgggtttcg tgtaaaagca    144840
     actcccgttc cgctgttatt tcccatattc ccaaaaacca tagcttgaat attaacggct    144900
     gttccaagcg tctccgaaat atcatttaat ttacgataaa tcttagctct tggattattc    144960
     catgatttaa aaactgcctc aattgctaac aaaagctgcc ttttaggatc ttgcggaaat    145020
     ttttctcctg cttctttttg atatagttct ttgtaaaatt caacaagtct ctgtaaatct    145080
     gaaccagtta gttctgtgtc atcttgataa catttatctg tcttaagtcg atctaaaatg    145140
     gtatcaaatt tatattttgg aatgcctgta accacatctg caaacatttg gataaaacga    145200
     cgataactgt cataagcaaa acgctcgtct tctgtctttt tcactaaacc ttggacacta    145260
     cgatcattta accctaaatt taaaactgta tccatcatac caggcatcga aaaaactgct    145320
     cctgaccgaa ctgacaccaa caaaggatca tcaacacttc ctaattgctt gttctgttca    145380
     acctccaatt gtgccattgc ttgatcaatt tgactaagaa tactctctcg gatatggcaa    145440
     gcgttatcat aataatcatt acaagcctgt gttgtaatag taaaaccttg tggtaccggt    145500
     aacccaatac tcgtcatttc agctagatta gctcccttac cacctagcag ttccttcatt    145560
     tccttacaac cttcatcaaa atgatacaca aacttagttt ccatcagcgt ctccttttac    145620
     agatttttag ctacttgtcc atttgttttt aagatttcta aaataatcgt tgctgtttct    145680
     tcgattgctt tatcagatac attaatgatt gggcaaccta aatttttcat aacttcttca    145740
     gcatacctcg tctcctccaa aatccgttct aaactggcat aatttgccgt actagaaaga    145800
     cctaaggact ttaatcgaac ttttcggact tgattaagat gatcaaccga attagttagt    145860
     ccgataattc tcctagaatc aatcatacgt aattctttag gaacaggaac ctctggaacc    145920
     aaaggaatat taataacttt aatattttta tctgctaaaa acatacttaa tggcgtttta    145980
     gaagttcttg aaattcctat aataactaaa tctgcttgta aaatacctcg cggatctctc    146040
     ccatcatcat attttactgc aaattctatt gattctactc ttttgaaata atcattgtct    146100
     aagcgtcgta aaatccctgg ttctcccaaa ggatctatac ccgatatcct tgatattcct    146160
     tgaataacat ttgttaataa gtcaacataa gcataatgtt cactttcaca tcgtttctgt    146220
     gcataggaag ccaaagcaac atcaactaaa ctaaacatca taaatactgt cttctggcta    146280
     gcctcttcaa aaacttgttc taagcgttcc tgactgttaa tataggaaaa acattgaaaa    146340
     tgccaatcat catgtcctgg aaattgtgac aaacacgctt ttgcaatagc tttggctgtt    146400
     tcccctaaag aatctgaaat aataaatata gtgagttgat cttccatcag tttcctccta    146460
     ataatctctt atttctaaaa acaaactagc gaggattgtt ttagataatt tcccgatcac    146520
     tttaaatttt tcgggatatt gcttatcatg acgaacgaca gggagactat ccacttttct    146580
     gctcactaat ttatcagctg ccgcaaaaag actttcattt tctaaaacag ttgtcacgtg    146640
     tggcatacgt gtcatcacca ttcctattgg cattttagaa agatctcctc cgccaatact    146700
     ggtctttaat aaatctttac gtgacacgac tccacagaga aaatcatcat catccaagat    146760
     aaaagcacaa ccagcatctt ccataaaaat atgtacaata acatcataaa ctgaatcttt    146820
     ttgatgaact gtcagaggga tccccataat ttctgaaact gtcatctttt caaaatgact    146880
     tgtccctatt gaagcatgat actgtcctaa ataaaaataa ccaaccttag gttttgcatc    146940
     tatgatacct agcatactta aaaccgccaa atcagacctt agtgctgctc ttgttactcc    147000
     taatttctca gctattagct caccagtaat gggctgaaac tgtttgataa tatcaataat    147060
     tctttcttgc ctttgattta attgaataag atcaccttct ttatatattg tatactattt    147120
     attttatatg ttatattata tatctttttt tactgaaatc aagtaaaaaa agatactatt    147180
     ttaaaaataa tcatactata tatttgcttt tagacatatc ttttgttaaa ctttcttcga    147240
     aaacgttttc gaatataagt atcggaggtt gtaatatgac aattaaaaat ctcactgttg    147300
     caggaagtgg cgttctaggt agtcaaatcg cctttcaagc agcttacaaa ggaatgtctg    147360
     tcaccatcta tgacattaac gatgaagctt taaataaggg aaaagaacgt atcaaaaaat    147420
     tagctaaagt ctatcaatca gaaattgaaa cagcaaaaga agcatatagt gataaagcta    147480
     aaagtatcaa gtataataaa aacttattgc ctagcttaga ccatattttt ctttcaaaag    147540
     ttgccgattc attagacttg attgctgatt taccaaacca aattactttt tcaaaaaact    147600
     tagaccaagc tgtaagtgac gccgatttag taatcgaagc tgtcccagaa acagttagta    147660
     taaaagaaga tttttacaaa caattagcta aagtggcacc ttcaaagaca atctttgcaa    147720
     caaattcttc aacacttgtt ccaagtcagt ttgctgatat aacaggacgg cctgataaat    147780
     ttttagcaat gcatttcgct aacaatattt ggcaaaataa tattgttgaa attatgggac    147840
     ataagggaac tgacgacgag gttgtcaaag aagctttggc attctcaaaa gatattggta    147900
     tggtaccttt acatattcat aaagaacaac ctggctatat tcttaattca atactagttc    147960
     cattcttaga gagtgcatta gcattgtact ataataaggt ttctgattct gaaactattg    148020
     ataaaacctg gaagttagga acaggagcac cgatgggacc tttagaaatt ttagatatta    148080
     ttggcatcga taccgcttat aatatcatga agaattattc agataccaac agcgatccta    148140
     atagtcttca tgctcacctt gcaaaaatgc ttaaagaaga attcattgat aaaggacgta    148200
     ccggtaaagc tgctggacac ggcttttatg attacgacta aactataaaa gaggttagat    148260
     aaaaatctaa cctcttttat aattcaacta aagaatagtt gcaccaagaa cagttttaaa    148320
     atgatttaaa gcccattgat gattactatc atttaagcta gctacagctg ctgctgggac    148380
     ctcaatttta taacctaagt tataagcatc aattgctgtg tgtaatacac aaatatctgt    148440
     caatactcct gtcaatatca aagtatctat tcgtctttca cgtaggcgaa tatctaaatc    148500
     agtgccagaa aaggcagaat aatggcgctt atctatccaa aaaacacgac tatcttcctt    148560
     aatagtttca tatagagttc ccaaaggacc atataggttt ctaccagaag tccctttaat    148620
     attatgctca ggaaaaagat tggtctctgg atgaaaaaca tctccaatat catgattatc    148680
     aatcgcaaaa aaaatataat cccctgaccg gtatgctttc tctgtaacgt cagctatagc    148740
     tgaagcgata gattgcgctg gtttacctgc cgttaatttc ccatcatctg ccacaaaatc    148800
     atatgtgtag tctattgaga tgagtgcttt tgtcattttt cttcttatct cctcttgatt    148860
     tcaaaaaagg aactgaaagc tactcccagt cccatgctat gattaattat attcttttaa    148920
     tttgtcaaaa ataccttcgt taataacttt gaggtatgtt cccttcatac cgagtgagcg    148980
     gctctcaatg attcccgcag actccaattt acgaagagca tttacaataa cggaacgtgt    149040
     aattccaata cggtctgcaa taacagatgc cgttaggcgt ccttcaagtc catctaattc    149100
     tcctaagata gcagctacag ctttcatttc tgaataagat agagtgttga tagccattgt    149160
     caccgctgtt tgtttacgaa tattttcttc tagattttct gtttgaaggt taagtaattg    149220
     aataccaaca acggtgcttg caatttcaac taaaatcaaa tcatcgtcgc taaattcttt    149280
     atcattacgc cagataataa atgttcccaa gcgcattcca ccaccataaa ttggagcgat    149340
     tgttgtaata ccatcttgga agttttcctt tgtctcaact gggaaaattg acaaatcatt    149400
     atctactgat aagttagctt ctgtatcata aacacgacta gcagatttaa catagtaatc    149460
     tgggaattgt tttgtttcaa aaaattcttc cacacggtca gtgtttgttt tatatttcat    149520
     ggcatagcca agtaagttac caccaccatt aataatacat gcgttacagt caataatatc    149580
     agctagttga gccgccattg tattatatgg taattcggca tctaagctat ctacggaacg    149640
     ctgtaagatg gatgtaattt ttctagtttt ttctaataaa ttcggcattt ccttcatcct    149700
     ttgtatgttt tgcgttacaa ttatatcaaa gcattttagc ttttgcaaat cgatatcagt    149760
     acattttaag aacttctatt attaatttaa tgtttatcta ataaaaattc attctagcgc    149820
     ttgtattggc ttaaaaagcg agccattttt tcttgtagtt cagtcaattc atcaacacgt    149880
     ggtaagtaaa caattctaaa atggtcagcg gtattcatat taaatcctct accgtgtgtt    149940
     agtaatactt tttcttgttt taagaaatta agcacaaact cttcatcatt atcaatacgg    150000
     tacatatctg tatcaatttt agggaaaaga tacagtccag catttggttt tacagcagat    150060
     aaaccaggta tttcattaat tgctttatgg atataattac gttgctcgta gatacgacct    150120
     cctggcaaca acatactatc aatagattgc tgtccgccta acgatgtttg aataacctgt    150180
     tgagcaagaa catttgaaca cagcctcatg ttagctaaca tattcaaacc ttcaatataa    150240
     cctttaacat gttgtcgcgg accagacaat accatccaac caacgcggaa accacagatg    150300
     cgatgtgatt tagataagcc agataaagta actgtaaaaa tatcctctgc aatagaagca    150360
     attgggatat gctccattcc atccataact aaacggtcat aaacctcgtc tgaaaaaata    150420
     atcaagtcat tttgtctagc aatatccaca atctcttgca aaatttcacg cggatagact    150480
     gctccagttg gattatttgg attaatgagg acaattgctt ttgttttgga tgtgattttt    150540
     gatttgatat catcaatatc aggataccaa ttagcttcct catcacaaat ataatgcaca    150600
     gcatttccac cagcaaggct aacacaagct gtccataacg ggtaatctgg cattggaact    150660
     agaacctcgt catcattatc aagcaaagct tgcattgaca tagagattcc ctcactaaca    150720
     ccattaacaa tgtatatatc atccatgtca acatggatgt tttgtaactg gtaatactgc    150780
     ataacagcct tacgagctga aaaaatacct ttcgaatcag agtaaccttc tgattcacgc    150840
     gcattcgtaa ttaaatcacg aatgacttca tctggcgctt cgaagccaaa ggcagctgga    150900
     tttccagtgt ttaaccgcaa tatcttttca ccatttgccc tcatgcggtc cgcctcttct    150960
     aaaacagggc ctctaatatc ataagccaca tgttccagct tcattgattt atcaaatatc    151020
     ttcataaaaa tacctcgtat cttccattat aaaacaaata ttctcaaaat tgaaacattt    151080
     actgcggttt atcaagcgat taagttaata ttaagctatt tcagaaaact aacataaaac    151140
     gctttcattt ttctagaaaa aacgttataa tatagctata aaatgaataa ccaacatatc    151200
     taacttactc atcactcact ccttctgata agatggctag ttgagtacaa gaggttatct    151260
     ctttttggtt atatttagag gaggacaggc ttatgtcaca aaaatatgaa cgcatccttg    151320
     tcgctattga tggatcaaca gaatctgaac ttgcttttga aaaggcagtt aacgttgctc    151380
     ttcgcaatga ttctgaatta atcttgacac atgttataga tacacgtgct ttacaaagct    151440
     ttgcgacatt tgatacttat atctatgaaa aattagaaaa agaagcaaaa gatgtccttg    151500
     aggaatatga aaaacaagct cgtgaaaaag gagcagataa agttagacaa gttattgaat    151560
     ttggtaatcc caaaacatta cttgcacatg atattccaga aaaagaaaaa gtagacttga    151620
     ttatggttgg tgcaacaggt cttaatacct ttgagcgttt ccttatcgga tcttcctcag    151680
     aatacatcct tcgtcacgct aaagtagatt tactcattgt acgtgatcct aataaaacaa    151740
     tgtaaattta aatacgctca ctttctaaaa tatcctgagt tatattaact caggatattt    151800
     ttattttcga tttaaggatt tctgaatttg gctatctaat tcacgtcgaa ttgatggctc    151860
     aggagcgaaa tgttcttccc agtcgtctgg ttttaaaatt ttatgagtaa caggatcaaa    151920
     atgagctttg ccatctggaa agattttacc catattggcc tcatgtactg tatcaaaaag    151980
     aggttttggg tcgactccca taagaacaaa ggagccataa gtcagataaa gtaaatctgt    152040
     taaggcatcc acttctccca ctaatggtgt ttctggatgg tctttagaaa taaccttatc    152100
     tcttgcttta tcaatagcta agtgtaaatt acggatagat tggtcaaata ctttttggtt    152160
     accttgacta gcagcataca agaactcaac gatttcttct actttaaagt ctgacctgaa    152220
     accagcttcc ttactgtcat ataagcgtgg cgtttcaata gtttcaccat ccattaatag    152280
     atggaaggat tttactttat tgaaattctc gtcacgacta ctgaatgttt tttcaatctc    152340
     aaattgaata agtccataat gggctaatgc cttagagata ccatcatcat tattgtcagc    152400
     agttgtataa cgtgcatttt ctttcacttg ctgactggcg ttccccatgg caacaccaat    152460
     gccaacttga gataacatct caatatcatt atcagaatct ccaaatgcta tcacttcgga    152520
     taaatcaaaa ccatagcgtt gaccaacacg ttcaattccc ttaacttttg actgctcttc    152580
     agaaatgaca tccattgagt aaggactgct tcttgttaat ttaacacgag gaaattgttt    152640
     ttgaattcgc tctgattcgc cctctgttgc aactaaaacg acctgataaa taggttctcg    152700
     taagataatc atgaggctat caatattttg aggtttaatc cgacgaataa aatgcttaaa    152760
     gcttcgttca atcgcttttg cccattttct cggaacaagg ctagatacaa tctgccccaa    152820
     acggctagtt cctagaccaa taatacctga accgagtaat cccgaggctg ttcctaatga    152880
     aatttctctt cttcttgctc cagcatatcg aatcagacga tagacagttg tcttagataa    152940
     ttgattggta taaataattt cacttctact atagatatat tgaccattat aggttacagc    153000
     aaaatctaaa ccaaggtttt ctaaaaaagg ttgtacaaaa ctaggacctc gccccgttgc    153060
     taaaccgact agtattcctt ggtctttcaa atttcgaatt gctttaattg ttgacttttg    153120
     tacattctta cgatcattaa gaagtgtacc atcaatatca aaaaatactg ccttaattgc    153180
     cactgggtca acatcccctc ttttttatga taaaataaat tatatcacaa cttgaaagaa    153240
     gtataaaatc aatgaaaaaa atccttgttc tacatacagg tggaacgatt tccatgaatg    153300
     ctaacgagaa gggacaggtc atgtccagcg ccgataaccc aatgaaatac gttgatttat    153360
     cattagatga ccttgatttg actgttgtag attttctaaa tcttcccagt cctcaaatca    153420
     cccctcatca tatgcttgat atctatcact atctgaaaca acatgccagt aattttgatg    153480
     gtgttgtcat tacgcatggg actgacactt tagaagaaac agcatatttt ttagacacaa    153540
     tgatactccc taaaatccca atcatcatta ctggtgctat gagaagcaca aatgaacttg    153600
     gtagcgatgg cgtttataat tacctatcag ccctccgtgt cgctaatagt actaaagctg    153660
     ccgacaaggg ggtgctagtt gtcatgaatg atgagataca tgctgctaaa tatgtcacaa    153720
     aaacacatac aacaaacgtt tcgaccttcc aaacccctac acatgggccc cttgggatta    153780
     ttatgaaaca agacctgctt ttctttaaag caactgaaga gagagttcgt tttgatttag    153840
     ataaaattac aggaactgtt cctatcgtga aagcatatgc tggcatgggt gatagtggta    153900
     tcattagctt tttaaattct caaaatatta gcggattagt tattgaagca ctcggtgcag    153960
     ggaatatgcc cccaaaagct gcacaagaaa tcgaagaatt aattgagcaa ggtgtccctg    154020
     ttgttctagt gtctcgctgt tttaatggta ttgctgagcc agtttacgga tatgaaggtg    154080
     gcggagcaag attacaagaa tctggtgtca tgtttgttaa agaactaaac gctcccaaag    154140
     ccagactcaa attactcatt gcactcaatg caggtctcac agggcaaaat ctaaaagact    154200
     atattgaagg ttgataaaaa actctagaaa tatttctaga gttttttatt aattttcagt    154260
     ttgtaatact ctctcaacac tgctaatagg catttcttga ttcgttatta attgaaatgc    154320
     ttctgctcct tgataaatca gcatccctag accattataa gcatgtttca ctccattttg    154380
     tctaacaaat cgtaacaatg ctgtttcttt aggcttgtaa accaagtcga caactactaa    154440
     attgggtgtt aaaatttctg gatcgttaat taaactataa ttatctaatg gcctcattcc    154500
     taaactagta gcatcaatat aaaaatgact agttctaata gcgtctttaa atgctgtctt    154560
     attttctaga taatcaacga ctacctttat ttgaaactgt tttttaattt tatctgataa    154620
     gtcaatgacc ttatcgtaat ttgagctatt acgattaaat aatctaattt ccgcaactcc    154680
     ctccatagct gcttgaactg caactgcttt acctgaacca ccaataccag ctattgtaac    154740
     tattttattt ttagcactga aaccttgagc tgctaaagct ttaaaacaac caatgccatc    154800
     tgtcatatgg cctactaaac gtccggttcc accttgatta acgatagtat ttacagcacc    154860
     cactaattta gcttgaggag ataaatcatc tagcaaaggg ataacactct gtttaaatgg    154920
     cattgaaaca ttaacaccac gaatacccaa tgccctgaca cctcgaacag cttctgttaa    154980
     tttaccctct tctacttcaa atgtcagata ggcataattc atgttttttt cttgaaaaga    155040
     ggtattccac attaacgggg atagagagtg gcgtgcagga ttggcaatta gaccagttag    155100
     taaagtttcc ccatttaatg aattcattgt ataaccttct ttcttaacaa tttatttcag    155160
     ttcattttac caaaaactga ctcaattaaa aagagagtat gtaatttata ctctctccct    155220
     tagtttaagg caatatatta cctgcactac ggtaaatatc ataccattct tcacgggtta    155280
     aagcgatatc attagcctta tcaattgcct ttaaacgaga tggattcatt gaaccaacaa    155340
     tcgcctgtat ttgggcagga tgacgtaaaa tccatgcaat cacaatagct tcgctgctaa    155400
     cattgtagtt ttttgccagt ttagctatgg tttcatttaa ttccttataa tccggatgat    155460
     taacaaataa accacgagat aaatcaattt gaaatggaga ccaagcttga atggtaactc    155520
     ttttgagacg acaataatca acaatgccat catcatgttc aattgaagct ttatttaaca    155580
     tgttaacatt taaccctgca tcaaacattg gtgtatgtgc tggcgataat tgaagttgat    155640
     tcactgctaa gggctcgtca aggtaggatt gtaacaattc catttgaaac cggttttgat    155700
     tgctaacacc aaagtgtttt actttacctt ctgcccttag tttagtaaat gcttcagcta    155760
     cttcttcagg ctcaactaat acatctggac gatgaagaat gagaaaatct aaatattctg    155820
     tccctaatct ttctaaaata ccatctactg atgataaaat atactcttta gaaaaatcaa    155880
     agtaaccttc tcgtatccca catttagatt gaataatcat tttgtcacga ttgacattta    155940
     aatgtttgat tgcatctcga aagcgtaatt cagatagccc tcccccataa atatcagcat    156000
     gatcaaaaaa attaataccc aaatctaatg ctgttccaac tacttcttca gcttgttttc    156060
     cttccaagtc actcattctc atacaaccta aagcaattcg agttgcttga atgcctgttt    156120
     gtccaatgtt ttgtaacata tgcaccccat tctaatctgt ttgtattaac agaaagatta    156180
     atcaattcat tataacaaaa tttctatgaa aaggcttact attacaaatg caaaaagctg    156240
     agtaaattta actcaacttt ttttctgata ctcattattg actaaataag tcggtaagaa    156300
     aaatctattc tgaaaagtac tattataaat tacagtaatc attattgtca taacatacct    156360
     ccacatctgt gataggaata tcatatgaca gcaagcttaa actgagctta gcacagcctt    156420
     aatagaaact taatcaaaat ctgaatgttg gcgtaaatta tctagaataa gtgcccattc    156480
     tgtattttct ttccaattat tatctttgac aatatcacta gcaacacgtc tggcttcttc    156540
     taaaatagga taatcctcaa cgatatcagc tacttgaaat tctggaattc cagactgacg    156600
     agtaccaaag atttcaccag aaccacgcat ttttaaatcc gactcagcta aaacgaaacc    156660
     atctgtcgtt tctgtcatga ttgtcattcg ttttttccca gaatcagttt tgggattagc    156720
     cactaaaaca gcgtatgatt gtttatatcc acgaccaaca cgcccacgaa gttgatgtag    156780
     ctggcttaat ccaaaacgat cggcatccat aataatcatg atcgttgcat ttgggacatt    156840
     tacccctact tcaataactg ttgtagatac taaaatatga ctttttttat ccttgaaatc    156900
     ttgcattata gcatcttttt catcattttt catacgtcca tgtacaagag caaccttagc    156960
     aattccttca aaataagtag ataattcagc atgcaatgct actgcattct ttaaatctaa    157020
     agcttctgac tcttcaatca acggtgaaat gacatacact tgagcatctt tttgcaattc    157080
     accttttacc cattccaaca cagtacctag ctgctcgtgt ttcacccagc gtgtaataat    157140
     aggtttacga ccggcaggta attcatcaat aatagaaaca tccatttctc caaaagctgt    157200
     gattgctaga gttcggggaa ttggggtggc tgtcatcatt aaaacatcag gattttctcc    157260
     cttttcacgg aaaattctac gctgtttaac accaaaacga tgttgctcgt ctgtaattac    157320
     aagccccagt ttatggtact gtaccgagtc ctggataaga gcatgagttc ctacaatcat    157380
     atcaaccgag ccatttgcaa tagctgctaa aaccgtacgc ttaacagctg ctttcatacc    157440
     cgaagttaat atagcgattg ataaatctgg aaataactct tgcagactaa tgtagtgttg    157500
     ttcagctagg atttccgttg gaaccatcaa agccgattga aaacctgctg tataagctgc    157560
     atacattgat agaccagcaa tgactgtctt tcctgatcct acatctcctt gcaataaacg    157620
     attcatatga gctcccgatg acatatcaga taatatttca tctaaagagc gcttttgagc    157680
     attcgttaga ataaaaggta aagaggaaat ttttgtctcc atagcatgtt tactataaag    157740
     aataggcaaa ccatttgttt cagatttatt ttcggatttc aaaacttgaa ggttcatttg    157800
     aaagtaaaat aattcttcaa atttaatccg acggagcgct tgcttatact ctgtgatatc    157860
     ttttgggaaa tgcatagcta aacaagcctg actacgaccc atcaatcggt atttttccaa    157920
     taaagtagct ggtaaatttt ccttcaattc caaatgcgca ctgatttcaa aagctgactt    157980
     aatagcttta atcaaagtag actgtgaaat tccctgagct acgcgataaa caggttgcat    158040
     gtcatcttca acttgagcta aaaccttcat cccagtaata gctgatttag ttgcatccca    158100
     tttaccaaag acagctacct cttgaccaag ttctatttta tcagctaaat agggttgatt    158160
     aaaaaaacta acatttaaga cagcttcccc ttgacgcaac ttaaaactta aacggttacg    158220
     tttaaaacca taatattgta cattagctgg agtaacgact aggcctgtaa tgactgcttt    158280
     ttcaccatcc actaaatcaa aaacagattt tgatttaaaa tcttcatagc gaaacggata    158340
     ataaagaagt aaatcttcta ctgtataaat atctaatttc tgaaattttt ctgctgattt    158400
     tggtccaaat cccttaagat tagaaattgg tgattgtaat agcataagat tctccttcta    158460
     atatctttta ttatactaaa agatcaccaa aaaggcgcct caagagcgcc tttattatgt    158520
     ctaattattt atggccaata acataagtta attgtgcagc ttgtgctgaa ctaaaagtac    158580
     ggtaagagac aataccacgt cccattgcat tagattctga aataagaact gaaccatctt    158640
     ttttaacttc ttcaacaata gctacgtgac cgtaagtgcc atcagcacca gcttgtcctg    158700
     gtgaaaatga tacagcatag cctacttttg gtgaatgtgt tgtttcaaaa ccagccttat    158760
     gttgccaatc tccaccatta cccataaatg gatcaaatgt ataacctaac tctttagctc    158820
     ggttaaagac ataccatgta cattcacccc atggataagt tgatgcaata tagctagctg    158880
     tgttaactgc tgttgataag ctaaaaccac ttggtaaatc tgctaaactt gctgtcgata    158940
     aagctttcaa ggcagcagga atttctggtg tccctccatg ttgatcaatc cagcggtcta    159000
     aatcttccat aatctgggca cgacgtttac cagttccaga gttatctgta taataaacac    159060
     caccctcagt aactgtatta agttgtccag aagataattt ctgtgctttc aaatcttgga    159120
     tttcaaagct agagttgttg tttttaataa ttgtattttt tgtcaacaac ataattgctt    159180
     cttcatcatt ataagcacta gcatggctag agtcatgatc aaaggcacca taaccaaaca    159240
     tattagcacc tggcatctta gccactcctt gagttcccaa tgaactttca aggacagcaa    159300
     tagctacaat agcacggaca tctaaaccac tatctttttc ccattgtaat aacttagcac    159360
     cattgatacg attagaatca tattgaatcc ctaaagattt taagtaccca tctaattgtt    159420
     cagctttgat accgtaacga tgtgacaata aatagtgaga gtaggcatcc tgaccagacc    159480
     agtgttctac gtagaatggc gttgctgtca ctggtgaaat cggtgttgat aataagttat    159540
     catcaaagga taaagcagga acagaagcat tctgatttgt ctgaacactt tctatctgag    159600
     acggagcggg agttatttta ggctctacta atggtaaggt aggctcaggt tttaattcag    159660
     tctttgttga ttgacctggc ttactgtctg cttgactact gtttgtagta ttagtgctag    159720
     gagtagatgc tgttgaagca gaatcagatg ttttagcatc ttcgttggaa gaagattgat    159780
     gtgatgaact tgatgatgat tcattgcttg atgatgtctc tgtcgtacca atctctgttt    159840
     tttctgttga gatacttcct tcggctgaag gtgaagcagt ttctgaatct gtaggttgtg    159900
     ttttttcctg tttctctgct tcagaagaac tttctgttga tgctgttgcc attgtcaggc    159960
     ttgtttctgg attaatagtt tctgctaagg tcactaaagg tgatgatagc gataagacta    160020
     aagtggataa caacaaagtt gccattactt tttgttttga catatactaa tgatttcctt    160080
     ctataaaaat tgtcactgat tagtttaaca tatttttaaa ttttttaaaa cagttaacta    160140
     ctgtgtcatt tgtttttaat aatatctcgg aatacgatcg cttaaaagac aaagtacttc    160200
     ataattaatc gtctgtcttt tttgagcgac gtccgtagtt gtaatgttac aactaccttg    160260
     ttgaccaatc aaggttactt tagttccgat agtatatttt tgaggtaaac ggatagtcat    160320
     ttgatccatc gagacacgcc caataatttc acaaagttct ccatttacta taactgaaaa    160380
     tccttgcata tctcgtgtcc atccatcagc gtagccaatc ggtactgttc caacaaattc    160440
     gtctccagta acttgatagg ttgcgccata gccaacttga gaaccatcgt gtagttgttt    160500
     aacatgtact agctcagact ctaaacttaa agcagggttt atagggtaag gtaagtctaa    160560
     atcagttcca cttggattta agccgtacat aacaacaccc aatctaacgg cattaaaaat    160620
     tgtctcacta tgccaaaggc ttgtagcaga attactagca tgaacaaggt ccggacaatt    160680
     atctaatcct gaaataaagt ctttaaaaaa agtaagttgt tgattgaatt tacagttatc    160740
     ggcttcatca gctgttgcaa aatgggtgaa aatccccttg acagaggcac cactttcccc    160800
     caattcagaa attagcttat ttccttcatc taactggcga acacctatac gtcccattcc    160860
     actatcaact ttgatatgta cttctagacc agataaatct actgctgatg tctgacataa    160920
     acgtaaccac tccaagctag caactgttag agtaatattt tcatttttgg ctagtataac    160980
     ctgctcaggc ataacaacac ctaataccaa tatcattttt acaattcctg cttgacgtag    161040
     ctcaatagcc tcatctaaat tggatacgca aaaaccatct acaatagact caatgtattt    161100
     tgaaacttca acagcaccat gcccataagc attagcctta actacagcaa atgttttttt    161160
     atcacttgga atgtgctctt gtacagattt aacgttattt gcaatcgcct ctaaatctat    161220
     caaggctctg gttggtctat gataacttga aatcattttt cttcctccaa aataacacta    161280
     gcttgtgcat aattaccact atgagatatt gaaacaaaag attttccatt aaacggttct    161340
     tttgtaatca aaggcgctcc tttatcatcc gataaaattt cgatatcatg aaaattaact    161400
     ttcccaattc ctgttccaag tgctttgcta taagcctctt ttgctgccca tcgccctgtt    161460
     aaaaaagaca tctgacgctt gggattggaa attcctttaa aaagaagcaa ttcttgttcg    161520
     gtcaaaacgc gttctgcaaa acgttgatta cgctcatatg ctttagtaat cgcctctatc    161580
     tcttgtaaat caattccgtg tccaacaatc atgtgtaact cctataagtt cgatacttac    161640
     aaactattgt aaatatccct aattagcatt tctgttttat cccaacctag acatggatct    161700
     gtgatagact taccaaaaac atctggttta tcttgtcttc catcttctaa ataagattct    161760
     atcaaaaaac cacgaacata gtttctaatt ttagtatgcc actgtcggtc tgcaagtact    161820
     gatttcacaa tgcgaatttg ttctaaaaat tgcttacctg aattgtcatg atttgtatca    161880
     acaacaataa agggattttg caaatcagtc tcttcataat gagtaatagt ttctaaaagg    161940
     ttttcataat gataattagg gatacttcga tagtcggcat tatgatatcc tctcaaaata    162000
     acatgtgaca gcaaattacc atctgttcta acttgcttat tttgatagaa taattcctgt    162060
     tgattttgtg ctgcatagac cgcattaagc atgactctta aattaccaga cgttggattt    162120
     ttcataccta ctggtgcatc tatacctgaa gatataaaac ggtgtccctg atcttccact    162180
     gaacgcgcac caatagcata gtaagaaact aaatcatcca tcactgataa catctctgga    162240
     taaagtaatt catcagctgt caggagtcca gtctctcgaa tgatgtcata gtgcatctta    162300
     cgtgcttgaa aaaaaactcc tagtttgtca gaatggtgaa ctaagccttt ataaccatca    162360
     ccattcgttc ttggcttagc ggtataaact ctcataacca aaaacatttt atctttaaag    162420
     gcagcttcca atttagctaa acgctttgca taagttagca ccgcctttgg attatccgca    162480
     gaacaaggac ctactattac tagaaaccgc tgatcctcac cttttatgat attttttaac    162540
     tcttcttctt tggctaattt tttttggcta acttctagat ctaagctagt tttctgcttc    162600
     aatatttcaa tattaatttt atcacttaac tgatgaaatc ccatgttttt tcctaataca    162660
     acctaagtct attaataagc tctgctatac aatatagtcg tcatactatt agacaagtaa    162720
     tgataaaaca gtcttctcag actgttttat ttttatttta aaatcattgt tattgtaaac    162780
     atctcagacc atgacaattt ttaaacttca tgccagagcc acaaggacat ttatcattac    162840
     gtttaatccc ttggtattct ggtgattcat tattcatagg tacatgttgt gccgagatat    162900
     tttgctctgc tgttgtcgta gcatgttgag aagcacgttc acgctcttgt tcatgaattt    162960
     gagctttcat caatgtacgt gtcacatcaa actcaatcga accaatcata tcttggaaca    163020
     tacggaaacc ttctgattga tactcaacga ttgggttatt ttgagcataa ccacgaagtc    163080
     caacggagtt acgtaattga tctaaggcat caatatgctc tgtccattga ttatccacta    163140
     ccatcaagat taagactttt tggaattcga taatagcttc tggatctttt aatttagcaa    163200
     tttgttgctc ataaacagct aaggcacgtt cataaagaag ttctttaatt tcagcctctt    163260
     ttagaccacg aagttctgaa actgtgatag cttcttcatc taataacgcc gatcttgcaa    163320
     aattaacaat agcttctgct gcagtatttt tatcgcttct gctatgtgca tcaactgctc    163380
     ttttaatcgt acgtttaatc atccctttga gctctggtcc taaatcacgc tcagcagtaa    163440
     tcacttctct acggttagca taaataatct cacgttgttc acgcataaca tcatcgtatt    163500
     gcaagacttg tttacgtgtg tcatagttat taccttcaac gcggcgttga gctgattcaa    163560
     cttgtcgtgt caacattttt gatttaataa ctgtatcatc ttcagctaaa ttcattcgct    163620
     caagaaccac tttaatacga tctgtaccaa agcgacgcat caaatcatct tctaacgaaa    163680
     gatagaattg tgattcacct ggatctcctt gacgacccga acgaccacga agctggttat    163740
     caatacgacg gctttcatga cgctctgtac caataacaca taaaccacca agttcacgaa    163800
     ccccttcacc aagcttgata tcagtaccac gaccagccat gttggttgcg attgtaacag    163860
     caccacgttg cccagcattc ataatgattt gagcttcttt aaagtgattt ttagcattca    163920
     aaacttcatg tggtactcca gcagcaacta attttctaga aattaagtct gacgtttcaa    163980
     cagctactgt accaaccagt acaggttgtc cttgttcata acgttctttg acatctgcta    164040
     ccaccgctct aaatttagag tcaagagttg gataaagtag atctgaatga tctatacgtt    164100
     gaacaggacg atttgttggg ataggaataa cgcgcatatt ataaatttca cgaaactctt    164160
     cttcctcagt cttaccagta ccagtcattc ctgctaattt atggtacata cggaacatat    164220
     tttggtaagt aattgaagcg ctcgtttttg attcttcttg gattggcact gactcttttg    164280
     cttcaatagc ttggtgtaag ccatctgaga aacgacgtcc ttccatcgta cgaccggtaa    164340
     attggtccac aattaaaatc tcttgttctt cactaaccac ataatcaata tttaacaaca    164400
     taatatagtt agctcgaaga gcgttatcaa tgtagtgagt taaggcaaca ttttcgagat    164460
     catacaagtt atttagatgg aaatagtttt cagccttgtc aatacctgta tctgataaac    164520
     caattgtttt tgttggaaca tcaatgatat aatcatcgct attaagcgtt tttacaaaca    164580
     tgtccgcacg tgtatacagt tggttcatct cagagcttac aggacctgaa acaatcaatg    164640
     gcgtcctagc ttcatcgatt aatacagagt caacctcatc aaccaaagca tagttgagtg    164700
     ggcgttgcac catatcttct tggcgaacaa ccatattgtc tcgaaggtag tcaaatccga    164760
     cttctgcgtt agttgagtat gtgatatcac aattgtaagc ttcgcgtttt tcaaatggtg    164820
     acttagctgc taagttaatc cctacagata atccaagcca actataaacc tcacccattt    164880
     cggtcgcatc acgtgttgat aagtactcat taacagtaat aacatgaaca cctaatcctg    164940
     agatagcatt tagataaaca ggcattgtcg ctgttaaagt ttttccctca ccagtacgca    165000
     tttctggaat atcaccatgg tgaagaacga taccacccat aatttggacg tggtatgggt    165060
     ataaacctaa tacacgttta gaagcttcac gaactaccgc aaacgcttcc ggtaacaatt    165120
     gatctaaagt ttcaccattt tgataacgtt ctttaaattc tggagttttt gcttgtaaag    165180
     cttcatctga taacgcagcc atatgatctg cgtaagagtc aactttctta gctattttat    165240
     ctaatttttt taattcaccc ttgtcatttt caataacagt gcgtagaata tttgccattc    165300
     taattccttt cgatactctt atcaccacat tttaccataa ataatgttgt ctttcaataa    165360
     atggtcgttt taatcgagat taaaaagagt ggtatcccca ctctcattat tttttaacat    165420
     gacttgctat aatttctaac tgtccatcaa tatcccattt gacaacatca tttggcaaga    165480
     taaagtggtc acctttttta agtgtataaa ctttgttatc tactgtaatg tgacccgctc    165540
     cgtctaagac actaaccaaa aggtagggtg caaattgttt aaagttggta acaccagaaa    165600
     tttcccattt ataaactgta aagaaatcat ttgaaactaa taaagttgaa gatagatgtt    165660
     ttaacttcat attggcagga acagtattgg caggtttacc aatcgtgaga acatctattg    165720
     attgttcaat gtgtaaatca cgtaattttc ctgaagcatc tggacgatca aaatcataaa    165780
     cacgataagt agtatcacta gattgctgtg tttctaaaat taatatccct ttacctatag    165840
     catgcattgt cccacttgga acgtagtaaa aatcccctga tttaacagga attcgggtta    165900
     aaagatgttc ccaatctcca gattcaatca tttggcgaag ttcttcttta gttttagcat    165960
     tatgaccata gataatttca gatccttcat cagcagaaat aatataccaa cattctgttt    166020
     taccaagttc accttcatgt ttaagagcat aagcatcatc cggatgaacc tgtacactaa    166080
     gccagtcatt agcatctaag attttagtta gtaaaggaaa gacagtatca tcagggttgc    166140
     caaataagct tttttcacct tgatacagct tatctaaaaa acaaccttta aagcgaccat    166200
     tcttaactct tgagacaccg ttaggatgag ctgaaatagc ccaatattct cctgttgttt    166260
     cacttggaat atcatagcca aattcatccc ttaactttgt tccaccccag attttatcgt    166320
     gcatgcttgc ttctaaaaat aatggttccg acataagaat cccctatctt ttgtaaaatt    166380
     caagcctatt atagcatttt atccatcata tcgcttactt tttttaatct tttatttgct    166440
     aactaaacta agtagtggct taagggtttt attaaccttt tgatattttc tttgctaaag    166500
     caaaatttcc taacgttgca gaaccatttt cttctacagc tggtgtcaca atataatcag    166560
     acaaattggg aactggtaaa tacccattta ataaagttgc aaatgtctgg cgaacacgtc    166620
     ttaacatgtg tttttgtgcc atgacgcctc caccaaatac aatgacttgt ggacgatata    166680
     atacagttgc ttgtattgca gcctgagcaa tataataggc ttgaacatcc caaaccattg    166740
     aattttcttc aatcaattca ccacgaatac cagtcctagc ttctagagtt ggaccagatg    166800
     ccaaaccttc taaacagcta ttatgaaatg gacagatacc tttaaaatca tttgcttggt    166860
     cctgcggatg catcgccata taagtatgac ctgcttcagt atgaccagtt cctcctataa    166920
     attcaccctt ttgtatagct cctgcaccaa ttcctgtacc aatggtgtaa taaacaagtg    166980
     aatcaatgtt gttacgagct ataacttcac cataggcaga gctattaaca tctgttgtga    167040
     aataaaatgg aacattgaaa tctttagaaa ttaagccgag taaattaaca ttagcccaat    167100
     gtaactttgg ggtcgttgtg atataaccgt atgtctttga ttttttatca atatcaatgg    167160
     gaccaaaaga accaatagca actgcctcta acttcttttc aaatctttta aagaaatcaa    167220
     cagtcttttt aatcgtttct tgaggcgtcg ttgttggaaa ttgtattttt tctacaactt    167280
     ttaattcctc atcaccaact gcacaaacaa actttgtccc acctgcttca atactaccat    167340
     ataactttgt catctttttt cctatctata atctctatct caaagacaaa ggttgggata    167400
     attatcccaa cctttaatcc tcacttaaca tcaataatca tgtcacctgt agtaacaaca    167460
     ccctctttta ccaatggtat aacatcagca aaatcagctg tattagtcac aataatcata    167520
     gctgtattat ccagacctgc ttctgcaatc ttggctgaat caaaggtgcc aagaatatca    167580
     ccttttttca ctttttggtc tgcctttact ttagaagtaa accctgtgcc attcatggtg    167640
     acagtatcaa tacctatatg aatcaaaatt tctgcacctt tatctgattt gataccgtaa    167700
     gcatgacctg tttcaaaaac aatttggaca aaaccatcaa caggtgagta aattgtatta    167760
     ccgcttggtt taatagcaag gccatctccc ataatacctg atgaaaaaac tgggtcactt    167820
     actgtatcaa gagcaataac ctgtccatca agagggctaa caatcgtttc tgcccttaat    167880
     tggctagttt gagtaattgt tggattgtca tctgtttctt caaccaaagg actaacttca    167940
     gctactactt tttcatcttt atcttcatat ccaaacatat aagttaatac aaaagccaaa    168000
     gccgtagttc caatcaccat aataaggtac ttaacaattt gaccatttaa ataaagtaat    168060
     gttcctggga taatggtaat accaaaacca gttcctgcta atttcaatat tgaagctaac    168120
     cagccacctg ctgctcctgc aattaatccc ataataaatg gcttaccaaa acgtaagttt    168180
     actccaaata tagccggttc tgtaatacca agtccagctg aaagcgctgc cggaaaagca    168240
     agggctttta attttttatt ttttgtttta acaccaactg ccaaagtggc acctgcttgt    168300
     gctgtcatag cagctgtaat aatagcatta aatggatctt tcccatcagc agcaattaac    168360
     tgagcttcaa gtaaattaaa gatatgatga acacctgtaa caacgattat ctgatgaaca    168420
     ccacctaaaa taagacctga taggccaaga ggtaaattaa ggacaaattt tgtccctgct    168480
     aaaacatagt tttcaactga atggaaaata ggaccaatga caaaaagtgc taaaattgac    168540
     ataactgtaa aagttaggaa cggcactaat agtaaatcaa gaacatctgg gattttctta    168600
     tgcaaccatt tttcaagttt agcaccaagt aaacctacaa agaatgccgg caatactgaa    168660
     ttttgataac caactactgg aataaagccg aaaaatttta tgggatgggc atcacctgag    168720
     gccactgccc aagcgtttgg aagggcagag ttaaccatca tcaatcctaa tacgagaccg    168780
     ataacaggat ttccaccaaa aactctaaaa gctgaccaag aaatcaaggc aggaaaaaaa    168840
     gcaaaggccg tgtcagtcaa aacgacagta taggtataaa aattagaact tgaaaatgct    168900
     tttgaagtcg tcccaaataa agctaaaact gtatcattat taatcgcacc gcgaatcccc    168960
     ataaataaac cagtagcaac aatggctggc aacaatggaa caaaaacatc accgaaagta    169020
     cgaatagctc gttggaaagc attcccttgt ttagctgctt ctgccttttg atcagaggtt    169080
     gacgaagttg gcaaaccttg agccactact tcatcataaa tcttattaac agtaccagtt    169140
     ccaaaaataa tttgatattg acctgaattg aaaaatgctc cctgaacttt ttcgatattt    169200
     tcaacagtat ttttatcaat gactgtctca tcttttacca taacgcgaag acgagtggca    169260
     cagtgtgcta cgctacgcac attactagca ccaccaatcg cattaatgac ttgtttagca    169320
     atttctgtat ttgaagccat ctataaatct cctttgatat tttgaaagcg tttcatttta    169380
     tttactctaa tattctagca cgtctcataa atatatgtca agcgtttgac ataaaataat    169440
     attttttgat attaagagtt gatttcaaaa gagaaaacgt ttactatata gttattagat    169500
     attaagacag tcaaggagta tcaaatgaat ttacccactg aaatccgcta tcgtccttat    169560
     gatgaatgga ctgaagaaga taaggaaaat attgtaaaga atgtctcaaa atccccttgg    169620
     agagcaactt atcacttaga agctaaaaca gggcttttaa atgacccaaa tggcttctct    169680
     tactttaatg gaaaattcca tcttttttac caaaattggc cctttggagc tgcacatggt    169740
     ttaaaacaat gggtacatac agaatcagat gatttagttc atttcaaaga aacaggaatc    169800
     aagcttaaac ctgaccatgt caatgatagc catggtgcat actccggttc tgcattagcc    169860
     attgacgata agctttttct tttttatact ggtaatgtcc gtgacatgaa atggaaccgt    169920
     gacccccgcc aaattggagc atggatgaca agtgatggca agattacaaa atttgataag    169980
     gtccttattt cacaaccaaa tgatgtcact gagcattttc gtgaccctca gattttcaat    170040
     tatgataatc aattctatgc tgttattggg gcgcaaaata gtaaaaaatg cggattcatt    170100
     aaattatata aagcacttaa taatgacatc catcattggg agtttgtggg agatttagat    170160
     tttggtggta ctggatctga gtatatgatt gaatgtccaa atattatttt tgtcaaagga    170220
     aaacctgtat tactttatag tcctcaagga ctagataaaa acgaattgga ctaccaaaac    170280
     atttatccaa atacctacaa aatcggacaa tatttcgatg ctaactcatc taagatagtt    170340
     gaaccatccc ctatctataa tttagattat ggttttgaag cctatgctac tcaaggattt    170400
     aacacttctg atggtcgtgc ctttatcgtg agttggatag gcttgccaga tattgattat    170460
     cctagcgatc aatttgatta tcaaggagct atgagtttag ttaaagagtt aagtataaaa    170520
     aatgggaacc tttatcaata tcccgttcct gctatgaaaa atcttcgtca acatcaagca    170580
     gaatttaaaa cacaacttca aactaacaac acctatgaat tagaattact ggttcctaga    170640
     aatgatcttt cttcatttgt tctctttgct aatccgaaag gacaaggact atccattact    170700
     attgatactg caaaggggaa agttatcgtt gaccgctcac aagccggaca gcagtacgcc    170760
     acagaatttg gtactagtcg ccagtgtaac attccaaaag atgctactag tgtcaatgtt    170820
     tttatcgata agtccatctt tgaaatcttt ataaataaag gagaaaaagt atttacggga    170880
     cgagtctttc cagatgcaga acaatcaggg attcaactaa aagaaggaca cgttcatggt    170940
     aaatattttg aattaaaata ttaatatggt tgcaaaatta acagatgttg ctgcacttgc    171000
     cggtgttagc ccaacgactg tatcacgcgt tattaacaaa aaaggctatt tatctcaaaa    171060
     aacagtcacc aaagtcaatg aagccatgag aacccttggt tataaaccta ataatttagc    171120
     acgtagctta cagggaaagt ccgctaaatt aattggactc attttcccca acatccgtaa    171180
     cattttttac gctgaattaa ttgaacacct tgaaattgag ttgtttaagc atggttataa    171240
     aactatctta tgtaatagtg aaaaggatcc tatcaaagaa aaagaatacc tcgaaatgct    171300
     aggagcaaat caagtagacg gtatcatttc aagtagtcac aacctaggaa ttgatgatta    171360
     cgagaaagtt gaggctccca tagtagcatt cgatagaaat ttagctccac acatccctat    171420
     cgtctcatct gataatttct ttggaggaaa aatggctgct caaaccctta aaaaacatgg    171480
     ctgtcaaaag atgattatga ttacagggaa tgataattca gattctccta ctggacttag    171540
     gcggctaggt ttttcctatg aatcaaagga atccaaagtt atcacagtca caaatgggct    171600
     atctaatatg agacgtgaga tggaattaaa atcaattatc tcgactcaca aaccagatgg    171660
     tatttttaca tcagacgact taactgcttt attagtaatc aaacttatca gccaactagg    171720
     gttgtccatt ccagaagata tcaaagtgat tggatatgat ggtacaagtt tcattcaaga    171780
     ttacgtccca catctaacca ctattaaaca gcctattcga gaaattgcgc aattgatggt    171840
     tgaaatactc ctagctaaga ttgaggggca aaagacaaat aaggattata ttttaccagt    171900
     cagtctcatc cctggtagta gcgtttagga aatcatattt atgaaataat ttttagtacc    171960
     gatagttatt tttcaaagca aattaaaaat gtggaagaag attcttccac atttttaatt    172020
     ttcatttgtt ataaattgac ttaataaacc attgacaaat tttgctgacg tctcatctga    172080
     atatttttta gcaatctcga taatctcatt tagagctaca cgatcaggcg tttcatcaaa    172140
     atatttaatt tcatagaggc ctaagcgtaa gagagattta tcaaccaatg ttagacgttc    172200
     taagctccat cctgatttta agtgactaga aatcaaagta tctaattcat ctttgtgatc    172260
     tacaacacca ttaacaagat taagtaaaaa gattggaacc tctaaaactt tgtcttcaga    172320
     tactgtttta tcataaccat aagcaaagtg agccgcatca ataaactctc caccagtttc    172380
     taagctaaat agtgtttgaa aagcacgttc acgtaaatca cgtcttgaat ctttaaatac    172440
     actagtcatc taagaaatcc tcatcaaaca atgacttcaa gtctggtttt ggtgttttct    172500
     ctggaacaat accttcaaca tggatattga ccgaagaaat ttttacttct gccatgtcat    172560
     atacagctgt tttgacagct tgttgaatag caattgaaac tgctggtaca tttacaccat    172620
     actgcaagta aacataaata tctgcagcta ctgtatcatc ttcttcattt ttaaggtaga    172680
     cacctctacc tagagatttc ttactaaggc tatccgttac cgctttgtta cgtaacgaat    172740
     gaacaccatc aactttagtt gcagcaatac ctgtaattac ctcaagtaca cgtggtgaaa    172800
     tgacaatttc tccaagattt tcagttgtca tagcttatcc tttcttttag tgtttactaa    172860
     ggtttttcct taatagagta aattcatcat gaatctactt aacacttttt tgagagtcat    172920
     taggcgcgtg aaacgtaagt tccttctgct gtattgatta ctaacttttg tccagcttca    172980
     ataaagtctg gaacgttaac aacaagtcct gtttccatag ttgcaggttt tcctgaacca    173040
     gttacagtag cacctttgat tgatggttga gtttcagcaa ctgtcaattc aacagttgtt    173100
     ggaatttgaa caccaataac ttctgttcca tagaattgaa tttttacttc tgagttttca    173160
     agaatgtaga gtaattcatt ttcaatgtta acagttggaa tttcatattg atcgtaagtt    173220
     tcattattca tgaagtaagc tgtatcatcc attttataaa ggtattgagc aggtacagtt    173280
     tcaataatag cttgctcaaa tttttcttca ggacggtaac ttgtatcaaa agttgaacca    173340
     gtacgaacat cacgcaattt catacgcatg attgtgttac ctttacctgg tttgtggtgg    173400
     ctagcttcaa gaacacggat taatttccca tcagccgttt caaaagtcat gcctgcttta    173460
     agcttacttg cttcaatcat ttattaatac ctctttgtaa aaattattta tcaactcatt    173520
     ttatcacaaa taacctgctt tctcaaatag tttattgatt tggtatgtgt ctaatttctt    173580
     gataaataaa taaaatcacc aagagggcgt aaataagact gaagcacttg acactttcct    173640
     cttacttcag ttttgataat attgcctttt gacgatacaa tatttttaaa ctgattaagc    173700
     aagtagcatt tgcttcaatc ggttggcgag aggtgtttgc acacctttcg ccttttcttc    173760
     gtgtttcttt aataagatta tgtcacaata gaatattatt aaagaaaaaa tcgtaaattt    173820
     attgcctgac atcacttatt tttcaaggtt tcagcaagtt ttataataat tagtcataaa    173880
     atgatcttct agatttggga gatttttcat ttctccgtag tgaaggtaaa ttatattctt    173940
     ttaatgtata tttaaaatga tttcctaggt ttcttaatcc ttcatttttg attgcttcat    174000
     attgtgctct ccattttccg aaaaataaat ctcttaaatt gccttcatga               174050
//


spacer
spacer