Dbfetch

ID   AL713849; SV 8; linear; genomic DNA; STD; VRT; 19265 BP.
XX
AC   AL713849;
XX
DT   22-MAR-2002 (Rel. 71, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 17)
XX
DE   Zebrafish DNA sequence from clone BUSM1-172E19 in linkage group 18 Contains
DE   the gene for a novel protein containing leucine-rich repeat domain, the
DE   gene for a novel protein similar to vertebrate squamous cell carcinoma
DE   antigen recognised by T cells 3 (SART3), the 3' end of the coro1c gene for
DE   coronin, actin binding protein, 1C, the gene for a novel protein similar to
DE   vertebrate NifU-like N-terminal domain containing (NIFUN), a novel gene and
DE   a CpG island.
XX
KW   CORO1C; CpG island; HTG.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-19265
RA   Pandian R.;
RT   ;
RL   Submitted (12-JAN-2009) to the INSDC.
RL   Wellcome Trust Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK.
RL   E-mail enquiries: zfish-help@sanger.ac.uk Clone requests:
RL   http://www.sanger.ac.uk/Projects/D_rerio/faqs.shtml#dataeight
XX
DR   MD5; 5b3f48fe6e2124b182c6e2dc12093d10.
XX
CC   -------------- Genome Center
CC   Center: Wellcome Trust Sanger Institute
CC   Center code: SC
CC   Web site: http://www.sanger.ac.uk
CC   Contact: zfish-help@sanger.ac.uk
CC   --------------
CC   
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats;
CC   all regions were covered by at least one subclone; and the assembly was
CC   confirmed by restriction digest, except on the rare occasion of the clone
CC   being a YAC.
CC   
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases:
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP;
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
CC   
CC   Clone-derived Zebrafish pUC subclones occasionally display inconsistency
CC   over the length of mononucleotide A/T runs and conserved TA repeats.
CC   Where this is found the longest good quality representation will be
CC   submitted.
CC   
CC   Any regions longer than 1kb tagged as misc-feature "unsure" are part of
CC   a tandem repeat of more than 10kb in length where it has not been possible
CC   to anchor the base differences between repeat copies.  The region has been
CC   built up based on the repeat element to match the total size of repeat
CC   indicated by restriction digest, but repeat copies may not be in the
CC   correct order and the usual finishing criteria may not apply.
CC   
CC   IMPORTANT: This sequence is not the entire insert of clone BUSM1-172E19. It
CC   may be shorter because we sequence overlapping sections only once, except
CC   for a short overlap.
CC   
CC   During sequence assembly data is compared from overlapping clones. Where
CC   differences are found these are annotated as variations together with a
CC   note of the overlapping clone name. Note that the variation annotation may
CC   not be found in the sequence submission corresponding to the overlapping
CC   clone, as we submit sequences with only a small overlap.
CC   
CC   The true left end of clone BUSM1-172E19 is at 1 in this sequence.
CC   The true left end of clone BUSM1-241H12 is at 17266 in this sequence.
CC   
CC   BUSM1-172E19 is from a Zebrafish PAC library
CC   VECTOR: pCYPAC-6
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..19265
FT                   /organism="Danio rerio"
FT                   /chromosome="18"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="BUSM1"
FT                   /clone="BUSM1-172E19"
FT                   /db_xref="taxon:7955"
FT   misc_feature    1..19265
FT                   /note="annotated region of clone"
FT   misc_feature    1
FT                   /note="Clone_left_end: BUSM1-172E19"
FT   mRNA            complement(join(<1..1364,1578..>1765))
FT                   /locus_tag="dZ172E19.1-001"
FT                   /product="novel protein"
FT                   /note="match: ESTs: Em:BI661119 Em:BM494775"
FT   CDS             complement(join(<1..1364,1578..1765))
FT                   /locus_tag="dZ172E19.1-001"
FT                   /standard_name="OTTDARP00000001714"
FT                   /product="novel protein"
FT                   /note="match: proteins: Sw:O43313 Sw:O43313"
FT                   /db_xref="UniProtKB/TrEMBL:Q8AW13"
FT                   /protein_id="CAD58751.1"
FT                   /translation="MHAEKKHKCLKCSNGYSTEWDLRRHVEDCGRTYSCTCGCPYASRA
FT                   ALLSHIYRTGHEVPKEHRYPPVKKRKMERLSSGATSFLLDEQIDDMPDSKKKLTEGTAT
FT                   TILVSEAPDAAQYNTNQPRHIQKLLLPKPKVALVNVPVMQFAHLPVLLPSTESSALRSL
FT                   VLSLDAQGSVSTVHILSPSIGTMVPDLNNKTFKETFPVSTLGPETISTGVQVNLESQAS
FT                   VEDPLIDHGIKSKSTSTNIQTDLTYLNKEMGTGPETVSLNEASVSSCSQTDISVSAQIQ
FT                   LPISVQTQTLPSRIKATFSIGAQTDFFSFSSFNVTRETQTSCSEAPLNESQMDQAMCTN
FT                   LFDPDTLSVSTQTATVVAPFRTSGLEGPLTCTGAELFEDKSSASMCFGAQTDQNTVADN
FT                   QTQTMILFRDLENILSDSMSGATSSCASGLVAGHESQNTGIDFDFEEFLNATHIQTQTE
FT                   ESGLNTLNTETTLELLDIETQTDFLLFDNLGNGHNSDVGTRVQPNDLELEMFDTQTQTD
FT                   "
FT   misc_feature    7897..7914
FT                   /note="Inconsistency in the number of bases in
FT                   mononucleotide run between subclones"
FT   mobile_element  complement(<10920..>12878)
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="dZ172E19.2-001"
FT   misc_feature    17266
FT                   /note="Clone_left_end: BUSM1-241H12"
XX
SQ   Sequence 19265 BP; 5890 A; 3704 C; 3560 G; 6111 T; 0 other;
     gatctgtctg ggtctgcgtg tcaaacatct caagctctag atcatttggt tgcacccttg        60
     ttccaacatc actgttgtgc ccattaccaa ggttgtcaaa gagcaagaag tcagtctgtg       120
     tctcgatgtc caggagctcc aaagtcgtct ctgtgttcag agtattcagg ccactttctt       180
     ctgtctgagt ttgaatgtgt gttgcattaa ggaactcctc gaagtcaaag tctatacctg       240
     tgttttgtga ttcatgccca gcaactaaac ctgaagcaca gctcgaagtt gccccagaca       300
     tgctgtcaga gagtatattc tcaaggtcac ggaagagtat catggtctga gtctggttgt       360
     ctgcaactgt gttttggtca gtctgtgccc caaaacacat agatgcagaa gatttgtcct       420
     caaaaagctc agctccagtg caggtgagag gaccttctaa accactggtt ctgaaaggag       480
     caacaacagt tgcagtctga gtggagacac tgagtgtatc agggtcaaaa agatttgtgc       540
     acattgcttg gtccatctgg ctttcattca atggggcttc agagcagctt gtttgtgttt       600
     ctcgggtcac attaaaggaa gagaaactga aaaaatctgt ttgtgcccca attgaaaacg       660
     tggctttgat tcgtgagggt agcgtttggg tttgtacact aataggcagc tgaatttgag       720
     cacttacact tatgtctgtc tgtgagcaag aggacactga ggcctcattg agggaaacag       780
     tctctggtcc agtacccatc tctttgttga ggtatgttaa atcagtctga atgtttgttg       840
     aagtgctttt gcttttgatt ccatgatcaa tcagcggatc ttccacagag gcttgactct       900
     caagattgac ctgtactcct gtgctgatag tttctgggcc caatgtagaa acaggaaagg       960
     tctctttgaa agttttattg ttcagatcag gcaccattgt gccgattgat ggtgacaaaa      1020
     tatgcacagt gcttacggac ccttgtgcat ccaaagacaa gaccaatgac ctcaaggcac      1080
     tactttctgt ggaggggagg agaacaggca ggtgggcaaa ctgcataaca ggaacattca      1140
     ctagggccac tttgggcttt gggagaagaa gcttctggat gtgtctaggt tggttagtgt      1200
     tgtattgtgc tgcgtctggg gcttcagaga ctagtatggt agtagctgtt ccttcagtaa      1260
     gctttttctt agagtcaggc atgtcatcaa tttgttcatc gagcaaaaaa cttgttgccc      1320
     cacttgacaa cctttccatt ttcctctttt ttactggtgg atacctaaaa aataaatagt      1380
     gactttgagc tttttattaa aaaaatgaac aagattaaca accataaact aggatatgtg      1440
     ataaaaggtt gccaaacaca atgtcctatc tgaggccaca tatgatatcc agtcataatc      1500
     aaagtttaaa atcataccat cctctttttt catattttcc cattgaacca ccaccaaaca      1560
     caattttaac agattacctg tgctccttgg gaacctcatg accagttctg tagatatgag      1620
     acagcagtgc tgctctactg gcataaggac aaccacatgt gcagctgtat gtcctcccac      1680
     aatcctccac atgtctccgc aggtcccact cggtgctgta gccattactg cactttaaac      1740
     acttgtgctt cttttccgca tgcatcttca taaaatgcta tacagttagt aagattggga      1800
     aacatgttag ttagcagttg ttttcctagt aagactttac tgatggtaaa ttgaagaaac      1860
     atcacagaca gacacatgct ccagacaaat aacaatggca agtacctgct taacaagcga      1920
     aaactgagaa aagggtctgt ttggtcctct tgggcatcct tcaattgggc aacagtacag      1980
     cttttgcgaa ttcttatcgc cctttctaat cgtagggtta accagaccct cctaaaatta      2040
     aacaaagcat attaataaat acatgtaaaa gatgacaata atatctctgt tatacctggc      2100
     tcaaagatgt taaattaaac ttcagatttt ttttctatcg ttctatattt tgtatgcatg      2160
     caagcttgat tttcgagtag acaatgaaaa ggtgacatta tgcaaacatt cttcagctgt      2220
     gatgactgat gatctgaggt ctgcatagaa tcacaaattt tgtaactgat gaccgcctac      2280
     atagacattg catccctgat acatcaaaag tatgtgtttg caccaacaca gctgatcatt      2340
     ctgagccatc tgtcatgtca tacttgggtg ggttagcatc atccttgttc tgtacaggcc      2400
     tctggaaaac tccaagcttg taaggatact aaccttttta aaataatcaa gtaacagtat      2460
     tatgccctgg ctaaatttcc tccctcagcc cttaccatca tggcctccca atcaccccaa      2520
     tccactgcat tggctctatc actgtctgtc ctttacacca atcacggtcc gagatggcca      2580
     atgtccctgc agagtttagc tccaacattc atcaacacac ctgcctggaa gttttaaata      2640
     aaccttgtaa gacctttatt agcttgttca ggtgtgtgtg acttgggttg gagctaaact      2700
     ctgcaggaca ccgaccctcc aagaccaagt ctggtgacct ctaccaaaca ctattgtaaa      2760
     gcgctttagg tgcatggtca tacacaataa atgtgctata taaatccaca ttatattaca      2820
     tcagagtttg tgtttgttaa tattataatt cataactaat ccatataaag acacatgggg      2880
     cttacggtgt atctacagag tgccatacta aaacaggcag tcatcatttt ggtaactgtg      2940
     taggggtacc tagctgtaca tgagcatatc atataaaatt tatcctatca gatgtgaaat      3000
     caaccataac acggtatatc agaaaccaac aaatgtattt gtacttgcac gtcacgtgaa      3060
     ttatcatcat gacacatgta aaaataaagc atgaggttac agacatgtaa tcatatggaa      3120
     tttggaagct atatgctttg atttgattga atttgactgt gaataactta tagtctgtta      3180
     atcaaaaaaa ctcttttata aggatagttc atccaaaaat aaaggtttta tgaccattta      3240
     ctcatactta cgtggttcta aacctttatg aatagataca agatgttcta aagaatgttg      3300
     ggaaccagga gttatggata tatagtaatg tatgaagctg ggaataaaat atactaagga      3360
     agtcaatgcc tgctgctttt cttgcatttt tcttaatttt ttattttgta tttagcagaa      3420
     aaataggaac ttaaacatgt ctagaacaag tgacaaattt tcattttggg gtgaactatc      3480
     tatttaagag gacaaaacac tggagatgta caaattagtc aatggaacat ttatgaccag      3540
     cttgaaacat ttcgactcca agaactgaaa aaaaaaacac agctaaaacc tttgtattat      3600
     tatttttttg ctacagaaaa caaataacag caagaaaaag aatagtggac tgcatgcttt      3660
     cttattctgc actgcagagg cactacagga ttttctgaag aaatcatata tgcataataa      3720
     taaataatta atgccaaaaa gaacataaaa actcctaaca gactgttcac acagatcaac      3780
     ttgaggatcg tggacctttc ttttttgagt catgaagtct ccgctagctt tctcgaaaat      3840
     aagaagccca tacttgacaa acaagcctgg ctcactctgg tgcaaactgt ggttacgtca      3900
     tttaggcttt cagcctgtcg agcagctctc attcaatgca ctgttcactc tgcagaaagc      3960
     tgccagaaag gctgagagga aatccttaac atcccctgaa tagatagtgt aattttttat      4020
     aatttgcata gaatacataa cttttttttg tttttcaggg gtttatatat aattgtaaat      4080
     aagtaaaagt tcaaagtcag tagtcaatga tggtgatgca caaaactaga gcatgtcgta      4140
     tagttgtgtg tttgcagaaa atactatata attagttaaa ttttgtccat tgattttaag      4200
     aatattcaga atcagacaaa agatgcaatc aatacatact gtatatccta gagtacactt      4260
     ttgtaaactg cctattttcg tttcttattc taaataatta cagacaacgt ttcttattgt      4320
     agaaaattag atcaagcatc tataccatca ctcttacaga aatcaacatt tcaattcatg      4380
     tagcagctaa gatgttacca cataattcat taatgcaaat attgctgagt ttatttcaca      4440
     taacaaaaaa tgcagaaggg tccaacaaca gataacgtta aatcctacat aagttagata      4500
     aataccgaaa aatcagacct gaaacgagaa cagtcagcag cagatgtgtc ctggtgttgg      4560
     tgcagtgttt tacctggacc ctgtgagact tgaccagatg catgttgagt gctggagtgt      4620
     tgggcagaat cttcccacat ccttccaccg tgcagaggat gttggtccgc acttctttgg      4680
     tgagctctgt tatggagggt ttaataatct ctctgtcttg taaaggtagc ttctcgctgc      4740
     atttttgtct tttgtgacgg ctattattat tgactgtcgc agcagccatg attcaacata      4800
     ctacaacacg cattcacttc cgggacacgt tacatagcaa ccaactcacc tcagacagtc      4860
     tcacatttac ttccggacga cgtacaaata ccaagtaagt tacgcaaagt tcggacttgc      4920
     gtccttggaa gttcagactt gccaagttca gacttggaag aacgaactcc cgaggacgcg      4980
     aggacacaag tcgggtaacg ttacttcttc aaatgaaaca gcagtatact ttataacgtc      5040
     actaacctca ccatagattc atcagtttca ctgtacatta acaataaatt gatttaatta      5100
     ttattaatta ttaatattat attcatatta taaatctaca tttttgattt aggaaaatgt      5160
     acacatatat tcgtataaat gtgaattaaa atgtgttatt atacacagac acgtgtcttt      5220
     gattatcaga tttattaaac tacaatggta attatacaca caataagaaa taaaagacat      5280
     acacgataag aaataaagat tacgtcaaac aatttggtaa acaaagacaa acagcgtaca      5340
     acacggtaac ataattaaag acaattataa aaggtgacaa aataacactg ccaaaataat      5400
     acacctgaga acaaataata gatttataag actgtccgtt agatattcac aagatgtatt      5460
     aaacatcatg ttttaactac aatggagtga tgaggtccag cggtacgtcc gagatggcct      5520
     ggtcaaagta aagctgctct ggcgggcgag ctgatgacgg agctcccgct ggcaggctgg      5580
     gagtcagagt ccgcataagc cgaggcacat cgtcaaaaaa gtatcttttg agatctgcac      5640
     gcacagacct gcacttccag acctatcgtt ttctcagaca gtgccacctg ctgttgggtt      5700
     gggtgaagct gcaggtacgg agaccccata gatatacatt agatgtcccc taccctgttg      5760
     ttgtctattg gaagtaatgc gtcaatagaa ccgtcatttt ggaacaggga atcgctccat      5820
     tgaaatgaat gaggaccaag gtacagtgga ggactgtggc catccaaagc cagagatata      5880
     cacatatatc tatgatcggg agttttcctg gatgttagta ttaaatgttt ttattaatta      5940
     cgaaaattat aattttacaa cttttctaca ttgatggatc agtgattgca caggcattcc      6000
     tgacaaaaag cttgtgtttg tgtgtacaga aatgtactat cctctctgtt aaatttgatc      6060
     taatcagtgg cgcccccaga aaattttctt aggggtggcc aagtaaggcc acaacaaatc      6120
     ttgtggtggc acacaaaaaa attatgaatt gtgtatatat tgtgaataag gagtaatgtt      6180
     atatttttgt ttttggtaaa ataaataatg aagttttaat gaattccaat aattactctt      6240
     gaaatattgt aatttattcc gcaagtacaa gtgcaaacca aataaaaatc aatatttagt      6300
     ctaaaacctc tttccggtaa gttatttctt gtacaacata caatatatgc catgtctaac      6360
     attaatgaat tatgaataag attaattaat gaattaataa accaaacaaa acccaacaaa      6420
     attttgaaaa gcagatttca aaatgtatct agttatttat tttggatttg tggttttcaa      6480
     tcagatgaaa cacaactttc tcatttcaaa aataataatt tctttataaa aagtgtgcaa      6540
     tctcagtgaa tcagcttcgt cagtggcgct gatcaatcca caataattta gtggctgcat      6600
     tttatttatt catttattta ttgaagtatt gtgaatttaa gtaaatacat ttaaattaat      6660
     aatatcagca actatcatat tggggtggcc acagaggtgg ccagagttta cacaagggtg      6720
     gccgtggcca ccccttgggg gcgcccctgg atctaattcg tgtcctgaaa cacacctctt      6780
     ttttttcaaa caaactttta tttagaaaag aagaaattta caatataaat caggaagtaa      6840
     tctgtagaag actggaatac aagaatatac aattaaagtg ataagaacaa taagtaaaaa      6900
     agaaaggagt aatagaaaga aaataaaaaa gagaacaaaa tgaggaaagg ggaagtacaa      6960
     aattaaatta aataaaaaat acagaaagca ttaattacta acatactgga agcatgattt      7020
     ttcataagtt tctattaact tgcagaattt cttgttgtta gatagacgta tctttaagca      7080
     tggaatcaat ttcaattaaa ctgaaacaca ccgcctgctt tcacttctca tactgacgga      7140
     gggagcggtt cggttgtgaa tgaatctccg ttatgaacga ttcgttcact agccaacaat      7200
     aataccagtt tctggcagtg cagcatctcg ttatcatatt tcttggcatt gtttgctgat      7260
     tttattcatc aaaactagca taagctgagt atttagtgcg agttggagct actttgcctc      7320
     atggtgaatg cagaaagtga ctgtattatc atcagtaacg tgacctgttg agcacaaaag      7380
     ttcagaacat acaaaaacgt aaaaaactta atcttaccaa tgaagtgttc tgcctttggg      7440
     ctttgttttc tttgtatgct cgttactaca tccgtacaca gcgctaaagt ctagcatctt      7500
     cacgtaatta cactgtgttg actagtgcgg ttgaatgaca tttgtcctgg gagcaatgta      7560
     ccagtttggc ggcgctattg acgcatgctc agggtcccta tgtgatatct agtgtatgcg      7620
     gagacccaac tgcatgctca gacaagcatt ttctagcaag tagaaacatc agagacgcca      7680
     gtgaggttat tgattattaa agcgattgct gaaaattacc aggttttgcc ataaatcaat      7740
     gtggtgtaaa atattatact aacaaacaat catttcagtg tttgatttga tcaaaattag      7800
     tgccaaaaga atattatttt atgatatcta caccatgctc ttattttata tattattgta      7860
     ccattctggg acacttttct atcaatgttt tctggcaaaa aaaaaaaaaa aaaactttta      7920
     aaatattaaa ataaaatgtt taatagcgca attattattt ctaacatatg ttagtgctat      7980
     gtgtattgta catattactg tatttttgta tctgaaagtg ctaccaaaga ctaccagtaa      8040
     cacaataaca gtttatcaat tattaataag ttctgtaatg tttacaaata cgtttttttg      8100
     gaaatccaaa tattagtaac cctgcataga atttacaata tgagttctcg taggtaaaat      8160
     aaaaaaaaat aatttgcttt ggtgtgtatt tttcccagat tgatattaca atttaagggg      8220
     ggggggggtt tgggtctctg ccaacactaa tacagtgcac caaatgttgc agatatttcc      8280
     attttttttt tttttgcttg agaaatgaaa aatctcccca acaagattgt aaagcattta      8340
     ttttgtttga taatattttc tacatgaaaa aatagcactg gagcactgtc tccaattatt      8400
     atttttcacc atttttctat gcattgttta ctacttggct tgtaggacct catgaaaacg      8460
     tacataaaaa taaagtttgt tgtgagaaaa ttacgcatag tactataatt tattgtatgt      8520
     gtgtgaagaa atttattgta tatgaagata atattcaatc cctttactca atacgaaacc      8580
     gtgataaatc cttaatgatt aaaagaaaac aacaacaaca aatgtctgaa aatattgaag      8640
     taacaataaa aggaacaata tctatttaaa aatgcaatta ataacagaat tattgcatta      8700
     aatcaaaatc tagtatgttt aatattttat atattaatgt attcaatcat agcgtaatat      8760
     tttatagtag aaaaatagtt taaagagccc atattatggg tttttgaaaa tgcccttcca      8820
     tgtagtgtgt aacacagctc taagtgaagt gaaatatcca gctaaggctt aaatctgtaa      8880
     gtgtacagtg tttaaaactg ttgattcatc aataaaagag tcgactcagt gcttcaaatg      8940
     agtcgtcttg ataacgagtc attaggtgtt tcccatgacc taataacgaa acacagttat      9000
     tcacactcat gcgcaaatct gggagatttg aaacctgcgg cccgccctct aacacagaaa      9060
     cccacacaca aacacacaca cacacaaaca tgccggtcga ttgatgtccc actgcagagg      9120
     gatattattg agtctctacc atagatgaaa tctcagcatt ataacccagc cttgagcagt      9180
     tggaaactac tggaaacttc tggaaactac atgctacaaa gaatacttca tcgggcgttt      9240
     attaaaggaa gaatcagtaa agtgtactga ttgacatctc aggacatgaa tcgatttctt      9300
     cctccatttc ttaagtgtaa gtacgtgcga ttaaagttgt tgcctcgttt actctagctt      9360
     gcaaatgtat ttagttgtga tttgttactt aaaactgcgt gtactgtatc aggttaactc      9420
     gctatattct catatcgcgt gcaaagccac gttaaaaacg cgatatgtgt gggttatgtg      9480
     tgtgcgtgtg tgcacgttgt cgtgcggagg agggctatgt gtgtgtgtgt gtgtctgtga      9540
     aaagagcaga gtgtgacaag ctaggagatc tcctcgcaag ttcttagagt ttttgttcaa      9600
     aaaaatagtt aatcgtcggt attttcaagt ccatcgtctg tatttacatt cacccactgg      9660
     cagctaaaat ccacgcctta aactttcgag catgtataca ctgtgacaac ttttatgatg      9720
     ttaattagct gctgggcatt tgactctgtc tctcgctaaa ggcaatcagt gtcgaccaat      9780
     cgcaacaggc tgtcatcggt ccaatcagcg cacattagct tcactgggaa caaatgaatc      9840
     actggacgat tcatatggca gtcgctggga taattaggta aaaatatatg cagattataa      9900
     ggccataaaa aatgtttttt gaccttgcat gcatattaga ctgttattgg agacccttac      9960
     aaccaaaata tgaccctatt tcatgtataa taagggctct ttaagtcaca atttataagc     10020
     agctgaattc aggttagtcg atcttttaaa cagcaggtgg cactgtgaag gtctggaagt     10080
     gcagatctag ctgtctgagc gagcaggtct gagcatgcgg ttgggtctcc ggtcctggag     10140
     cttcataatg ttgcacaagt cacctctcga tgcatccttg gccaaagggg cagagcaagt     10200
     acacatccgg gaatttcatc tgtacttgga aagatgtgaa ctttagaatt ggaacagtaa     10260
     tttggcgacg gttgatgacg gttgtttcac gaggacaagc acactccaaa cgtctctgac     10320
     gtctatccgc gatcacgaaa ttgaattgca tcaccgcagt tgcaaatcct tcgatcacga     10380
     tgcaaacagg tccgattagc aaagcctcag gctgcatact tccatactat atagtacgct     10440
     aaaatcagta tgcgagcagt agtatgtccg aatttataga attcgaaaat cagtaggcaa     10500
     gaagcacccg gatgacttac tacttccggc gagattctga aatgcgcatc ccatgcacgc     10560
     tgcgctatcc cataatgccc cgtgagagaa ttcatgaatg gaagtgaggc gacgcaactg     10620
     acgcaggtag gtcacgtgac catgacaaaa tggcggatgt agtacgtccg aattccattc     10680
     atacttttca cattcatact gtatagaacg tagttttcta acggccgagt agtacgttta     10740
     aattcaaatg cagtacctac tgagtagtag gcggtttcgg acgcagcttc agtctctctc     10800
     cagtcaatct ttcagtgcgc aggtcttctt attcttcttg gttttatggc gagttgcgaa     10860
     tcaacttcaa aggcgccacc tactgtgatg gagtgtgaag agattgaact ggtttcctat     10920
     attcttttgt ataatccact atttttaatc aatcttatta ctgcctttat ttgtctccct     10980
     gaatctacac catcttttaa taaacctttt attgtgaaat cctggtatcc taaactatgc     11040
     aattactctt taggatttct tctttcattt ttatgtgctt tgcacctatt taaaacatgt     11100
     tccactgtct cctctgttag acatgtgtta cataaacctg ttacatgttt ccccattatg     11160
     tattatgttt gattcaaatg tgtatgtcct gttcttaaac gtgttaaaat aacttattct     11220
     cttcgactaa gattatgcga tgttttgctt ttctttattt atttattttt ttaatcttat     11280
     gataatgtat acctgtgtta ttggactccc aaactttctg ccatttccta ttgcatgcct     11340
     ctaagattaa gcttttctct tcggctctgc ttagtgaaat gcgtctaatt ggttcatttt     11400
     gttgtagaga ttctttagct attttatctg cctcattgcc ctgaattcca acatgcgctg     11460
     gtacccacat tagatgaatt attactccca tctgtgttag actattaaac ttgatcatga     11520
     tttctgttag gatgtcattt ctttttgatt ccattgattt taaactcatc aagacagcca     11580
     ttgaatcaga acatattaga gctttatcag gtctggtttc atatgtccac tctcatgcca     11640
     tcaaaattgc aaccatctca gctgtgtata ctgaagttcc atctgatatc cttccagcct     11700
     tcctcacttc aagctctggg acatagaaag ccactcctgt ccttcctgat tctatactct     11760
     tgaaccatct gtatatattt gtagatatga gtaatatgca ttattaatgt agttcttgac     11820
     atatgtgatt atgttaacag cttctttcat ctctcttttg ttttcatgta attttaaatg     11880
     tacttttggt ttatcaatta accatggtgg aattggtgaa attatattta aagatgcaaa     11940
     tgataattta tcaagaccat tctcatttac ccattctttt attttccagg catagccctt     12000
     cccttgtgta ctcataaata cccagcaatc actcaaaacc tttcttacag gatgattctc     12060
     actttgtccc tgtagactta tccaataagc catagcctat ttttgtcttc taatatagag     12120
     tggtgtttct gatgtctcta tttgaagagc agctataggt gttgttttca ctgcccctaa     12180
     aataattctt aacgccttag tttgcataat gtctagtttc tttaataatg ttaacaatgc     12240
     tgattcatat actgtactat gcatccatag ttaaaactag atcgcataag tccatcataa     12300
     attcctttta acgactgttt gtcagcaccc cagttttgtc ctgaaactgc tctcattaaa     12360
     tttactatct ttccacattt cttaatatat aatttatatg attcttccat gttaactttt     12420
     gattaaacca taatcctaga tacttaaaat tttctacttt ctctaaacat gatccatata     12480
     atgtaagctg cttattccct gttattttct tctttgtaaa aaatttgata acatgttcta     12540
     gatgttgaaa attttaaacc ccaatgtaat gaccatttct ctactatatt tatagcttct     12600
     tgaagtttat ccatattaaa tgcaatattc cttcctcttt tccacattat tccatcttct     12660
     gcgtacaatg ctgtactaat tcctggagca acatttttaa aaatataatt aatcatgatg     12720
     ttaaaaagta tgggactgat tacacttccc tgtggtgttc cgttttctat attcacaatt     12780
     tgtgaaactt aactacctac ttggacttga attgttctat caaataaaaa actcaatacc     12840
     caattaaaca ttactccttc aataccaatc gtcttcattc atccacagga ggtctgacgt     12900
     tcactctaac tctcactctc actctctctc tctctctctg aacgtctaac cacacagatt     12960
     gtccagcgat cctcaaatgc aataaagatg tgggttaaca gtctttgtaa ctcaaaactg     13020
     caacacgaat ttgcttttgt gtaactattt ggaggtaaac tattaaaaca aaaactctaa     13080
     atcaatcgca tctcaacctc tgctctcagt ttcacttttc tttcgtcttc caagccccgc     13140
     cccttaacct ctagaggtca tcaaattgaa cacataaaac gtttttattt attagataac     13200
     ttttttcata aagaactatg atttcagaat tgaaacacct ttgtaattta gcagaacgtt     13260
     ctgaaaataa tttgttgaaa aataaaagaa aaaaaaaaca aaaatgctta aggctgattt     13320
     atacttctgc gtcaaacgcc ggcgtatgct acgtcgctga cgcatagccc ttcgtcgtgg     13380
     ccgtcggcgt cgctgacgtg cacctctcaa aaaatgtaac tacacgttgc aacaacgcgt     13440
     agcgcaagct ctgtgattgg tcggcttggt agcgctgacg aatctgggcg ggaccgagag     13500
     ctgcgtgaat ggtgcgagcc tgatggggcg attgtttaca agtgtggagt ctggaagtgt     13560
     ggaaagtttt gttttgtgtt tatctcatag ttaaagttta atagtataaa ccaggcttta     13620
     atatcaacag atcatatatt agtagggctc tctctctctc tctctctcta taactcaaaa     13680
     tgatatattt ttgtggtaat gaaatatacc atacagtaat tgtacaagca acattgcact     13740
     ttatatgtaa tacgttcaaa caaaaataaa tgtactgcat aaatacaatt gttaattatt     13800
     ttgtccttgt actattgact tgtctcaaca aatatcagat ttttaaaaac cttaattttc     13860
     atggttgact gccattgtaa ataaacaact aataattttg agcagtgtag ctcacgcgat     13920
     gacaaacaca ctttatgttt tggtggtctt gaccaaatta ctgacataat aactaggttt     13980
     tgaagtgtaa ggtccaccca gttggttcaa tggaggtgtc cactggtgga tgaaggttca     14040
     atgcctgatc ggtctttcca gtgcacaatg ttgatttact ttaagtttaa ctcaaatctg     14100
     actccaattt gaatatgagg tggtttagaa tattaatata tttatctttc gttttatctg     14160
     actccaatca taaaacattt agaagattat atcgatttat aatttagatc aatgtttgaa     14220
     ccttttatct tcactagtaa ttattcgatt tgttaatttg ggtgctcatg tcgctcagat     14280
     aaattgcccc ggccgacggc gtatctcatg gtcacactct tgtcagtctt gattattaaa     14340
     cagaggtaga tgtctactac ttttaaatgg ccgctccctc attcagatga ccgcttgctc     14400
     attctaaagt atttttgatt agacctcctt agatgtacac ccttgagtaa agacaatatc     14460
     atttccagtc agaggttagg gcctgtagga gcctatatgt tgacttgaat gtaatttggg     14520
     ctgtcaccac ttgggggcaa tatgtgcaca tagggtttta aagttggtgt ttcttgcatg     14580
     agagaagaag acttgaggaa gggaacgcat gcagttttta ccacaccatt acaacattat     14640
     taattgcaag tatgtattta tatcaagcta aataaagtga atttaaattt gaagaggaag     14700
     caaaactgga cattggttgt gtgcgtaaaa acgtgcgttg agatgccaag ccttcgacat     14760
     taagctgctg caacagggcc attataaaaa atgtaacgac tactgtactc tagaataatt     14820
     ttggtttagc caagcccatg gtttcccata tacatgggaa cgtatgtaca tatatactaa     14880
     atatacatat ttagaataac attactttta aacaagcatc tatctaggtt agtcgtgcaa     14940
     cttcttgttg tcctagacgg aagttaatgc cctttccacc taagtacact tgaatcaata     15000
     tcaagagtca gtcggatgcc taaaatacaa atagtgtgct cgatgctcca tctcaactgg     15060
     attttaatcc atctactgac ctgacacagg aagtgcggaa acaaggatac agcataatct     15120
     actaaaatta ataattagag taagcaaaat atgttcaaat ataacaattt aatagtcagg     15180
     taattgtgta ttatgtcaat tcattcagtc aattcataaa cgatcaatac aaaacatcaa     15240
     attatcaaag ataaatcaaa gattaaatga tgcatacctg acttcaaaat atacatagca     15300
     tggaacatga agttccacac tatgggctga tctggataac agaatcgcac tgaacattta     15360
     gaaactttcc cttaagtagt aaatccaaga atcccctcaa ggaaaggggt gtgtgaataa     15420
     caaaaggcat ttgcatttag tggaagggtt tctgcctata ggaaaggcac acccttggca     15480
     gtggttcaaa agatagccga agttatatat ttattgtttt gattatgtct atttctgagg     15540
     gagtgagacc agtcgcactg agacatttta aatgatatca aacatgatag ataaagtcac     15600
     ttgggttgat atagaacatt cagactttga aatgaccatt ctgtgtgagt acagtatgta     15660
     gagggggtgg ttgaaaatgg aggaaaggat gggagctgtt ttttcccgca ttcccgcctg     15720
     ctgggttgta aagtcgtttg tctctgtttt cggcacatgt ttgaatggtc aaagacatca     15780
     aaatattagt gaaatctcac gtcttacaga agcataaatg aaatgtttta ggtgagtaac     15840
     tacattttgc agacatgcta ttaagttcca gcaaaccatt tcaacattgc cgccagagct     15900
     gccagagtca acgccgccac ccccagagct ggcaaagttg ataccaccgc taccagagtt     15960
     gacaccgcca gagtcattga aggtgctaga accctctgaa ttccttgaat ggcgggcacc     16020
     agatgcttct gaatccctcg aatggtgggc atcagacacc tttgaatccc tccaatggcc     16080
     aggggtgcca gataccctca aattccctgc gccagatcca gaattcccca aatggtcaga     16140
     gtcgccacct gagtcccaca aatgggcaga gtcgccacct gagtcccacg aatggccagg     16200
     gtcgccacct gagtcccaca aatggccaga gccatgtggc ttcccagtgc cgttagagcc     16260
     atctgactct ccagtgcttc ctgaaccaaa gcctcctgac cctctagggt tattcgaact     16320
     gccagtgctt cgtgaacctg actcaatggg gtttttgaat cgccagtgcc tcctgaacct     16380
     aagcctcctg atccacaggg gctttctgaa ccgtcaatgt ctgctgaacc aaaactgcat     16440
     gcttcagaac ctctgcagct ccacgctcca ggcccttcac agctccattc cctaggcctt     16500
     tcacagctcc acgcttcagg ccctttgcag cttaacactc caggccctct gcagcttcat     16560
     gctccaggtc ttccgcagct ccacgctcca ggccctatgt ggctccaggc tcccctctgc     16620
     tgcatggacc tggcccgcag tcccttcctc tgttccgcct cagcttcacc tccctcctgc     16680
     actgtattaa gagcatctag aagccgctta tagagggggg ggggctctat tataattgcc     16740
     agtggtgttg tctccactag tgatttactt actgtagttt gttgcaatcg tcaggggggt     16800
     tttctatatg agaaattact gctgatcgaa ctacaactcc cagaactccc tgcacttatc     16860
     aactcttgca acagctgaaa ataatccgga cacacacaca cagacaaagt tgctgctcat     16920
     ctattctgat tacaggacaa taaatagacc ttaccttgat tcacacattg gcgagtctta     16980
     tttcagtttg aacattacaa agcattttcg tgtgtattaa tccttgcctc gttccttgtt     17040
     ttgattcatt gttgaataac catacctctc gcctgtatac tgaccatgtc ttttggattt     17100
     ttcttgtttt actcttttgc ttctgttttt gagctctgtg tgtacaacct cgattattaa     17160
     actgcatttg gaactgcacg tctgttctca gcgtctgctt cgtgacaaga acaagcaacc     17220
     ataaattcaa gagaataaaa gcttcacaaa gactggtcat gagttgatct gaagaccatt     17280
     ccccctgtaa tagagcatct tataaaatta tgaaatatta ctgtgaatgt gagaccactt     17340
     taccaatcac acaaagacct ttaaatgata ccaattatga atagaaaaag tatagatcca     17400
     caatattcag aagttggcca ttctgcgtga aggagtgtca ttgagctgct ctgctaaaga     17460
     aggtaaagtt gagggcaaag aggggtgctc cgggtgggtg actgagacag ttgaacaact     17520
     ggtttcctaa tgttcttccc agattaatag cttattgttt aattgcatga caattctcat     17580
     ggtcttgcct tatgaaattc actgacattt cttggggtct gatattatgg aaatatttag     17640
     ccatccttac aatttttaac ataatttgac aatttgtaaa atgaaatgtg aaatgctgac     17700
     aatgaagcac tgtttgtcta tttgactcag tgattctata ttagactcag atgatctgca     17760
     gtgtgtaatt gtggcaatgg tttacagtga atttaggagt gtgtgatatt tattgtctct     17820
     gatcatcaaa aacattttaa gagtccaaaa gatttacagc ctgatgaagc ctataatgca     17880
     gttatacagg gaaatataat tgttagaata ataaaagata aaagaggaaa taattaatca     17940
     aagagtgaca agtatttctc tcccttttta atgtgtaagt gcaatacaca gattagacag     18000
     gctgacatgt gtagttattc actgtgtatt tgatgactat tttagttttg ggcttttctt     18060
     agaagtttat taaactttca attacatccc aaattaagcc ttgttttagc caaaatcaag     18120
     ctgtctatta gacttatttt taaacataac agaaatgctt gctgggatgg tacagaggca     18180
     gtgctcactt ctggacaggg agggtttaga cttgcaaatg gagacagaat gtgcagaact     18240
     tgtggctgtt ctctatgcaa gcgctgatgt tttgaacctt tagccaacag catgtgttat     18300
     tgattgattg atggattgtt aaataaacta ataaataaaa taattaattt gtgttttttt     18360
     atattataca tacagttgaa gcccccatga attattagac cccctgttta ttttttcccc     18420
     aatttctgtt taaggagaga agattttttc aacacatttc caatcataat agttttgata     18480
     actcatttct aataactgat ttattttatc tttgccatga tgacagtaaa taatatttta     18540
     ctagatattt ttcaacaatc cgtatcttta aactgtatca cacttctata cagcttaaag     18600
     tgacatttca aggcttaact aggttaatta ggttaactag gcaggttagg gtaattattg     18660
     tataacgata tgtaacgggt tttattttta gaatgttgta gtgacacact gagggcagga     18720
     tacaactgca gccacacttg acttttctcc ccatagactt ccattcatac gcacgcgaat     18780
     gcgtcagacc ggaaacgcag ggtcatgctc atgcatcaag tttcacaggt tgctgcagtg     18840
     caaagttcaa gctttagatg atctttgtgt ttgatctgtg tgtacaatgt ctgcgtaatc     18900
     gtggtttaca gtgaatttag accggtttag tagaaatgtg tgatatgtat tggctctgat     18960
     aatcaaaaac acattttgag tccaaaagat tctctgcctg atgaagccca ataacagagt     19020
     tataatgacg ttataattgt agaattgtac atgaataata aaatttttat taagataaaa     19080
     taagattttt atgttttgcc aggttctgca agtagatgag catgtcattg gagtagacta     19140
     tgaccagctt gtgaagttac ttataagatc tcagctcatg gggtattacc attaaaatga     19200
     aacttttcca gcagaatatg acgctttaaa aaattccatc agcactgata attatgaaac     19260
     gcatg                                                                 19265
//