spacer

EBI Dbfetch

ID   AL672149; SV 4; linear; genomic DNA; STD; VRT; 15645 BP.
XX
AC   AL672149;
XX
DT   15-FEB-2002 (Rel. 70, Created)
DT   29-JUL-2003 (Rel. 76, Last updated, Version 9)
XX
DE   Zebrafish DNA sequence from clone BUSM1-265N10 Contains the 3' part of a
DE   novel gene similar to IP3K (inositol 1,4,5-trisphosphate 3-kinase).
XX
KW   HTG; IP3K; kinase.
XX
OS   Danio rerio (zebrafish)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;
OC   Cyprinidae; Danio.
XX
RN   [1]
RP   1-15645
RA   Pandian R.;
RT   ;
RL   Submitted (20-JUN-2003) to the INSDC.
RL   Wellcome Trust Sanger Institute, Hinxton, Cambridgeshire, CB10 1SA, UK.
RL   E-mail enquiries: zfish-help@sanger.ac.uk Clone requests:
RL   clonerequest@sanger.ac.uk
XX
DR   MD5; e1676348483e00800710e133cc4cff28.
DR   RFAM; RF00001; 5S_rRNA.
XX
CC   During sequence assembly data is compared from overlapping clones.
CC   Where differences are found these are annotated as variations
CC   together with a note of the overlapping clone name. Note that the
CC   variation annotation may not be found in the sequence submission
CC   corresponding to the overlapping clone, as we submit sequences with
CC   only a small overlap as described above.
CC   
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases:
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP;
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
CC   
CC   BUSM1-265N10 is from a Zebrafish PAC library
CC   VECTOR: pCYPAC-6
CC   
CC   IMPORTANT: This sequence is not the entire insert of clone BUSM1-265N10
CC   It may be shorter because we sequence overlapping sections only once,
CC   except for a short overlap.
CC   The true right end of clone BUSM1-265N10 is at 15645 in this sequence.
CC   The true right end of clone BUSM1-181P14 is at 2000 in this sequence.
CC   
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats;
CC   all regions were covered by at least one plasmid subclone or more than one
CC   M13 subclone; and the assembly was confirmed by restriction digest, except
CC   on the rare occasion of the clone being a YAC.
CC   
CC   Clone-derived Zebrafish pUC subclones occasionally display inconsistency
CC   over the length of mononucleotide A/T runs and conserved TA repeats.
CC   Where this is found the longest good quality representation will be
CC   submitted.
CC   
CC   Repeat names beginning "Dr" were identified by the Recon repeat discovery
CC   system (Zhirong Bao and Sean Eddy, submitted), and those beginning "drr"
CC   were identified by Rick Waterman (Stephen Johnson lab, WashU).  For
CC   further information see
CC   http://www.sanger.ac.uk/Projects/D_rerio/fishmask.shtml
CC   
CC   -------------- Genome Center
CC   Center: Wellcome Trust Sanger Institute
CC   Center code: SC
CC   Web site: http://www.sanger.ac.uk
CC   Contact: zfish-help@sanger.ac.uk
CC   --------------
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..15645
FT                   /organism="Danio rerio"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="BUSM1"
FT                   /clone="BUSM1-265N10"
FT                   /db_xref="taxon:7955"
FT   repeat_region   124..210
FT                   /note="drr800 repeat: matches 1..87 of consensus"
FT   repeat_region   432..450
FT                   /note="1.9 copies 10 mer TGTGCAATTG 29% conserved"
FT   repeat_region   complement(487..548)
FT                   /note="drr1107 repeat: matches 1..58 of consensus"
FT   repeat_region   complement(765..944)
FT                   /note="drr535 repeat: matches 1..180 of consensus"
FT   repeat_region   969..1046
FT                   /note="drr566 repeat: matches 1..78 of consensus"
FT   repeat_region   complement(980..1125)
FT                   /note="Dr000115 repeat: matches 209..358 of consensus"
FT   repeat_region   1249..1592
FT                   /note="Dr000397 repeat: matches 1..377 of consensus"
FT   repeat_region   1688..1698
FT                   /note="2.2 copies 5 mer AATAA 22% conserved"
FT   repeat_region   complement(1769..1927)
FT                   /note="Dr000115 repeat: matches 3..167 of consensus"
FT   repeat_region   2332..2343
FT                   /note="3.0 copies 4 mer CATC 24% conserved"
FT   repeat_region   2638..2915
FT                   /note="Dr000286 repeat: matches 1..298 of consensus"
FT   repeat_region   2923..3179
FT                   /note="Dr000397 repeat: matches 2..255 of consensus"
FT   repeat_region   3189..3403
FT                   /note="Dr000397 repeat: matches 360..573 of consensus"
FT   repeat_region   complement(3446..3508)
FT                   /note="LOOPERN6_DR repeat: matches 757..833 of consensus"
FT   repeat_region   complement(3553..3717)
FT                   /note="Dr000286 repeat: matches 22..202 of consensus"
FT   repeat_region   3730..3879
FT                   /note="Dr000222 repeat: matches 64..209 of consensus"
FT   repeat_region   3893..3910
FT                   /note="2.2 copies 8 mer TTCTGTCT 36% conserved"
FT   CDS             join(<3924..4134,5889..5987,8088..8159,11846..12052)
FT                   /codon_start=2
FT                   /gene="SI:dZ265N10.1"
FT                   /product="SI:dZ265N10.1 (novel protein similar to human
FT                   inositol 1,4,5-trisphosphate 3-kinase (IP3K))"
FT                   /note="match: proteins: Tr:Q91XW1 Tr:Q96DU7 Sw:Q96JS1
FT                   Sw:P42335 Sw:P27987 Sw:CAD20257 Sw:CAB65055"
FT                   /db_xref="GOA:Q8JFS6"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JFS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD43433.1"
FT                   /translation="TYLEDELVRARVKPKLREDLYNKMLEVDSGAPTTEERQQKAVTKP
FT                   RYMQWRESLSSTHTLGFRIEGIKVVRGETCNTDFKKTRSKEDVTQVFKDFIEGNKNIIN
FT                   SYITRLEEIKRALKASEFFKKHEVIGSSLLFIHDHTERAEVWLIDFGKTTALPDGQYLD
FT                   HYRPWEEGNREDGYLWGLNNLLQTLSSLGKRE"
FT   repeat_region   4206..4218
FT                   /note="13.0 copies 1 mer T 26% conserved"
FT   repeat_region   complement(4232..4301)
FT                   /note="drr747 repeat: matches 47..115 of consensus"
FT   repeat_region   4317..4327
FT                   /note="2.2 copies 5 mer ACAGG 22% conserved"
FT   repeat_region   complement(4419..4469)
FT                   /note="drr747 repeat: matches 16..66 of consensus"
FT   repeat_region   complement(4491..4652)
FT                   /note="Dr000365 repeat: matches 15..182 of consensus"
FT   repeat_region   4654..4664
FT                   /note="2.8 copies 4 mer AAAG 22% conserved"
FT   repeat_region   4710..4724
FT                   /note="5.0 copies 3 mer TTA 21% conserved"
FT   repeat_region   complement(4725..4805)
FT                   /note="drr746 repeat: matches 138..220 of consensus"
FT   repeat_region   4821..4846
FT                   /note="8.7 copies 3 mer TAA 34% conserved"
FT   repeat_region   4840..4860
FT                   /note="10.5 copies 2 mer TA 35% conserved"
FT   repeat_region   4864..4875
FT                   /note="6.0 copies 2 mer AC 24% conserved"
FT   repeat_region   4876..5291
FT                   /note="TDR18 repeat: matches 2..489 of consensus"
FT   repeat_region   5296..5625
FT                   /note="Dr000396 repeat: matches 1..362 of consensus"
FT   repeat_region   5628..5723
FT                   /note="TDR18 repeat: matches 474..570 of consensus"
FT   repeat_region   5731..5744
FT                   /note="7.0 copies 2 mer TA 21% conserved"
FT   repeat_region   complement(6206..6297)
FT                   /note="TDR15 repeat: matches 86..174 of consensus"
FT   repeat_region   6288..7014
FT                   /note="TDR13 repeat: matches 1..772 of consensus"
FT   repeat_region   complement(7014..7112)
FT                   /note="TDR15 repeat: matches 17..104 of consensus"
FT   repeat_region   7255..7273
FT                   /note="3.8 copies 5 mer CTATG 38% conserved"
FT   repeat_region   7475..7485
FT                   /note="3.7 copies 3 mer ATG 22% conserved"
FT   repeat_region   7694..7713
FT                   /note="3.3 copies 6 mer ATAAAA 31% conserved"
FT   repeat_region   7695..7715
FT                   /note="3.0 copies 7 mer TAAAAAC 35% conserved"
FT   repeat_region   7917..7926
FT                   /note="10.0 copies 1 mer T 20% conserved"
FT   repeat_region   8334..8404
FT                   /note="Dr000183 repeat: matches 35..107 of consensus"
FT   repeat_region   complement(8402..8595)
FT                   /note="Dr000017 repeat: matches 68..265 of consensus"
FT   repeat_region   8643..8653
FT                   /note="2.2 copies 5 mer GAGCA 22% conserved"
FT   repeat_region   complement(8682..8897)
FT                   /note="drr534 repeat: matches 1..216 of consensus"
FT   repeat_region   8905..9230
FT                   /note="drr707 repeat: matches 194..521 of consensus"
FT   repeat_region   complement(9328..9391)
FT                   /note="Dr000324 repeat: matches 201..259 of consensus"
FT   repeat_region   complement(9399..10515)
FT                   /note="Dr000234 repeat: matches 2..1143 of consensus"
FT   repeat_region   complement(10519..10614)
FT                   /note="Dr000324 repeat: matches 130..199 of consensus"
FT   repeat_region   10557..10645
FT                   /note="Dr000193 repeat: matches 576..677 of consensus"
FT   repeat_region   complement(10760..10831)
FT                   /note="Dr000407 repeat: matches 1..72 of consensus"
FT   repeat_region   complement(10766..10843)
FT                   /note="TDR9 repeat: matches 131..208 of consensus"
FT   repeat_region   complement(10844..11304)
FT                   /note="HATN10_DR repeat: matches 1..455 of consensus"
FT   repeat_region   11424..11535
FT                   /note="Dr000341 repeat: matches 647..760 of consensus"
FT   repeat_region   complement(11557..11658)
FT                   /note="Dr000315 repeat: matches 277..383 of consensus"
FT   repeat_region   12316..12327
FT                   /note="2.4 copies 5 mer AATTC 24% conserved"
FT   repeat_region   12936..12945
FT                   /note="3.3 copies 3 mer AGC 20% conserved"
FT   repeat_region   13202..13227
FT                   /note="26.0 copies 1 mer T 25% conserved"
FT   repeat_region   13302..13318
FT                   /note="3.4 copies 5 mer AAACA 27% conserved"
FT   repeat_region   13420..13451
FT                   /note="6.4 copies 5 mer TTTTA 41% conserved"
FT   repeat_region   13421..13455
FT                   /note="8.8 copies 4 mer TTTA 25% conserved"
FT   repeat_region   complement(13701..13737)
FT                   /note="Dr000193 repeat: matches 934..970 of consensus"
FT   repeat_region   13742..14038
FT                   /note="drr596 repeat: matches 3..390 of consensus"
FT   repeat_region   14060..14208
FT                   /note="Dr000213 repeat: matches 47..195 of consensus"
FT   repeat_region   14223..14295
FT                   /note="drr596 repeat: matches 446..523 of consensus"
FT   repeat_region   complement(14246..14412)
FT                   /note="drr596 repeat: matches 1..173 of consensus"
FT   repeat_region   complement(14427..14946)
FT                   /note="Dr000332 repeat: matches 34..556 of consensus"
FT   repeat_region   15032..15043
FT                   /note="2.0 copies 6 mer AAAGTG 24% conserved"
FT   repeat_region   15180..15190
FT                   /note="2.2 copies 5 mer AGCTC 22% conserved"
XX
SQ   Sequence 15645 BP; 5063 A; 2839 C; 2935 G; 4808 T; 0 other;
     accaatgaaa agggcatcac agtcaatacg tgaagagaca aatgcatgga tgacagtctc        60
     agcatccctg ctactgatta agggacgcgg ttaggaaaag caacgtgaat aaaagaatgc       120
     agatttaata acagatttaa tgtgagactg aaaggagagt gtagagttga agattacacc       180
     tacatttttg acagacgtag atgttttaat gtgagagcca gcaatctcac agggtctcaa       240
     actggtcgaa atattgctgg ttagtgctgg ggtgccaata aaaatgatct cagttttgtc       300
     catgttgagt ttcaaagaat ttgagttaag ccaatcatta atgtccttca cagagaatgt       360
     gttcacacat gacgattaca tataaaatca atggaaataa aggcaaattg cgctgcaaat       420
     ttggcacaga atgtgcaatt gtgtggaatt tacctctttc atttcttgta tgcaacgttt       480
     ccctacttca actcgagcag aaaattcaca tgaggcaaaa aacatcccat gagtaatcta       540
     gagcgagtga catgatcaat tgtatatggt ttcaattaat gcttttattt agttattatt       600
     tttacaaatt agctaagtaa aattgatggt ttaaatcccc tataattgca tcagttaatg       660
     attctacctt aagtctttta tgaataacta aatgcagcat tgggttcgtg tcctaacgtt       720
     ttatcctact catcagatta tgctaccaac actgtgtttg aatgattctg cggttgaggt       780
     tagagattag gtagtttaga gtgatattac agcttcatat cacactactc cacattaaaa       840
     tttacactgg tagcaaaatc tgatgggtag catattgcgt catcaaaatg tgcgacatac       900
     tatttcaatg ggaggtagga cgatctgaca aagtaggaca aatcgacaag acatcggatt       960
     gtttatagta gggctaggtg atatggcaaa aatgcaatct cgataatcct tttccatatt      1020
     gataaataac gatatgtatt gcgatataag ttgttaatgc ttccagaaaa cagttttcca      1080
     acaatgactg aagccacaaa gatcagacgc tttattaaat aacattttaa actgttgttt      1140
     attaacaaaa atagcttaca cataactgat ttttggatgt tccgatgttc tgtcatatac      1200
     ttttgatatt ctgaagaact gtaactgaca gtataaatac agaacacaat aataataata      1260
     ataattcctt atatttatat agcactttta tggatactca aagttcttta caaatttttt      1320
     ggggaccaaa agtgtgcagc atcctcctgg atgacactac agtagccata tcgcgccaaa      1380
     ccgcacacca gttgattagt ggaaaggaga aagggtgatg aagccaatta tgaaatgggg      1440
     atggttagga tgtcatgatg gacagaggcc agtgggcaaa tttgttaaac ccctactctt      1500
     tttccaagga catcctggga tttttaacaa ccacagagag tcatgtcctc gatttaacat      1560
     gtcatctgaa agatggcact cactgagcag tacttgcatg tacttatttc atttttaaaa      1620
     aacaaaaaat tacaaaaata ttttaaaata aatgttttac ttaattaaaa atggctaaat      1680
     agtaatcaat aaaataaaca agagtttaac agcaaatact gccggcagga aagtgaatcg      1740
     agctcgctaa tcaatactgg gtggcgtagc atatctctaa tatcaacaca atgacagatt      1800
     cccgcaaatg tctgctgcgt gattgtctct tagatcaata tcaaataaaa atgtccatag      1860
     cttatcatcg ttatcaacat taatattatc gcgattcgat ataatatcgt ttatcggccc      1920
     agccctagtt tacagtaact tttttacatt ttcgactaca gcaacttaac cgctttaagt      1980
     caagctgaaa gtaaatgatc atatttttca aaaagtacta agaaactgtg aagtgctaag      2040
     tcgtagataa acattgctct gatccccaca ttacaagtgg acaaacttta ttttaactcc      2100
     agaccacctc agtgagatga actgttcatt gcacactgca atttacaaac aaggcacgat      2160
     ttgacactgt attttaagaa atattcaaac taaaagatga cgctgttgca aatatattgg      2220
     atgcgagagc aaagtcacac cactgaagtg tgaataattg tttttattat atggaaattt      2280
     attgctgtga ctgttattac agatcatttc ataaacctta aatcactgca gcatccatcc      2340
     atctatgaga acaatataaa catccatgca gaagtttaca tctttcacag ctgtactttt      2400
     aaaacatttg aaataaagtg aagctgtgag cctgtcttac tgtttacttc tgtgtctaca      2460
     atcaagcatg gattttccaa acagtgtgtt ctaatgatgg gggtcaaagc aggacagaaa      2520
     tatagcctat attactttga gattctgatg agtttaaatg taaaattcct gataatatta      2580
     aaagcggacc tcagagagca gcacacatta gaaaaagaca tttcatgacc cctttaactc      2640
     ttgtgcactg ttcaaattga ctaccctttc gttatgttag tggctgtttt tgccccattg      2700
     acttcaatca aaattacatt tttggactgc aaagctgaca ccagttaatc atttattctt      2760
     gattgttggt ggttttccct gttgggaaga ggtaaactgt gtcatttttg ctgttgatca      2820
     tcagttagca tcattaaact tttagataga taaaagttgc tggctttcat atggagctat      2880
     atggagtaaa acagctaatt atagtgtttg agtataaata agtaataata ataatgaatc      2940
     cttacattta tatagcactt ttctggacac tcaaaatgct tctacacatt ttgggggggg      3000
     aatctcctca ttcaccacca gtgtgcacat ccacctggat gacgcggcgg cagcaatata      3060
     gcaccagact gcacaccaca caccagctga atggtggaga ggagacagtg tgatgaagcc      3120
     aattatgata tggggatggt tggaggcctt gatggacaga ggccagtggg caaatctggg      3180
     acatcctggg cgctcactga tcatatatag agtccccatt aatataaggg ggtgttagga      3240
     tccacacaga ccataggttg agtgccccct gatggtctca ctaacaccgc ttccggcagc      3300
     aacctagctt tcccatatca tctcccatcc aggtactgac cgggttcagc cctgctaggc      3360
     ttcagtgcgc taccatgtga gagttgcaga gagctagctg ctggaatgct agatgctttc      3420
     tagatacact tactatgttt actatgtttt gagagctttg ctgcttattt agattttccc      3480
     agacatatag atatctctct cacacacaaa atacattcca tatagaatca taaactaagg      3540
     ttttttgcat ttcaactaat gatgaaccgt acaaattaca attttgacct cttcccaaca      3600
     gggataacca gcagcaacag tcatgtcatg gctttgcaat caaaaaatgt tattataatg      3660
     gaagtcaaac aggcaaaatg atccatgaac ataaagaaag agtagtaagt ttgctaactt      3720
     tcaaattttc aaaacattgt ccatatatgt gtcaaaataa gattactcac caaaaaatca      3780
     ttccatttgc agaaacacag agaaagttgt ggccaaatta agacttttta aattaagacc      3840
     ccagagtgat gaacacatcc ccaacagcac atagatgtta aacgtctaat tcttctgtct      3900
     ttctgtcttt tgttctctgt caggacgtat ctggaggatg agctggttcg agcacgggtg      3960
     aagccaaagc tgcgggagga cttgtataat aagatgctgg aggtggacag cggagcacct      4020
     accactgagg aaaggcagca gaaggcggtt actaaacctc gatacatgca gtggagagaa      4080
     agcctgagct ccactcacac tctgggcttt cgcattgagg gtatcaaggt agttgtttta      4140
     ccatctgtcc tgtttctaat tctttgtcta ataaatgttt tgttaacatt tgtctttgtt      4200
     ttaggttttt ttttttttca attgaactat gtttgtttgt tctgatgata tattatttct      4260
     cagtgccagt gtctaaaagg gtttttttgt tcacttaact ttttcaagaa ttagaaacag      4320
     gacaggaggt aaaacaacat taatgataaa caagaaaagg atcaaaacat gtcaggacaa      4380
     agaggaaaac attctttgta atgtttcata tgtttttttt ttttttttca cccaacttaa      4440
     gacattgaaa gtcgatacaa ctgatgttta ataatgaagt taagtacaag tcggtgccaa      4500
     tggagtagtg gttagtgcgt caacacatga cataacaagt gttcacggtg aactaagttt      4560
     gattcctgcc ctgaggtcct gtactgatcc tttgcctgtc cccatgcttt cctgtctata      4620
     tgcgctactg ttctatcaat taaaggtaaa aaaaaagaaa gaaaacaaaa ataatgagga      4680
     cactagaaaa gaactaaagg aaatagggtt tatttttatt attacagttc tccagacaaa      4740
     acaaaatatt cagttggcac aagttttgtt acagagtagt tcacctctcc agaaaactaa      4800
     taatcacttc tccagaaaac taataatgat aataataatt ataatatata tatatatata      4860
     attacacaca cacacacagt tgaagtcaga attattagcc cccgtgttta actttttccc      4920
     caatgtctgt ttaacggaga gcagattttt tttcaacaca tttctaaaca taatagtttt      4980
     aataactcat ttctaataac tgattcattt tatctttgcc atgatgacag tatataatat      5040
     tttactagat atttttcaag acacttttat acagcttaaa gtgacattta aaggcttaac      5100
     taggttaatt agtttaacta ggcaggttag ggtaattagg caagttattg tataacgatg      5160
     gttaaagggg ctaataattt tgaccttaaa atgttttgtt tgttttttta aatcaagaac      5220
     tgcttttatt ctagcagaaa aaataagact ttaagaaaaa aaaaattcag acgtactgta      5280
     aaaatttcct tcattcattc attcattttc ttgttggctt agtcccttta ttatccagtg      5340
     ttgccacagc ggaatgaacc gccaacttat cccgctcatt ttttatgcaa cggatgccct      5400
     tccaaccaca acccatctct aggaaacatc cacacacaca catacactac agacaacctg      5460
     tactgcatgt ctttggactg tgagggaaac cggagcacct ggaggaggcc cacgtgaatg      5520
     cagggagaac atgcaaactc cacacagaaa cgccaactga gccgaggttc gaaccagcga      5580
     ccttcttgct gtgaggcgaa agcactacct actgcgtcac tacgtcgccg caaaaatttg      5640
     cttgcactgt taaacttaat ttgggtaata tttaaaaaag aaaaaaaaat gaaagagggg      5700
     ctaataatga tgacttcaac tgtttatttt tatatatata atatcaaaga ataagcctta      5760
     aacaagcaga tgtgtttttt tgcaataaca cattccccga gttctcactt gatatttgcc      5820
     tgctttctct gactgtggga acattcaaca cgactaactt gtttttgttg tttttgggtt      5880
     ttttccagag aggggaaacc tgcaacacag acttcaaaaa gacccgctca aaggaagacg      5940
     tcacgcaggt ctttaaggat ttcatcgaag gcaataaaaa cataattgtg cgtgagttct      6000
     tgagaactag atcaacctgt tctgtgaaat caatgcatgc acacctacaa ttaccagaac      6060
     aacactgagt cagtggctta atgaacacca gaccttgact gctccgtatc ctggatatac      6120
     tggttagaaa aggccagaca ttgtttactg taaaagttaa aactccgaca aacacatgct      6180
     gtagagggac agaaaagtgc tcttttaaaa tggtgatcat tagagccaat cacaatcata      6240
     tctgttgagc gtttgttgaa cacattggcc aatcagcagt atttcagcaa cagctcattc      6300
     tgaaaacgta gccctatata catttctgga gattgcgaat tatgtagcca gaggtacgga      6360
     tgactgcatt tcgtctttaa aatgaacgct acggggtggt atgatactgc tcctttttgc      6420
     gtttaccagc tgaccactta cctgcatgta gacagctttc cagctgttac cagtttgtcc      6480
     agtagcccac catgtacagt ggtggacttg tgatgcagag ttgactacga tgacaaggtg      6540
     caaatccagc gaagaacagt tcccaaaagt ggataagtca aaaccaggag gcaaaaataa      6600
     aataaaaagt aaataacaag gtgagaatgt ggtaaaatat gaaaatgtgg taaaaattag      6660
     gcgagggctt ttctttttct gaattgcctt ttaaaattgt cggttgggtt taaataagtg      6720
     ggtggatggg tcaatcggtg ctttgaaaac aataacaaga ggagggtggg gtttccagtt      6780
     gcttgatcag tcagtcattc agttagtcag tcaacagcga cctctggagg atttacatga      6840
     gaatagcagg tgcgaatggc acttgcaaga gaaatttgtg atctgtaaat gcgtacacat      6900
     cgtcctctgg tggattcccg aaaacaaaaa cttcaaaaag cgtaccgcct gtgatgtatt      6960
     tggcacggtt cagaaaggta tatatgggca cgttttcaga atgagcctgg gttgtgttta      7020
     agagtccact cagcagcgtt ccaaatgcaa gcaggaaatg ctgctattgt cacatttttt      7080
     caatttcagt acagactggt aacaaagttg atgatgccca tcgtgaacgc ctaactactc      7140
     acagtctcat aatttgaccg aataattcag aagcattgtc ttcctattgg ataataaaac      7200
     ttagtctcat ttttaataat tagacactga tgtgtcattg aagtactcgc actcctatgc      7260
     tatgctatgc tatttacaga tgttacagtt ttgttgtatt cataggagaa taaaatacat      7320
     gaacattaag aacttatgcc ctgtatcctc tattggaatg ataaatgaat atgtatgaat      7380
     tttaaaaggt tagctaacta ctagacttat aatattgcat attcttcagg ttattatgct      7440
     atttttgata gcatttgaca gttctgagca tatcatgatg atgattgcca gttgtcctac      7500
     tgaatgtggt ctcctcagca atgaactatt atctttgttc gtgctgatga gcagtgttgc      7560
     cagatattgc tatcaaaaat caacaaaagc attcccccaa aaaaatgcac caaaataaaa      7620
     acaaatagga tacagaatcg ccaactgtca tcataaccgt caaaactagt tgatcttttg      7680
     tacatagacc attataaaaa ctaaaaataa aaactctagt gcatttacat ttggtgtcag      7740
     gatccatgga aattggtgat ttgtttatct tagagtgcaa gttaaagggt taatggacaa      7800
     gggaagttga tggtaaagtc aggtgtttga atgcaaagca tttcacagta actaaaactg      7860
     agtttgaaaa gcaaatatag ctgcaaagct tttaatgatt gtgtttgaag aacatgtttt      7920
     ttttttaaga ggagagcaga gaaagctcta atgcttcact agggaaaagc agaaacaaat      7980
     gaactgcact tacaagttgt ccttgtgtaa ttggagcctc acttcagcaa atattgaaaa      8040
     cagatatctt gtctgcaatc atttcatgat gtgctcttct tttacagaac tcctacatta      8100
     caagacttga agagattaaa cgggcactga aggcctcaga gttcttcaag aaacatgagg      8160
     taaaaaaagt gtatttttta aataaagaca ttttctttat ctgcatacat ttatcttatt      8220
     actttaaaac tattaagtgg tttctttttt tcatagctgc atatatattc agcaaattat      8280
     gttgtgctgc aatgtaattg tactttaaat actgagtaat accaaaattc ctaccatctt      8340
     tgaaatgcct attgggcagt atgctcgggc attctttgaa tggggaaaca tcaaattctc      8400
     caaattacgt gtatcaagtc ttacctccct gactcatccc tcctttctgc ttcatacaaa      8460
     aaatccatca ggagccacgc ttagtctaaa taagatcacc atcatatttt ttaaaccttt      8520
     gtcgacttgc aatactcact gcgtgccaaa actcacataa aagactattt tgctggttcc      8580
     acaatgcatg agcagcacta gagcagtgcg gctatttttt caaagtgtat gttcacaacc      8640
     gggagcagag cagcacatca gcatcaaggt gcgcggtcat gttttttgct gtgcctatgg      8700
     tcagtctgct ttttgaataa actacaatgc tttcacctgc attggttcgg ttgcacatag      8760
     aaaataacat ctttattctt ggattaccac tcttaataaa tacacttgca tataaagtaa      8820
     atattatctc aaagcattta ctggggcact gtcgattttt actggggcac atgccccagt      8880
     aaatggggtc tagctacgcc actggtgtag tatttaccat ggcatgtgct tttcttttgt      8940
     ttcaaaatga cacttttttt tttactttgt gttggttttt catttaatgt tagtgggaca      9000
     gtacttatgt gtgtgtgtgt gtcaaacatt attgtgaatg aaatttgttt tggttcgtta      9060
     tatatttgaa aaaaagagaa aatgttgact ttagtgatga tagtgctcta tttaaatagc      9120
     acaagataac atctgacagt aagggtaaat gcctcacagc atcccatccc attagtttgc      9180
     atgttttaaa taattagtcc aggaggtggc gctgatcaac agcagcatta aaataattgc      9240
     aagagctgct caagagaatt atacttttgc tttatattgg tttgaaagca cgttgaaatt      9300
     attaataaag tgcctgtgtt cactcccatg caacttctga atcagtagct aaatcaacct      9360
     aaatggtgct gactgacaga cacactccgt attaaaacca tagactgtaa aagatatgga      9420
     cgtagtgtcc gtgacatcac ccataagttt ctgaagaatg caaaagaagc tacaaatagg      9480
     cgtggccaca catcgacatt tagttcctgc gacatcacac cgattggggg ataccaaaca      9540
     tgggcaaaga ggcggaccct aagcagagct acagacgcct gctagcattt tactcagatg      9600
     ggcttttctt cgggagaaac gcttaatttt tcattacctg cgactcgttt gttttttgac      9660
     cacatgcttg gttgtgtact atatcaataa agtgtttagt cttttaaaaa cattgagcca      9720
     ccaaacattc ttcttatgat atttttctac aggaggagaa tgcgaattac ttccaaacac      9780
     ttcaaatata gtctgtgtta gcaaatgctt gtctatttat gaaatccacc catggcatcg      9840
     cttcagatga cttatagagc ctacagctaa tcaatgtttt agattctgga gtgcattaca      9900
     ggtctaaaga aaactgtaat agacaaatga tgtttaataa aacaaataca tttatagata      9960
     tgtatacaag tatataatta cactcactct ggaaatggag gccatgtgaa tgatttgtga     10020
     gcacaattaa gtgaacacag catgccatat catctgataa ttgtaagaaa taattccaaa     10080
     aagcaattga ctgtaaagcc acataaaaca aaacagaaat gcgatgtata tgccaggttc     10140
     agcagctggt cagccggaat cagctgaggt gaagtcatgg caatcagtga gaccaagctg     10200
     tcactcaagt ggccatgccc ttaattatgc aaacttaata taacctaata taaaggaaat     10260
     ggatgagtta taaaaacaat tcaccccctc acagttgtca tgaagggtaa tattagcaat     10320
     atgaaccaaa attgttcttt gtaccaggct gtaaacacct tttttctgtt gtaaagttgg     10380
     ctattttaac tgtggggtca ataaaaaccc tactgttgct ctatatggag cgacaggact     10440
     agcggaattt agatgaattg catttcagtt acatccatat ttgcttcacg agggagagtg     10500
     ggaggttgcc gcttgattaa gaaactattc ccagatcagc ttctgtacaa gtgatcgctt     10560
     tcattctaga tttgtggatt cttaaagtga cagctctgtt atcaaacaaa acagtggatc     10620
     aaaatgagag attcgctact cttcactaaa taactacagt aactttaatc aagattaaaa     10680
     tacagtgaac aaaaagtgaa caagatttgt ataagccatt gatatgggct tttattttgt     10740
     ttttttaata tgttctaatg ttggcggttt attccgctgt ggaaacacca gattaataaa     10800
     gggactaagc tgaaaagaaa atgaatgaat gaatgttcta acgtaggcat gtgccagtat     10860
     aagattccgg tggtataata accttggata aaaatatcac aatttcacgg tatcacggta     10920
     ttgtgcacac tgctctaaaa tatattcttt ctaaatgtct gggtaaaaac acaaaagctt     10980
     ttttcccctt tgaaaacaat attttatttt ttgaaagatt tatgatagtt tggagcagta     11040
     aacacgtcag actaaataat ttaaatcaat cattgacttc cgctgtcttc atttgttaca     11100
     aaaacacaga tttctttaca atttaagacg gcatctttgg atattttttc tgctggagat     11160
     tcggttctaa aagaaaaaaa gtaaataaaa aatcttacac ataccttagg gatggtatta     11220
     cagaaaattg tggcgatatt aaaaccttga ctcttccaaa ctgcagtata ctgtaccttg     11280
     aaaacggtta tcttcccatg cctattccaa tgtttgttat gtattatatc atttgtagct     11340
     tgggagtgtg tatcctgtat attcgcattc taatgttgac aggtatgaaa gcataatggg     11400
     tcattttatg ttcgaagaaa aaggtctata gcaatccatg attggctcct gttctaaaag     11460
     tcaggcttca ttcaccatat tgactgttac acttttcccc atttaaaact atacaagtga     11520
     ctcgtcttgt gtattatata gtctttgtta atatccaaga gcttagaatg accaaaaggc     11580
     gacacttaac gttccattgc agcagcagct cccagcaaca gccccgtatt ccgccatttt     11640
     ggagtgaaag tggtcggcta ttgaattgcg agacttttat tcagaatttg gcatttccac     11700
     cattcaattc tcatgtgata cttcaaaata tgcatgatgg aaactcagct cattttattt     11760
     agcatgtgct tttcaaccca aacttctgaa tccttaatca agttaaacaa ttattcattt     11820
     ttgcttacct aaaaatgtct ttcaggtgat tgggagttct cttttgttca ttcacgatca     11880
     cacagagaga gctgaagtgt ggctcataga tttcggtaag accacagctc ttccagacgg     11940
     acagtacctg gatcactaca gaccctggga ggagggaaac cgagaagacg gatacttatg     12000
     gggccttaac aacctgctgc aaaccctgtc ctcgctggga aaaagagagt gacctcctta     12060
     cggcagactt ttcacttact gacagaacga cagcaaccgc aagctgacag acacttgtaa     12120
     aagagaggct accagtgaga tagtctggta ttttacagta ttaagctgta aaagcattgc     12180
     accacaatca tggtaacaac ctaaatgact tatttcctca aattacaaaa atcactcaaa     12240
     aacagaagaa atttagggcc tgatttacta aaccgaaaat tatcagggga ctgcaatcta     12300
     taaaaatcag cagttaattc aattcaaatt aagtttgaaa aatgaattta accagagaag     12360
     ctgtcaatta tgacatcaca agacattttc ataccatcaa ataactaacg ataccatttt     12420
     aaactaaaaa cacattattt tttgcatttt taatgaaact acagctgcat tttggtggcc     12480
     taaataatgc aaacactcga aaaaacgagt atcttagtgc aagttttaaa atcaaatatg     12540
     aaaaaacatt tttttttata aaaacagtga cgtcatgcac aagtggctgg actgacaatc     12600
     ataatatacc aatgtaaagg cgcagaatga gattttcgcc gctagagggc gcgtaatcac     12660
     aacaaaggca tagattgatg actctgtgac gaagtgttga agcatggtag ttgtgatctt     12720
     cgttacatcc taccggactc cagcatgttt atggatgagc tgaagtatta acaacttatt     12780
     atgatggtag catgaagcag agtaagacag aaagacttca tagcaaaata agagcaattg     12840
     ctgatgtaaa aagcgcgaca cggaataaaa gcagcagagc ttttattatg ccacagtcga     12900
     cgcttccggt tcttctgccc ataatcaacc gcggaagcag cagcactgtt atatcatact     12960
     aaatacattt aaagttctgt tctaatgctg ctcggtgcag tctaataaaa cacacaacat     13020
     atgaaagcgt ctctggtgtt tccctgtttt ctataaaagc aaaccggcaa tcaagcatta     13080
     gcatgacgac aaaggatatg ttctgtttcc ttttaaaatg ttgatggatt tgaactttct     13140
     tcgaaacatc tgggatattg taagtacgca agtcagctaa atatataaca tttttctagt     13200
     gttttttttt tttgtttgtt ttgttttatt aaacaaatat acagtttgtg cctttttgtg     13260
     aatttgtata taaaggggta gttttcagtt ttgttattca taaacaaaac aaaaaaaagt     13320
     ttaacttttt gtacaatttt cttatgcaaa caacttataa gaaaaaaaaa ctacatcagc     13380
     aaataagcag aaaaacttta gttttatgca gggaacgttt tttattttat atattttatt     13440
     ttatttattt ttttacagtg gcctttagta tggtttgcta aaactctatg ggaaaagata     13500
     ggctattaaa ggcacaacct atttttttat ttttactgca gtccaccacc agggggcagt     13560
     caaaatattt tggcttcagt tttcagtaag agtgacaccc ccttagaaaa aaaaccacca     13620
     cttttccacg ataagcaata tgtctccctt cagcacatgc tactgtatcc attttctgca     13680
     ttgccttact gtgggttaag caaacctgtc aactttggga tgtaaaaata agggatacat     13740
     ttggtggcca agagagctta acatgctgca atttaggaaa gcgcatgcaa ttacaaaaag     13800
     actggcaaaa agttacgaaa tgatcttcat caatttgaca gcacacgtgt tccaaattct     13860
     cacaacataa acaactgaag gaattgcagc aattggtcac aacacaacag aatgttacaa     13920
     ggagacccta aaacgtgagc tggttatgga ggatattgtt atttaggcta ataaatactg     13980
     aaggcacagg tatcgggtaa acaaacaaac aaactcacct ttcaaagatc tcctacaata     14040
     agagtttcca aactcggatt ttagctccag cttgcctcaa cacacctgca cggatgtttc     14100
     tagaaagcct ggtaagagct tgattagcta gcccaggtgt gtctgattgg ggttggaact     14160
     aaacttttca ggacaccggc cctccaggac tgagtttggg cacccctgtc caacaacttt     14220
     actgaaacat ttccattgtg tttcgttgtt tttgtgttga aaagcagcat gttttattaa     14280
     tgtttgtttt gtgaggattt gcagcatgtg tgctgtcaaa cggatgaaga tcttttcata     14340
     atttgctggt gtttttagta attgcatgtg ttttcctaaa ttgtagctcg ttaagctctc     14400
     tcggccaccg tagatacact ccttttatgc tcatttaaga cgaaatgtgt tttgttttga     14460
     agaaaaccca tcaagaccga tatgtttaga tattattatt aatattatta ttattatgtg     14520
     tgtatgtctg tttaaacatc cacccaaaac ccagtgtcaa ctcttgcttc gcttcaaatg     14580
     acgtgtacag aatccattat ggaaacagcg tctatttatc aatatggatc gcatctgaca     14640
     tgcgccgcta tatgaactga ctgttttgag gattgcaaag gaggggcaat ggtgcctgta     14700
     ctgaaaagga aggcaatcca actgttttta tatttatttc aaagtgtttt catgcctaaa     14760
     taaaacgaaa gcacagaata aattcacatt taagagcaag gggcatcccc tggtggttcg     14820
     gcggtatggg ttacatatag tgaggatcgg ctctatgata ttcatagcca cccttcatag     14880
     aaaattttta aaaacaggaa aatgccttca caggatgaca gcgggataga attgtaaaat     14940
     aaaggatggt tgaaaggtat ggggttaaga cattttacat ccgaaaaagc aagtggacca     15000
     actggtcacc ccctcataaa ttgtgtatca aaaagtgaaa gtggtataaa tgcatatgaa     15060
     ataaggatgt aaaataacag tgcaaatact agaacacagg cttgagacat cgcatgattt     15120
     gtttaaatac tcattagttt gcagttaaaa ataaaacttc tagaaacgca tctacagtaa     15180
     gctcagctca aaaaactcag ttcaaacgtt cttttattgc taagttttag ggtttctctg     15240
     acgcaagtta ttagtaaatc tggcccttag tttgaaaaga acataacatg agggcacaat     15300
     ttataactcg ctttaagctc ttaaacaagc cttccaatca aaagggttta aagatattga     15360
     aacaaattct gtcaagcgtg tccatttttg tgggggctgc attctggact ctatcaaaat     15420
     ctgttttgtt tggcacactc ttcaaataag atggtctcaa aaagcgacat tgcttcgtgt     15480
     ttagtttcac caaacattag tcaccaattg aagttgcgca actgacaggt ttttcatcta     15540
     gttaatgtgt acagtaggtg caacacattt gtacagtgtg agtaacgcac aatactagtg     15600
     catttatagt acaaaatgat gttaacggga ctgactgcag tgatc                     15645
//


spacer
spacer