spacer

EBI Dbfetch

ID   AL606968; SV 9; linear; genomic DNA; STD; MUS; 3994 BP.
XX
AC   AL606968;
XX
DT   25-SEP-2001 (Rel. 69, Created)
DT   15-JAN-2009 (Rel. 99, Last updated, Version 23)
XX
DE   Mouse DNA sequence from clone RP23-287K23 on chromosome 13 Contains part of
DE   the gene for a novel protein similar to a nuclear envelope pore membrane
DE   protein POM121 and part of a novel gene
XX
KW   HTG; POM121.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3994
RA   Holt K.;
RT   ;
RL   Submitted (13-JAN-2009) to the INSDC.
RL   ac.uk Clone requests: Geneservice (http://www.geneservice.co.uk/) and
RL   BACPAC Resources (http://bacpac.chori.org
XX
DR   MD5; 12438ce6a5519a62b1998ee53c7a98a0.
DR   ENA-CON; GL456164.
DR   Ensembl-Gn; ENSMUSG00000016982; mus_musculus.
DR   Ensembl-Scaffolds; AL606968.9:1-3994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117882; mus_musculus.
DR   EuropePMC; PMC524412; 15364904.
XX
CC   Genome Center
CC   Center: UK Medical Research Council
CC   Center code: UK-MRC
CC   Web site: http://mrcseq.har.mrc.ac.uk
CC   
CC   This sequence was finished as follows unless otherwise noted: all regions
CC   were either double-stranded or sequenced with an alternate chemistry or
CC   covered by high quality data (i.e., phred quality >= 30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and repeats
CC   all regions were covered by at least one subclone; and the assembly was
CC   confirmed by restriction digest, except on the rare occasion of the clone
CC   being a YAC
CC   
CC   The following abbreviations are used to associate primary accession
CC   numbers given in the feature table with their source databases
CC   Em:, EMBL; Sw:, SWISSPROT; Tr:, TREMBL; Wp:, WORMPEP
CC   Information on the WORMPEP database can be found at
CC   http://www.sanger.ac.uk/Projects/C_elegans/wormpep
CC   
CC   Sequence from the Mouse Genome Sequencing Consortium whole genome shotgun
CC   may have been used to confirm this sequence.  Sequence data from the whole
CC   genome shotgun alone has only been used where it has a phred quality of at
CC   least 30
CC   
CC   IMPORTANT: This sequence is not the entire insert of clone RP23-287K23. It
CC   may be shorter because we sequence overlapping sections only once, except
CC   for a short overlap
CC   
CC   During sequence assembly data is compared from overlapping clones. Where
CC   differences are found these are annotated as variations together with a
CC   note of the overlapping clone name. Note that the variation annotation may
CC   not be found in the sequence submission corresponding to the overlapping
CC   clone, as we submit sequences with only a small overlap
CC   
CC   The true right end of clone RP23-38E20 is at 2000 in this sequence
CC   The true left end of clone RP23-9O16 is at 1995 in this sequence
CC   
CC   RP23-287K23 is from the RPCI-23 Mouse BAC Library
CC   constructed by the group of Pieter de Jong
CC   For further details see http://bacpac.chori.org
CC   VECTOR: pBACe3.6
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3994
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="RPCI-23"
FT                   /clone="RP23-287K23"
FT                   /db_xref="taxon:10090"
FT   misc_feature    2001..3994
FT                   /note="annotated region of clone"
FT   mRNA            join(AL589879.21:181361..182817,2001..2238,
FT                   AL590614.8:5843..6090)
FT                   /locus_tag="RP23-9O16.2-002"
FT                   /product="novel protein similar to nuclear envelope pore
FT                   membrane protein POM121"
FT                   /note="match: cDNAs: Em:BC097347.1"
FT                   /note="match: ESTs: Em:BB015632.2"
FT   mRNA            join(AL589879.21:181687..182817,2001..3829)
FT                   /locus_tag="RP23-9O16.2-001"
FT                   /product="novel protein similar to nuclear envelope pore
FT                   membrane protein POM121"
FT                   /note="match: cDNAs: Em:AK022555.1 Em:U10099.1 Em:Z21513.1"
FT                   /note="match: ESTs: Em:BB614547 Em:BB615373"
FT   CDS             join(AL589879.21:181728..182817,2001..3829)
FT                   /locus_tag="RP23-9O16.2-001"
FT                   /standard_name="OTTMUSP00000000480"
FT                   /product="novel protein similar to nuclear envelope pore
FT                   membrane protein POM121"
FT                   /note="match: proteins: Sw:Q9Y2N3 Tr:Q96KW2"
FT                   /db_xref="GOA:Q5SW25"
FT                   /db_xref="MGI:MGI:2684870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SW25"
FT                   /protein_id="CAI24930.1"
FT                   /translation="MGSYLGKAGSSPRSPAQGRADSGEKPASRRPARPLYQVHRVQHVH
FT                   RAQPARRHRPARRPPNWDPANPTAFVSEAWRRFPMKRPQNPIMGSLPSDWWESYLKRNI
FT                   WSLRHPRATWSPVTVKISPPERRPRPLFPVSRVVNSAGPSEEPPGPCGKDPVLRALLQC
FT                   RKGRARWEEPLFPDTSDSQRHSASVWSAFKPLLKSGATVSFVARPGSLKRRPHVQSSDD
FT                   KCKRSGCFSGALVASIHTQGPPSTKRNAITSSYSSSRELSGSWKRHFLRTLVQTPEWPL
FT                   KKAGESPNSHLSVTPSSSGQLNGEIPLLQSGPRDLLTIPCQQGPVVTEEDPTLEGQAVP
FT                   SNQTTEATTGTAGDSIPEMRAGIQPTLSLSRSSSERVLSTHVNPQLESLKNMPAPLGCS
FT                   QLEHIQGISSDSNPSIASTQASPSSPTTPVTDSTWLSSIPRAHRSAVPPHSSVINPTAP
FT                   TTQSTLVGVVSNPILHLPASVLPVETSSHLALRPIWGPVHSTEVRTASYSRISVMAEAS
FT                   SSSSPSTTPGILRPTFKPIFGSIEPLQTMSETAPVHTRQPSSSLSSDSTHLFHSLATTA
FT                   PCVVTSVIPASKSKDPGVDLNIVTSTTGNSCSVPSCSTFLLGASQNFPSATDLIFPSQH
FT                   PTIPTVHTVTIFSQVLTSAIKISPLRSTDTLKGVSNPLATLGLSSTNQPPVTSSNSNVT
FT                   SALTSSLGSSPKPLLPPSQRNTSQSSPGAIDGLKQSSLQLAPAQSFSTSFLSENSGVSP
FT                   TPSAQLVLSKTTQPACGQLTSSAPIIHTPATSQTGFGSTLAGFPFGKASSTALRVIRQN
FT                   HQSVTYSSVFGSTAPRPFAFGGLVMPMDCGEPEVIVAAPKRSTSGTRQSMTPSTLAPFV
FT                   QCWNQSMQGPPNQITPLAGIPARKIMSGAPSLVPFAQSIPVPGAIKAGSSLGFGMSSPT
FT                   VQGSVGRNPLRSLEPSFCIGTKSKTLRNREPGRSRKHHTYKK"
FT   CDS             join(AL589879.21:181728..182817,2001..2238,
FT                   AL590614.8:5843..5924)
FT                   /locus_tag="RP23-9O16.2-002"
FT                   /standard_name="OTTMUSP00000042078"
FT                   /product="novel protein similar to nuclear envelope pore
FT                   membrane protein POM121"
FT                   /db_xref="GOA:Q3V0N0"
FT                   /db_xref="MGI:MGI:2684870"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0N0"
FT                   /protein_id="CAT00710.1"
FT                   /translation="MGSYLGKAGSSPRSPAQGRADSGEKPASRRPARPLYQVHRVQHVH
FT                   RAQPARRHRPARRPPNWDPANPTAFVSEAWRRFPMKRPQNPIMGSLPSDWWESYLKRNI
FT                   WSLRHPRATWSPVTVKISPPERRPRPLFPVSRVVNSAGPSEEPPGPCGKDPVLRALLQC
FT                   RKGRARWEEPLFPDTSDSQRHSASVWSAFKPLLKSGATVSFVARPGSLKRRPHVQSSDD
FT                   KCKRSGCFSGALVASIHTQGPPSTKRNAITSSYSSSRELSGSWKRHFLRTLVQTPEWPL
FT                   KKAGESPNSHLSVTPSSSGQLNGEIPLLQSGPRDLLTIPCQQGPVVTEEDPTLEGQAVP
FT                   SNQTTEATTGTAGDSIPEMRAGIQPTLSLSRSSSERVLSTHVNPQLESLKNMPAPLGCS
FT                   QLEHIQGISSDSNPSIASTQASPSSPTTPVTDSTWLSSIPRAHREKCLSGRWSWTSEAK
FT                   KDVLSGDKSLP"
XX
SQ   Sequence 3994 BP; 917 A; 1206 C; 927 G; 944 T; 0 other;
     ttgtgtattt ggagctcagc ggacagctta tgggagttag ctcactcctt ccaccaagtg        60
     catgctcaga cttggccatc ttgcttgtca atactgtttt gagaaagtgc ttggttagct       120
     acttgttttg ttttgggtga aatgtaagat tctagctcat ggccaggcag agttctttga       180
     tactttggtc cactggccag cataggggtg tagagtgaaa ctttctgtat ccccctaaga       240
     agtcagtttt accttcaact tctatcaact tgtttaacac actaattctg caagtgaata       300
     gaggtttggt cgggaagagg agctccaagt gtcttctaaa tagacccttt cccgccaggg       360
     tgcaaggtta caaatcctga ctttatcccc tgaaggtatg atgctgggtt tggccatgag       420
     gaggctctga tagaactcac agacattacc tcagctggct gctgcctttc ccattgacaa       480
     gtcacaatgc cctatagcct gcctaaacag ttccatcttc ctctggtcct gtgccctctc       540
     gagcacaccc actcgttccc tcgtacgttc actcgtacga tgaagggatt caaatcaccc       600
     agagtcgctt ccagctcaga gtttggggaa ctgggacgcg caccaatgcg catccaggtc       660
     caaggccggg tcctgcctgg atgctagaca ccgagccccc atgagctctg ccagtgtggt       720
     gctcagaccg cagatcccag agcgggctga cgtggttgcc gtggcccgcg tgtcgccagc       780
     tccccagttc cctcgcgctt ttctggcgct cgtggcccaa ccgtcactcg agcagcggat       840
     gcttggattc ggccgcctcc gccgaggttg aaacggggct agaagtcacc gcccgtccgc       900
     gcctctcagc atgggcagct acctgggcaa agcggggtcc tcgccgcggt ccccagcaca       960
     ggggcgcgca gactcagggg agaagcctgc gagccgccga cccgctaggc ccctctacca      1020
     ggtccaccgg gtgcagcatg tccaccgcgc ccagcccgct cggagacaca ggccggcccg      1080
     gaggccgccc aactgggatc ccgccaaccc taccgctttc gtcagtgagg cctggaggcg      1140
     cttccccatg aagaggccac agaaccccat catgggctct cttccttcag actggtggga      1200
     aagttacctg aagcgtaata tttggtccct tcgtcaccct cgggccacat ggagtccggt      1260
     gacagtcaag atctcgcctc ctgagcggag accacggccc ttgttcccgg tctcaagagt      1320
     ggtgaactcc gcgggacctt cagaggagcc accagggccc tgtggaaagg acccggtgct      1380
     gagggccctc ctccagtgca ggaagggcag agccaggtgg gaagagccac tgttcccgga      1440
     cacctccgac agccaaaggc attcggcctc cgtatggtcc gcctttaagc ccctgttgaa      1500
     aagtggggcc actgtttcgt ttgtggccag gcctgggtct ctgaaaagga gaccccatgt      1560
     ccagagctca gatgataaat gtaagagatc cggttgcttc tctggggccc ttgtggccag      1620
     catacatacc caaggccccc ccagcacaaa aagaaatgct attaccagtt cttacagttc      1680
     ttctagagag ctctcaggat cttggaagag acattttctc aggacattag tccagactcc      1740
     agaatggcca ttgaaaaaag caggagagag tcctaattct cacctctcag tcacacccag      1800
     cagctctgga cagctaaatg gagagattcc tctactgcag tctggcccta gggacctgct      1860
     aactatacct tgccagcaag gtcctgttgt cactgaagag gacccaacat tagaggggca      1920
     agctgtgccg agcaaccaaa ccacagaagc tacaaccggg acagccggag actccattcc      1980
     agagatgagg gctggaattc agcctacctt gtctctcagt cggtcgtctt ctgagagagt      2040
     tcttagcacc cacgtgaacc ctcagctgga aagcttgaag aatatgcctg ccccactcgg      2100
     gtgctcacag ttagagcaca tccaaggcat ctcttcagac tcaaatccct caattgcttc      2160
     cacccaggcg tctccaagct ctcccacaac accagtcact gattccacct ggctatcttc      2220
     aatccctcgg gctcacaggt ctgctgtgcc cccacactca tctgtcatta accccacagc      2280
     acccaccaca caaagcactt tggttggggt ggtgagtaac ccaattctcc atcttcctgc      2340
     atctgtactt cccgtggaga cgtcttctca cttagcatta agacctattt gggggcctgt      2400
     tcacagtact gaggttagaa ctgcctcata ctccagaatt tctgtcatgg ctgaggcctc      2460
     ttcaagctct tctccctcta caactccagg tatcttaagg cccaccttca agcctatctt      2520
     tggcagtata gaaccgcttc aaactatgtc tgagacagct cctgtgcaca ccaggcagcc      2580
     ctcttcttca ctgagttctg attctaccca tcttttccac agcctagcca ccacagcccc      2640
     ctgtgtggtt acgtctgtca ttccagccag caaatccaaa gaccctggtg tggatttgaa      2700
     catagtgacc agcaccacag gcaactcttg ctctgtccct tcttgcagca ctttcctgct      2760
     tggagcttcc cagaactttc cctcggccac tgatttaatt ttcccttccc aacaccccac      2820
     aattcccact gtacacacgg tcactatctt tagccaggtt cttactagtg ccatcaagat      2880
     atcccctctt agaagcactg atacactgaa gggggtgagc aaccctctgg caactttggg      2940
     cttatcgtcc acaaaccagc ctccagtgac ctcaagcaac tccaatgtga cttcagcact      3000
     cacatcatct ttggggtcaa gcccaaagcc acttttgcca ccatcccaaa gaaatacttc      3060
     tcaaagctca cctggggcca tagatgggct aaagcaatct tctctccagc tagctcctgc      3120
     ccaaagcttc agtacctctt tcctttcaga gaactcaggt gtgtctccaa ccccatctgc      3180
     tcaactggtc cttagcaaga ccacacagcc agcttgtggg cagttgacat cgtcagctcc      3240
     cattattcac actcctgcca ccagtcagac aggctttggc agcactctgg ctgggtttcc      3300
     attcggcaaa gctagttcaa ctgcccttag ggttatcagg cagaaccacc agagtgtgac      3360
     ctacagttca gtttttggca gcacagcccc aagacctttt gcttttggag gattagtgat      3420
     gcctatggat tgtggggagc ctgaggtcat tgtggctgcc cccaaaagga gcacttctgg      3480
     cacaagacag agtatgaccc caagcaccct agctcccttt gtgcaatgct ggaaccagag      3540
     tatgcagggc cctcctaacc agatcacacc tttggctggc attcctgcaa gaaagatcat      3600
     gtctggggcc ccctccctgg tcccctttgc tcagagtatc cctgtacctg gagcaattaa      3660
     ggcaggtagc agtcttggct ttgggatgtc ctctcccact gttcagggtt ctgtggggag      3720
     aaatcctttg agatcattgg aaccttcatt ctgtattggt acaaaatcaa aaacactaag      3780
     gaaccgagag ccagggcgct cccggaaaca tcacacttac aagaaatagc ccactctctc      3840
     tgtcacactg caacagagtc ttgatctctt ccaactctct ataacaaaca tacctaagac      3900
     caaaaagtga aagctatagg tgttcccttc atgtgtcata atctaagtct tccaagaagg      3960
     taaaccacca gtacgtcatc aagtgctggc aaag                                  3994
//


spacer
spacer