spacer

EBI Dbfetch

ID   AK220401; SV 1; linear; transcribed RNA; STD; MUS; 4466 BP.
XX
AC   AK220401;
XX
DT   01-MAR-2005 (Rel. 83, Created)
DT   08-NOV-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus premature mRNA for mKIAA1543 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4466
RA   Okazaki N., Kikuno R.F., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (22-FEB-2005) to the INSDC.
RL   Contact:Hisashi Koga Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
XX
RN   [2]
RA   Okazaki N., Kikuno R.F., Ohara R., Inamoto S., Nagase T., Ohara O.,
RA   Koga H.;
RT   "Prediction of the Coding Sequences of Mouse Homologues of KIAA Gene. The
RT   Complete Nucleotide Sequences of Mouse KIAA-homologous cDNAs Identified by
RT   Screening of Terminal sequences of cDNA Clones Randomly Sampled from
RT   Size-Fractionated Libraries..";
RL   Unpublished.
XX
DR   MD5; 3d705de2326231a6db5adee4ad6b655e.
DR   Ensembl-Gn; ENSMUSG00000044433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057028; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4466
FT                   /organism="Mus musculus"
FT                   /mol_type="transcribed RNA"
FT                   /clone="mfj19328"
FT                   /tissue_type="fetal brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             join(<99..2630,3903..4328)
FT                   /codon_start=1
FT                   /gene="mKIAA1543"
FT                   /product="mKIAA1543 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q80VC9"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014797"
FT                   /db_xref="InterPro:IPR022613"
FT                   /db_xref="MGI:MGI:1916947"
FT                   /db_xref="PDB:1UGJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80VC9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD90256.1"
FT                   /translation="LLTSLSSCPQIRYRKDRAIARRAPCFPNVTTLQDLASGAALAATI
FT                   HCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASHLPRGCPLSLEDLLYVPPPLKV
FT                   NLVVLLAEMYMCFEVLKPDFVQAKDLPDGHAVSPRNTETVPSQNNSGSSSPVFNFRHPL
FT                   LSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDV
FT                   VMGDPVLLRSVSSDSLGPPRPVSTSSRNSAQPAPESGDLPTIEEALQIIHSAEPRLLPD
FT                   GAADGSFYLHSPEGLSKPPLSPYPPEGASKPLSDRLNKAPIYISHPENPSKSSPCSTGE
FT                   ILKPPPPSEGSPKAVASSPAANNSEVKMTSFAERKKQLVKAEAESGLGSPTSTPVAPEA
FT                   LSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREAAGEAEEEAE
FT                   LGSVPGGERPAGEGQGEPSLRHKSVTFSPDLGPVPPEGLGDYNRAVSKLSAALSSLQRD
FT                   MQRLTDQQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSPARRAPAARRSPGPGPS
FT                   PTPRSPKHARPAELKLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLSEGTPP
FT                   EEPTTKPALIEIPLASLGEPAADEEGDGSPPGAEDSLEEEASSEGEPRSGLGFFYKDED
FT                   KPEDEMAQKRASLLERQQRRVEEARRRKQWQEAEKEQKREEAARLAQEAPGLAFTTPVV
FT                   ASAAPVATLAPTTRAMAPAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRPRASGTG
FT                   GPGRGGRRATRPRSGCCDDSALARSPARGLLGGPRLYKEPSAKSNKFIIHNALSHCCLA
FT                   GKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVT
FT                   PAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGGGTPK"
XX
SQ   Sequence 4466 BP; 1025 A; 1317 C; 1199 G; 925 T; 0 other;
     ggctctgggg atctgagctt cccacccctt catggcagaa atcccagttt tccctattcc        60
     agcctgcatg actgccaacc cggatatggc cagcctgact gctaacctca ctctcttcct       120
     gtccacagat tcgatatcgc aaggaccgtg ccattgcccg aagggctccc tgctttccaa       180
     atgtgactac ccttcaggac ctggccagtg gggcagcact ggctgccacc atccactgct       240
     attgtcccca gctattacga cttgaggagg tgtgcctcaa ggaccccatg tctgtggcag       300
     acagtctata caacctccag ctggtgcaag acttctgtgc ctcccatctt cctcgaggct       360
     gccccctgtc ccttgaagac ttgctgtatg tcccaccacc cctcaaggtc aacctggtgg       420
     tgctgttggc tgagatgtat atgtgctttg aggttctgaa gcctgatttt gtgcaggcca       480
     aagacttgcc tgatggacat gctgtctccc cccggaatac agagactgtt ccatctcaga       540
     acaacagtgg cagcagttct cctgtcttca acttccgtca cccacttctg tcacctggtg       600
     gtccccagtc tccactccga ggatccacag gctccctgaa gtcctctcca tcaatgtctc       660
     acatggaggc tcttggcaaa gcctggaacc gtcagcttag ccgtcccctc tcccaggctg       720
     tgtcgttcag cactcccttt ggcctggaca gcgatgtgga tgtcgtcatg ggagatcctg       780
     tcctgctccg ctccgtcagc tcagacagtc tgggtcctcc acgtcctgtg tcaacatcat       840
     cccggaattc tgctcagcca gccccagaat ctggagacct acccacgatt gaagaggccc       900
     tgcagatcat tcacagtgct gagccccgac tgctccctga tggggctgct gatggcagtt       960
     tctacctcca ttctcctgag ggtctctcca aaccaccact ctccccctac cctcccgaag      1020
     gagcctcaaa gccgctgtct gataggctca acaaggcgcc tatctatata tcacaccctg      1080
     agaacccttc aaaatcatct ccctgctcaa caggagagat actgaaacca ccacccccat      1140
     ccgagggttc ccccaaagct gtggcttcat ccccagcagc caacaactcc gaagtgaaga      1200
     tgaccagttt tgctgaacgc aagaaacagc tggtgaaggc tgaggctgag tcaggattgg      1260
     ggtctccaac atccaccccc gtagcacctg aggccttgag ctcagagatg agtgagctgg      1320
     gagccaggct ggaggagaag cgccgagcca tagaggcaca gaaacgacgc attgaggcaa      1380
     tctttgccaa gcataggcag aggctgggca agagcgcttt cctgcaggtg cagcctcggg      1440
     aggctgcagg ggaggccgag gaggaagctg agctgggctc agttcctggt ggggaacggc      1500
     cagcaggtga gggccagggt gagccgtcct tacggcacaa gtcagttacc ttctctccag      1560
     acctgggccc agtgccccca gagggacttg gggattacaa tagagcagtc agtaagctga      1620
     gtgccgctct gagctctctg cagcgggaca tgcagaggct cacagaccag caacagcggc      1680
     ttctagcccc tccagaagct cctggacctg ccccaccacc tgcagcctgg gtcattcctg      1740
     gacccgccac tgggcctaaa gcagcatccc ccagccctgc ccgtcgtgcc ccagctgccc      1800
     gacgcagccc tgggccaggc cccagcccaa caccccgtag tccaaaacat gcaaggccgg      1860
     cagagctgaa gcttgcacct ttgacaaggg tactcacacc accccatgat gtagacagcc      1920
     tccctcacct acgcaagttt tcacccagcc aggtgcctgt acagactcgc tcctctatcc      1980
     tcctgtcgga ggggacacct cccgaggagc ccaccaccaa gcctgccctc attgagatcc      2040
     ctctagccag cctgggggag cctgctgctg atgaggaagg agatgggagc ccccctgggg      2100
     ctgaggattc cttagaggaa gaggcatctt ctgagggaga gccccgatca gggcttggat      2160
     tcttttataa ggacgaagac aagcctgagg atgagatggc tcagaagcga gctagcctgc      2220
     tggagcgtca gcagaggcgg gtagaggaag cccggcggcg caaacagtgg caggaggcag      2280
     agaaggagca gaaacgggag gaggccgcca ggctggctca ggaggctcca ggcttggcct      2340
     ttacaactcc tgttgtagcc tctgcggctc cagtggccac cttggctcct actaccagag      2400
     ccatggcccc agctgaggag gaggtgggcc cccggcgggg ggacttcaca agacttgagt      2460
     atgaacgccg ggcacaactg aaactgatgg atgaccttga taaggtgcta cggccccggg      2520
     cctcagggac cgggggacca gggcggggcg ggcgcagggc cacccggcca cgctctggtt      2580
     gctgtgatga ctcggccttg gcacgaagcc cagcccgcgg cctgctgggt gaggaccctg      2640
     ttggaggggc cctatgattg tggagagagg gagtgtctgg tggcatgcag tgatggggca      2700
     ggaatttgga gtgggcatga gttccagtgt ggtgagggta acttccttcc ttggctggat      2760
     agtgaggaac tctcttggat atttgaggat gctactaaac agtgctccct tccctgtagg      2820
     tatgtggaca agaatgccaa actcagggct gggtttgtct ggaatggatg aggccctggg      2880
     ttaaatccca gagctgtata agaaaaattg ccatattaag gtagacaggt tggcacatgc      2940
     ctgtcattgc gatactcagg agtctgaagc aggaggattt tgagtttggt cctaaactgg      3000
     ctgttgagca gcttctctgc ccatttaggc tacaccttga ggtcctgcac caaacactga      3060
     aactaaggac acataaacac acacacacac acacacacac acacacacac gaataagttc      3120
     agagtggtgg tggtggctct tggtagagta cttgcctacc ctagcgtaca cgaaacttca      3180
     ggttccatcc ccagttttaa ccaggaatgg cagttatagg cctataactc cagcactgag      3240
     aaagtagaga ctggagactt ggtcatcctc aacaaatagg aagtttgagg ccagcctggg      3300
     ctatagaaga cccatcttta aaaagtaaaa gccagactgg agaaacgact cagtggttaa      3360
     gagcacctat tgctcttcca gaggtcccga gttcagttct tagcaaccac atgtgaccga      3420
     ctcacaacca tctgtaattg agtccagtgc ccccctctgc tgtcataaga cagatactcg      3480
     tataaataaa caaaacttag caggcaatca cgaaaggctg agagggtctc gggaatgccc      3540
     atgggcgtta atggaggtaa aggccttagg gataactgac tggtactgtc tatcctaggt      3600
     tcacggctca gcaaggtcta ttcccagtcc acgctgtccc tatctacggt ggccaacgag      3660
     gctcccaata accttggtgt gaagaggccc acctctcggg ccccttctcc atcaggcctc      3720
     atgtctccaa gccgcctgcc tggcagtcga gaacgtgact gggagaatgg aagcaatgca      3780
     tcctccccag catcagtgcc tgagtacaca ggtaagtgag accgggtaat gttagaagct      3840
     acgcgttctc tacctgcctt tccccaaccc acgcccagtc tctgctgact gactgccctc      3900
     caggtccccg gctatacaag gaacccagcg ccaagtctaa caagtttatc atccacaatg      3960
     ccttgtcaca ctgctgcctg gcaggcaagg tgaatgagcc ccagaagaac agaattctag      4020
     aggaaatcga gaaaagcaag gccaaccact tcctgattct ctttcgggac tcaagctgcc      4080
     agttccgggc cctctacact ctgtctgggg agacagagga gctatcgagg ctggcaggct      4140
     atgggcctcg gaccgtcact cctgccatgg tcgaaggcat ctataagtac aactcggatc      4200
     gcaaacggtt cacccagatc cctgctaaaa ccatgtctat gagtgtagac gccttcacta      4260
     tccagggaca cctttggcaa agcaagaagc ccaccacgcc caagaagggt ggcggtaccc      4320
     ccaaatagtg cccaccttgg gcagtgcact cctgggtcct gtctggtcat gctgtggggg      4380
     gctgagctgg gagcttcagt gactcagggc tcagctcagt ccccttgtct gtcctccact      4440
     ttcttgaata aaataactga aaagag                                           4466
//


spacer
spacer