spacer

EBI Dbfetch

ID   AC144611; SV 2; linear; genomic DNA; STD; HUM; 12965 BP.
XX
AC   AC144611;
XX
DT   04-MAY-2003 (Rel. 75, Created)
DT   09-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Homo sapiens fosmid clone XXFOS-89066G9 from 2, complete sequence.
XX
KW   HTG.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-12965
RA   Waterston R.H.;
RT   ;
RL   Submitted (03-MAY-2003) to the INSDC.
RL   Genome Sequencing Center, Washington University School of Medicine, 4444
RL   Forest Park Parkway, St. Louis, MO 63108, USA
XX
RN   [2]
RP   1-12965
RA   Waterston R.H.;
RT   ;
RL   Submitted (12-MAY-2003) to the INSDC.
RL   Genome Sequencing Center, Washington University School of Medicine, 4444
RL   Forest Park Parkway, St. Louis, MO 63108, USA
XX
RN   [3]
RP   1-12965
RA   Wilson R.K.;
RT   ;
RL   Submitted (14-JUN-2003) to the INSDC.
RL   Genome Sequencing Center, Washington University School of Medicine, 4444
RL   Forest Park Parkway, St. Louis, MO 63108, USA
XX
RN   [4]
RP   1-12965
RA   Wilson R.K.;
RT   ;
RL   Submitted (19-JUN-2003) to the INSDC.
RL   Genome Sequencing Center, Washington University School of Medicine, 4444
RL   Forest Park Parkway, St. Louis, MO 63108, USA
XX
RN   [5]
RP   1-12965
RA   Wilson R.;
RT   ;
RL   Submitted (09-JUL-2003) to the INSDC.
RL   Department of Genetics, Washington University, 4444 Forest Park Avenue, St.
RL   Louis, Missouri 63108, USA
XX
RN   [6]
RP   1-12965
RA   Wilson R.K.;
RT   ;
RL   Submitted (08-APR-2005) to the INSDC.
RL   Genome Sequencing Center, Washington University School of Medicine, 4444
RL   Forest Park Parkway, St. Louis, MO 63108, USA
XX
DR   MD5; 9e1eb5e47e91e9501ab6ebebd66e2a55.
DR   ENA-CON; GL000029.
DR   ENA-CON; GL582966.
DR   Ensembl-Gn; ENSG00000168280; homo_sapiens.
DR   Ensembl-Gn; ENSG00000262907; homo_sapiens.
DR   Ensembl-Scaffolds; AC144611.2:1-12965; homo_sapiens.
DR   Ensembl-Tr; ENST00000397413; homo_sapiens.
DR   Ensembl-Tr; ENST00000414838; homo_sapiens.
DR   Ensembl-Tr; ENST00000435030; homo_sapiens.
DR   Ensembl-Tr; ENST00000450621; homo_sapiens.
DR   Ensembl-Tr; ENST00000573697; homo_sapiens.
DR   Ensembl-Tr; ENST00000574197; homo_sapiens.
DR   Ensembl-Tr; ENST00000575453; homo_sapiens.
DR   Ensembl-Tr; ENST00000576072; homo_sapiens.
DR   GOA; C9JWB9.
DR   GOA; E9PET8.
DR   GOA; O60282.
DR   HGNC; HGNC:6325; KIF5C.
DR   InterPro; IPR019821; Kinesin_motor_CS.
DR   InterPro; IPR027417; P-loop_NTPase.
DR   InterPro; IPR027640; Kinesin-like_fam.
DR   UniProtKB/Swiss-Prot; O60282; KIF5C_HUMAN.
DR   UniProtKB/TrEMBL; C9JWB9; C9JWB9_HUMAN.
DR   UniProtKB/TrEMBL; E9PET8; E9PET8_HUMAN.
XX
CC   On Jun 14, 2003 this sequence version replaced gi:30349113.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12965
FT                   /organism="Homo sapiens"
FT                   /chromosome="2"
FT                   /map="2"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="XXFOS"
FT                   /clone="XXFOS-89066G9"
FT                   /db_xref="taxon:9606"
FT   misc_feature    1..513
FT                   /note="Sequence derived from PCR product of project DNA."
FT   gene            3214..8692
FT                   /gene="KIF5C"
FT   mRNA            join(3214..3320,7542..7590,7867..7922,8605..8692)
FT                   /gene="KIF5C"
FT   CDS             join(<3214..3320,7542..7590,7867..7922,8605..>8692)
FT                   /codon_start=3
FT                   /gene="KIF5C"
FT                   /product="unknown"
FT                   /note="Homo sapiens kinesin family member 5C (KIF5C),
FT                   mRNA.; H_AA089066G09.1 This gene was based on gi(4758649)
FT                   Continued from H_NH1415G13.1 Continues as H_AA084633A03.1"
FT                   /db_xref="GOA:Q57YV5"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="UniProtKB/TrEMBL:Q57YV5"
FT                   /protein_id="AAX82035.1"
FT                   /translation="GKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDK
FT                   IRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVT"
XX
SQ   Sequence 12965 BP; 3722 A; 2578 C; 2598 G; 4067 T; 0 other;
     ataaacacac acagacatat atatcacaca catacagaca caccacataa catactgcac        60
     acgcatacat catacacaca cagacatata cacatcacac acatatgcac acacagacac       120
     accacacatc acataccacc cctccacata catcatacat atacacacag atatatacac       180
     accacataca aacacaccac acaccacaca ctatatacca cacatgaccc ctacataaca       240
     tcataaacat acagagatgt acacatcaca cacatccata tagacacgca taccacacac       300
     tatataccac acccccacat acatcataca cacacagaca taccatatac cagataccac       360
     acattgtatg gcataccccc tacatacaca cacacagaca caccacacac acagagacac       420
     cccccacata tacatgcaca catacaggca gaacccacat atatcacaca cacaacacac       480
     acgcatacac acacacacac acacactctg catacatcat acagacacag acaccacata       540
     tcacacatat acaatacaca cacgccacag aatgccacac agccacacac atcacaagca       600
     cccccacact cgccacactt cctacattca cgctatagca catacctgca cacattccct       660
     acgtccatct cacacacata taacccccac atcacacata tatgtaatac tccacataca       720
     tcacacgccc ccacacacgc agacgtagcc ctcacacccc acacgtatat cacacacaga       780
     catatactac acacatcaca catccatatg ctcccctaac actacacaca cacacacacg       840
     tgcacactcc acatgcccct acatcctccc ctgcgtacac acacctgcag attgtttcgg       900
     caggcccagt ttgctgcaca taaagccctt accactcttg ggcatctgag ctggatcaag       960
     cagcccagct cctaggcctg tggtagatgt gggtatgctt ctgttcctgt ggggatggga      1020
     ggcattatta tgagaacact cacttttctc acattgattt tagggtgagg acttcagaga      1080
     gacacaaagt agagagtgtc ctagattcat ctctcgttct gccttggttc ttgccctgac      1140
     aaaggcaaac aaagagatgt cagcacttgt ataagccagg aatcaatggg gagataaatc      1200
     cattgaaagg gaaagcatct aggaaaatag atttgagtca attataaatg atttttggat      1260
     tatcaatcgt tcttctctgg ctgtgggcta ctgaggagaa gctaaaggat tatcatgaat      1320
     tattaaaaag ctctggaggg ctttggtagg ggaggtcttt tgattggctg agtggagtca      1380
     tgacatttgg ccagatggaa atgatgttct caccataggt attgtttctg ccaatgatct      1440
     ccatggttca gagcatgtgg aggtccattg tctaatttgt tacacattta tgatggaatg      1500
     tacagtttaa aagttatcaa gatttgagat tgtcagtcat ttggcactgt tttctttcct      1560
     aagatatata ttaattgtca gggatagaaa tgtgtttcag tctcttcagg tgaaataaac      1620
     tgcaataatt tcttcgtgaa aacctgctgt gagctgagtg atataatact aacatttatt      1680
     ttagcccttc tcatgtcact aagcacttta tatatcctat ttaacttgaa ttctacaata      1740
     attctatgta ataaatacta aatcttgtaa gcaatggaga gaaatataca tgcactggcc      1800
     atccctatct ttaggaagta tgcagtcaaa ctaaaaaaca agagcaatac atcaaactat      1860
     ttagattctt aatagataag ggcattccag aggagtatcc atttttccgg atgagagagc      1920
     tttgctggag gccagactgc cggacgtggt ggctcatgcc tgtaatccca gcactctggg      1980
     aagccaaggt gggtggatca ctttgagctc aggagttgga gaccagcctt ggcaacactg      2040
     cgaaacctca tctctacaaa aaatacaaaa aattagccag ctgcggtggt gcacacctgt      2100
     agttccagct actagggaag ctgaggatca cttgagcctg ggaagtggag gttgcagtca      2160
     gctaagactg caccactgca ctgcagcctg ggcaacagag tgagaccttg tctcaaaaaa      2220
     caaaaacaaa caaacaaaaa atctggaaaa tctctggatg tgttgttggc actgatcact      2280
     ttaaacctgc agactgtgtg tttgttcact gatggattgt tgaacacata tgagaactta      2340
     agtgcttatt tgacggtggg cttaggcaaa ggctctctgg agcttgtgtg ttgctttcaa      2400
     tacttctgga agtcttcatt aggagttgct gtcagatcct aaggcatctt ttctaaaatc      2460
     ttcaggggtg gcaaattctg gaccttaaaa atggatttgg taatatccaa atagcagaag      2520
     aatttaccta tccctatccc cacccactta ggtgaaatga gtaaagtaga aaagcgggga      2580
     aagaagaata taagacgatc ttaaacatgg atttaggtat tagaaacagc taaaaattat      2640
     ttggaacaat ttggcctggg aaccacagat ttttaaaaga agttgatgaa atgtattttc      2700
     ttgattgatc tgttaaatga tactgaaagt gttgccagaa taaggttctt agaaattttg      2760
     gaaaattttg gaaatcagtt ctagaggtga tttcattaaa caagattgcc ttacttggaa      2820
     ctccaggctc aggtcagttt gtaaatactc aaaacccaaa cccatatatt ctcgttcctt      2880
     ctcctgctcc cttttcctcc tcctcctcac cccacactag ccacatagac tctgattttg      2940
     tttccttgag tggcagctgg aggcaataat gtggggcctc agaacttggc agaacaagtg      3000
     ctcccctgct ggataaacag gccaacacaa tgagtttttc caccaacttc tggtctgttg      3060
     gcaagtcagg tagatgccca agggagctgg caggcacacg tgggtgcttc ctgctccacc      3120
     gggttctgtc tgaggaaccc agagatggtt ctccctctct ctcatgtgtc tcccagcatg      3180
     ctttaactgc ccgtgtttgt attttcgccc actaggggaa gctgcatgac ccccagctca      3240
     tggggatcat cccacgaatt gcccatgata tctttgacca tatctactcc atggatgaga      3300
     acctggagtt tcacataaag gtacgtatta ctgattggtc cccagagaag acactgggcc      3360
     ccagataacg tttcttatac ctcctccttt caagaagata taaaagatga tcctactaat      3420
     ttaaatgaca ttcttgtggt aagcagagcc ctctttatta gtgacctagg ctaacaggtg      3480
     tctggagggt ttgcttgaaa tatccacata atgaaagcaa aagccttctt taggaggaaa      3540
     tcatcttgat tgttgcccaa attctaccct ttatcctctg gatttctgtg ggtatgactg      3600
     aaatgtgttt gtgtttgggt tagggcagca ttttccaaag tgtgttctgt ggaacacagt      3660
     cccttgtgtt attaatggtg ggctagcagg gaaaagggct gtaaggccaa atgagctggg      3720
     aaaatgcttt cttgaacagt gttaagttta tcacaggttt caatatgctc tgcaaagggg      3780
     acatgcatta gattacattt cccagcttat ttgaatgtag acacatttct cctcctaaga      3840
     gtatcacaga cttgtgtttt gagcagagtg tcacagagca gaactctgag aaatgttggg      3900
     aagaggaatt ctcttccttt ttatcttccc ccttgtattt tgtttttgtt ttaaaccaaa      3960
     acttgttata tgacttaaat tggcattaaa agagagattt ctactctctt actgtagctg      4020
     ttaaataatc aaatttgata gtagggtata ttcattggaa cacctctttt gcaagtggct      4080
     gaaaggcact tgtttaagca aatagaggat attgtttata agatacagaa tctgacagtg      4140
     ggcattttgt ggaggatgaa gtgtggaggg caggaaatct aagccctgtt tttcttttta      4200
     aactttttaa acaattgaga tattgttcac ataccgcaaa attcatcctt ttaaagtgta      4260
     tagtttgatg gtttttaata tattcccaaa agtgtacaat gatgatcctt atcctaattc      4320
     ttgagcatat cgtcacctcc aaaagaaacc ccaaacctgt tacagtccct gcttttctgc      4380
     ccccttgctt gacttctttc tcttgttctg gagcatcttt ctctcttttt ggtgggagaa      4440
     ggggttggca acatggcagc tgctgctcca ccattccctt atttccaact ctaaattccc      4500
     ttgggcaggg actcattggc ccagcctaca taggtgcccc ccttgcccga tgagctgtgt      4560
     ccaggatgca catgctgtct gggggccccc actgtggctg gggagggtga aggggcagtt      4620
     ctaagaagcc tcgctaagca gatctgctaa gagatttccc ttcaggctgg gatcttagtg      4680
     caccaggccc atctgttcag agatgaggaa acggaagttt aaagatgcag ggttaggctg      4740
     ggcacagtgg ctcagacctg taatcccagc actttgggag gttgaggcgg gcagattgcc      4800
     tgaggtcagg agttcacgac cagcctggcc aacatggtga aaccctgtct caactaaaaa      4860
     aaaaaaatac aaaaaaagta gccaggcatg gtggtgtgtg cctataatcc cagctactca      4920
     ggaggctgag gcacgagaat cacttgaacc tgggaggcag aggttgcagt gagctgagat      4980
     cactccacca cactctagcc tgggcgacag agagagattc tgtcttaaaa aaaaaaaaaa      5040
     aaaaagacgc agagttacaa ggcccaactt aaacaccaag ttattgataa aactaagaat      5100
     agaccctagg tctgaccaac cgcacatgcg ataccttttc aattatatta aacttctccc      5160
     cttactactg tatacctttc gtaaatgaca taaaaagaag gcaccaactg tttgcccaac      5220
     tataaattac atctagcaaa tcacttttcc ttaggattcc ttttgttggc taaagcctgc      5280
     ttctccttct tgccaaggtt ctttatatct aaggatacag aagcttgttg ctttgatggg      5340
     atcaagattt agaagcttag tgcttcttta gggctgtttg catttaaata gcttaaacta      5400
     ctgcagggtt cttatgtgat aatcctggaa taagatgtta aaccaattac tgccctcaaa      5460
     atagggtctt gtgttagaat cttattaaga taaaaacagc cctagcatga agttagggga      5520
     ggagaggaac aacactctta agtctctagg gctgaatttt acagtctgga tttctgtgtt      5580
     gcatttgtac ttatgcttac ttgttttata aataataagt gggcaaatta gttgctgact      5640
     actttgtatt ctgaaccgga tagtgagagg ctaaatcaag aaaaagagga ctgactaagg      5700
     caatatcgaa aatctgctcc ttaaatgagt cccacagagg ttttaaactt tatttctgaa      5760
     cgtcctattt cttaatgcca aacaatgcct atttattttt cttccgccta gtctcacaaa      5820
     gtattttaaa tgacaaaaca acaaaatcac caccctcgca cacacaccaa aagcagaaat      5880
     taatgaaatc agaatcctgt ttctacttac attaaatgtg aatatgattc taattgccag      5940
     atttgccagt atctagtttg tgactttttt ttagatgtaa ttaattttct ctgtaatcta      6000
     tggaaataag gccatatgtt taagatctca aaaataatag acaagtctta atgaacatca      6060
     gacaattctg aaataaatag aatgcgctga accagggtgg agttggctgc aggaaggact      6120
     gggttagaga tgtccaggat tggaggtcag acagacccat aaggatgtgg ggagtgtggc      6180
     agcatgaaag attagagaaa gctgtaggcg tgagtctttc aaatgtcaca taagtgtgtc      6240
     catgagagat gggcctcagg gacagggaag tctgacaggt gttcaagtag gcagatgttg      6300
     ctagggatac aggcagccag gagagatgcc cagcagtgga ttccagggct caagctagga      6360
     ccccacatct cagagtagct gggatggttc cagtcaggta gttccagacc gaggcacatt      6420
     aaggataatg gatcagggct gagtcagagc tgggaccagt gctgggttag agtctttgct      6480
     tccccttgac tggtccagag ctgggatgta gggatgaggt tttacctgag tagtcacatc      6540
     ccagctttac aactttacaa ctgttttcct ttctgcccac tcccttgttt agatttcaaa      6600
     agcacttatg aacatagggc agataagttt attgggtagg cagacagcag atgtaaacag      6660
     agtacagaat cctagagggg gatttttgac atcgtaaagc cctatggctt catgtgacag      6720
     atggtacaat tgaggcctag ggtcttggtt atgtgtgaat tgagtcccta agaccacata      6780
     tttagttaaa gcaggtctca gacatcagcc agcataagaa tcgcctgggc aactgagaac      6840
     cagattccta gttcctttta tctgggattc ggattcagca ggactgtagt agggttcagg      6900
     gttctgcagt tcaaacaggt tcttaggtga tgctgatgaa ggtggtgctg tggctgagcc      6960
     ttgagactaa tgggaaggcc tccttttctt ctcacagtct aaccatcttt tatcaagtcc      7020
     cattttgttc agatctttcc tggatgcacc agagctggcc accattacca gctcttgctc      7080
     agttaccttt ctgagctctt gtagttctaa acacactgcc cttgccctct cctggcttct      7140
     tgcatgtgaa catttgggct aagtctcctt catgatactg tcagtatcat gcaataaggt      7200
     gaggcctact gagtgttttc taagcgtgct tggtgctcat ctaacttaaa gcctagagtc      7260
     ctcctgtaag tgtctagcac atgatgttaa gaacacttga atgacaacca aagggagctg      7320
     tgatgtgtgt aggtggagag tggtccacac ttagggaagc gtagagcaag cgggaagtag      7380
     gggaatccca gtagagctgg ccagatttta agtcttcact ttgaacccct cttcttactc      7440
     ttcttagcca tgcatgatga aagctttcat aagtactaat aatggcattt ttgaaataca      7500
     ctgcggcatg tctattccaa gctcaatttg tttttaacta ggtttcctat tttgagatct      7560
     acttggacaa aataagggac ttacttgatg gtaagtaacc tcagtgcttg tcctttattt      7620
     gttctgtaac gaaagtccgg ggaggttgaa atggtttatc acacttctgc ttaaggaatt      7680
     aatgaaaatt tatagagata ctctgttgcc ttcagggtat atgtttattc tcagccaagg      7740
     cttaaacttg catattgcaa agagattaga tttgactgtc tttgtaacaa acttccattt      7800
     ttcctccaat atagagtctt taacttttat tttcttcttt gcctgctgtc attctcatct      7860
     ttttagtatc caagaccaac ttggctgttc atgaagataa aaacagagtc ccgtatgtaa      7920
     aggtatgagg aagatttgat tggtgatgca attaatttct ctccagtctc tgtcataata      7980
     attattacat aagatgtgca gaatattatc tgtaaagagc atataggcat ttattcaggc      8040
     tccttatatt taatattcat ctggttttaa aaattgacat ttactttctt caattgtatc      8100
     tttcctttat gacattatta tttaatattg ttcacattta aagagatttt gatattgagt      8160
     gcaactgttt ttactttgca gtaacgccta ttatagcatt atctgtggaa catcaaagta      8220
     gctaatattg gtggccatga tcataaataa ataaagatag aaggcaaagc aaaacttcat      8280
     ccatttcttc ttctctcatt gattttcttc tttgattttc tgtcttctta aagtgttgct      8340
     gttcagtatg aatatgtact caaaaaccta ggaaaatttg acagttcttt ttttggttta      8400
     cgtctatatt tcctagggct tgctcagact tctctttaat gtagaattca agccctgggc      8460
     aaggaggaaa agttgttgga tcgatatttc agcctttcta tttatctgca cctctagaag      8520
     ataaacagga aaatgtttca gcctttcaaa atattgttgc ttttcaactc tttcagtggt      8580
     gaacctgaac tgattctctt ccaggggtgc actgagcggt ttgtgtcgag ccctgaggaa      8640
     gtcatggatg taatagatga aggcaaagca aaccgacacg tggctgtgac aagtaagcat      8700
     ggtgggggtg tttcctcccc tgcagcttgg gagacagata tctgcccacc aaccgagggg      8760
     ggtggggaat taggtacaaa tgaaagaatg catgggaagg tgattaaaga gcagtgctcg      8820
     gacacagacg ccagggtatg tgtgctatga gtatgtctag gcagtcatgg gaaagggtgc      8880
     cttctgctgt ccacaggact ctgaggtctt ggagatattg ggtgagactt actggaccct      8940
     gataacagcc taagcctgaa cattaggaaa aataaacaac cagccaacca aagggaggga      9000
     aagagtaagc tcatcagttt atttattttg atcatgttat tgttcaggtt aaaaaaaagt      9060
     tccaaaccaa caaattctat aatatgttgc agtcacacac atggaaataa accatgttgg      9120
     atttctgcct tctgtaaaaa agaaaaagaa agggaagaag gaagtcagaa agcagagcca      9180
     ggagctttag ggaaagcctt ccgatatgtt actagcagac acattcagat cggctcattg      9240
     gctctgcagt tccttcctca gtatgttcat tgcatctcag ggaagcagtg catatgggat      9300
     ttgggcagca gaggatccgt gaaaaaagac agttgtctat cttattaaga gggatgtgga      9360
     caaatgacag tgagttcata tgaacagaag ctgagagaac taagggttta tagcttgcat      9420
     gagggaaaaa aatctggagg agggtgtgtg gacaatgtaa tatatcttac cgtgttgaag      9480
     gtgctgacac taagaaagag ggtcagcttg ttctgttcca tctcaatact tagaataccc      9540
     atgattgttg gagctctagg gaggcagatt tcgacccctg tgaggagaac tctccaaccc      9600
     ttatagctgc cccaagtgct gcctgctacc tagagaggta gtgagttcac tgttatgttg      9660
     taaaagagat tcaggcattg gtttcctgac tggtctaggc tctttaagtc tcttctaccc      9720
     aagactctct gattctgtgg tccagaactg taattctcaa cattttctct atctgagcaa      9780
     tgtatcagat gatattcatg tatatagcaa ctttcatagg tgagcctatt cctggatgaa      9840
     atgttggtca agctccactt ctttttctct tgcttaaaac atgcacacat acctgaaaga      9900
     atgtaagaca gatattctta tagtagtagc atctctcatt tacgttattc actctgtttc      9960
     tgaagctgtt tttaatcaca aattatttat ggcatacctg ataatccatt ttgatgcctt     10020
     ggtttggaac tgctaatcta aaaaaaaatt gctattattc ttatcattct ggtaaggttt     10080
     ttctttatta ttgcaataaa atatacttaa tatgaaattt gccatcttaa ccattttaaa     10140
     gtgtgcattt atgtgatgtt aagtaccttc acaatgtgtg caatgtcacc accttccatc     10200
     tctagaactt tatcttctcc aaccaaaact ctgtacccaa taaacaccaa ttctttattc     10260
     tcctcttgct caacctactt tatctctatg aatttgactg ctctaggtac ctcatgtaag     10320
     tggaatcata aagtgtttgt ccttttgtga cttatttcac ttagcataat gtcttcaagt     10380
     ttcatccatg tggtagcaag tgtccttcct ttttaaggct gaacaatatt ccattgtatg     10440
     tatatacaac atttaaaaaa ttcgtttaac cattaatgga cgcttgggtg gcttccacat     10500
     tttggcagtt gtgaataatg ctgttatgaa cataggtgtg caaacatcta tttgagtcct     10560
     tgatttcaat tcttttgagt atatatgcag aagtggaatt ttcggatctc atggtaattc     10620
     tactttcaat ttcttgagga accgctacta tttgctatta ttacgatttt ctatagcagc     10680
     tgtaccattt tctattccta acagcagtac atcagagttt ccatttctct atatccttgc     10740
     cacttgttat tgttattatt tttataatag ccatccaaat ggtgtgaagt gctgtttcat     10800
     tgtggttttg atttgcattt ccctaatgat tagtgatgtt cagcatcttt tcatgtgctt     10860
     ataggccatt tgtatatctt ctttgaggaa tgtctattca aggtctgtat ttatttttta     10920
     atcaggttaa tttgttgttg ttgacttgga gttctctatg tattctggac atcaatccct     10980
     tattagatat atgatttata aaattttctt ctattccatg gattgctttt ttacactatt     11040
     gatagtgtct tttgatataa aagtttttaa ttttgatgaa gtgtctattt ttattttgtt     11100
     gcttgtgctt tgggtgtcat atccaagaaa ttattgccaa gtccaatgtc atgaagcttt     11160
     tctcctgtgt tttcttctaa gagttttata gttttagttt ttatatgtag gtatttgatc     11220
     cttttggagt aaatttttgc atgtactcta aggtaagggc ccaacattaa tatatttttt     11280
     gcatgtagct atccagtttt tccaacacta tttgttgaaa agactgttct ttccacatta     11340
     aatggtcttg acactcttgt tgaaaattat tcaaccatat atgtgaggat ttatttctgg     11400
     gccctttatt ctcttctgtt gatttatatg tctgtcttta tgtcaatacc acactgtttt     11460
     gattcctgta gctttgtagt aacttttatt ttttattttt ccataggcta ttggggtaca     11520
     ggtggtattt ggttacatga gtaagttctt tagtgctaat ttgtgaggtt ttggtgcacc     11580
     tatcacccga actgtatgca ctgcacccta tttgtagtct cttatccctc accctactcc     11640
     cacccttccc ctcaagtccc caaagtccat tatattgttg aagtgtgaga ccttcaactc     11700
     tgttcttatt tttcaagatt gtttaggcta tttggtatcc cttgagattt catataaatt     11760
     ttaggatgga tttttctgct tctataaaat atgtcattga aattttgata gagattgcca     11820
     tgaatctgta gattgctttg ggtaatactg acagcttaat gatattaagt ctttcaatca     11880
     atccctttat ttgtgtcttc tttcatatct ttcagtcatg ttttgtagtt tccagtgtac     11940
     aagtctttct cttctttggt taagtttatt cctaagtagt ttattctttt tttgctatta     12000
     taaataaggt tgttttctta attttttggg ttgttcattg ttagtatata gaaatgcaac     12060
     tgatttttta catgttgatt ttgtatccta cagctttgct gaattaatta ttagttctaa     12120
     cagtttttta aaaatgaatc tttagggctt tttacatata atctggtaag atggttttga     12180
     gaaatgattg ctggtgaagg ctgaatggga tggttgctgg ggtctctgtc tgcttggcag     12240
     acaaagacga ggatttgcaa ggatttttat ttccagtacc ccatcttaat gaagcatatt     12300
     taatttttga aaccttcttt gctgttagca taggttgtag aagtgtatgt cttaatcctt     12360
     ccttaggaaa gtcttaatcc ttgcttaaga aagcttatga tattactgat aaggcaaggc     12420
     ttatgcacat gactaagata gactacatca tgtattaatc atgatgaagt ctgaggaatt     12480
     taaagtgagg caggggagga ggtagtgaat tcttcaaggg gaaagtcatg ctggagtagg     12540
     aatttagagg atggggcttc aggtagagct agaaaatctg atatcttaaa ctgttgacta     12600
     agatttttag attaacttct ttgctccttg aagacattta aaatcttgta tttctagaat     12660
     gagcattgtt tttcagaaga aacaggggtc tcagataatt tttagaattg actggactta     12720
     cttcaatgaa atggatctat taggcatgac ttgttatgct ttttaaatga gaggattgct     12780
     acctaaacct acatgttctt tgtagagcag taaactattt tccttttcag acatgaatga     12840
     acacagctct agaagtcaca gtatcttcct gataaatatt aaacaagaga atgtagagac     12900
     tgaaaaaaaa ctcagtggga aactttattt ggttgatttg gctgggagcg aaaaggtaat     12960
     ttgtt                                                                 12965
//


spacer
spacer