Dbfetch

ID   AB062294; SV 1; linear; mRNA; STD; HUM; 1218 BP.
XX
AC   AB062294;
XX
DT   27-MAY-2002 (Rel. 71, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens OK/SW-cl.43 mRNA for ubiquitin-homology domain protein PIC1,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1218
RA   Itoh K., Shichijo S.;
RT   ;
RL   Submitted (24-MAY-2001) to the INSDC.
RL   Shigeki Shichijo, Kurume University School of Medicine, Department of
RL   Immunology; 67 Asahi-machi, Kurume, Fukuoka 830-0011, Japan
RL   (E-mail:shichijo@med.kurume-u.ac.jp, Tel:81-942-31-7551,
RL   Fax:81-942-31-7699)
XX
RN   [2]
RA   Shichijo S., Itoh K.;
RT   "Identification of immuno-peptidmics that recognized by tumor-reactive CTL
RT   generated from TIL of colon cancer patients";
RL   Unpublished.
XX
DR   MD5; 04284b9bd3dff6b39a416ccc7777250b.
DR   Ensembl-Gn; ENSG00000116030; homo_sapiens.
DR   Ensembl-Tr; ENST00000392244; homo_sapiens.
DR   Ensembl-Tr; ENST00000392245; homo_sapiens.
DR   Ensembl-Tr; ENST00000392246; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="SW620"
FT                   /cell_type="colon adenocarcinoma"
FT                   /db_xref="taxon:9606"
FT   CDS             125..430
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="OK/SW-cl.43"
FT                   /product="ubiquitin-homology domain protein PIC1"
FT                   /db_xref="GOA:P63165"
FT                   /db_xref="H-InvDB:HIT000059886.13"
FT                   /db_xref="HGNC:HGNC:12502"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR033950"
FT                   /db_xref="PDB:1A5R"
FT                   /db_xref="PDB:1TGZ"
FT                   /db_xref="PDB:1WYW"
FT                   /db_xref="PDB:1Y8R"
FT                   /db_xref="PDB:1Z5S"
FT                   /db_xref="PDB:2ASQ"
FT                   /db_xref="PDB:2BF8"
FT                   /db_xref="PDB:2G4D"
FT                   /db_xref="PDB:2IO2"
FT                   /db_xref="PDB:2IY0"
FT                   /db_xref="PDB:2IY1"
FT                   /db_xref="PDB:2KQS"
FT                   /db_xref="PDB:2LAS"
FT                   /db_xref="PDB:2MW5"
FT                   /db_xref="PDB:2N1A"
FT                   /db_xref="PDB:2N1V"
FT                   /db_xref="PDB:2PE6"
FT                   /db_xref="PDB:2UYZ"
FT                   /db_xref="PDB:2VRR"
FT                   /db_xref="PDB:3KYC"
FT                   /db_xref="PDB:3KYD"
FT                   /db_xref="PDB:3RZW"
FT                   /db_xref="PDB:3UIP"
FT                   /db_xref="PDB:4WJN"
FT                   /db_xref="PDB:4WJO"
FT                   /db_xref="PDB:4WJP"
FT                   /db_xref="PDB:4WJQ"
FT                   /db_xref="PDB:5AEK"
FT                   /db_xref="PDB:5ELJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63165"
FT                   /protein_id="BAB93477.1"
FT                   /translation="MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLK
FT                   KLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV"
XX
SQ   Sequence 1218 BP; 384 A; 206 C; 256 G; 372 T; 0 other;
     gaagttactg cagccgcggt gttgtgctgt ggggaaggga gaaggatttg taaaccccgg        60
     agcgaggttc tgcttacccg aggccgctgc tgtgcggaga cccccgggtg aagccaccgt       120
     catcatgtct gaccaggagg caaaaccttc aactgaggac ttgggggata agaaggaagg       180
     tgaatatatt aaactcaaag tcattggaca ggatagcagt gagattcact tcaaagtgaa       240
     aatgacaaca catctcaaga aactcaaaga atcatactgt caaagacagg gtgttccaat       300
     gaattcactc aggtttctct ttgagggtca gagaattgct gataatcata ctccaaaaga       360
     actgggaatg gaggaagaag atgtgattga agtttatcag gaacaaacgg ggggtcattc       420
     aacagtttag atattctttt tatttttttt cttttccctc aatccttttt tatttttaaa       480
     aatagttctt ttgtaatgtg gtgttcaaaa cggaattgaa aactggcacc ccatctcttt       540
     gaaacatctg gtaatttgaa ttctagtgct cattattcat tattgtttgt tttcattgtg       600
     ctgatttttg gtgatcaagc ctcagtcccc ttcatattac cctctccttt ttaaaaatta       660
     cgtgtgcaca gagaggtcac ctttttcagg acattgcatt ttcaggcttg tggtgataaa       720
     taagatcgac caatgcaagt gttcataatg actttccaat tggccctgat gttctagcat       780
     gtgattactt cactcctgga ctgtgacttt cagtgggaga tggaagtttt tcagagaact       840
     gaactgtgga aaaatgacct ttccttaact tgaagctact tttaaaattt gagggtctgg       900
     accaaaagaa gaggaatatc aggttgaagt caagatgaca gataaggtga gagtaatgac       960
     taactccaaa gatggcttca ctgaagaaaa ggcattttaa gattttttaa aaatcttgtc      1020
     agaagatccc agaaaagttc taattttcat tagcaattaa taaagctata catgcagaaa      1080
     tgaatacaac agaacactgc tctttttgat tttatttgta ctttttggcc tgggatatgg      1140
     gttttaaatg gacattgtct gtaccagctt cattaaaata aacaatattt gtaaaaatca      1200
     aaaaaaaaaa aaaaaaaa                                                    1218
//