Dbfetch

ID   Z80941; SV 1; linear; mRNA; STD; MUS; 2328 BP.
XX
AC   Z80941;
XX
DT   11-OCT-1996 (Rel. 49, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   M.musculus mRNA for semaphorin H.
XX
KW   semaphorin H.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2328
RX   PUBMED; 9515811.
RA   Christensen C.c., Tarabykina S.s., Hulgaard E.e., Kramerov D.d.,
RA   Lukanidin E.e.;
RT   "Transcription of a novel mouse semaphorin gene, M-semaH, correlates with
RT   the metastatic ability of mouse tumor cell lines";
RL   Cancer Res. 58(6):1238-1244(1998).
XX
RN   [2]
RC   revised by [3]
RA   Christensen C.c.;
RT   ;
RL   Submitted (11-OCT-1996) to the INSDC.
RL   Christensen C. C., Danish Cancer Society, Molecular Cancer Biology,
RL   Strandboulevarden 49, Copenhagen, Sealand, Denmark, 2100
XX
RN   [3]
RP   1-2328
RA   Christensen C.c.;
RT   ;
RL   Submitted (14-APR-1998) to the INSDC.
RL   Christensen C. C., Danish Cancer Society, Molecular Cancer Biology,
RL   Strandboulevarden 49, Copenhagen, Sealand, Denmark, 2100
XX
DR   MD5; dbadfd265fff1b1aada5f970ed9710cb.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
DR   EuropePMC; PMC87143; 11416145.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2328
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c fC3H"
FT                   /mol_type="mRNA"
FT                   /cell_line="66cl4"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2328
FT                   /product="semaphorin H"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="CAB02590.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNR
FT                   TSIFQSPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPD
FT                   DAIRFARIDPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFH
FT                   HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQ
FT                   FVGDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKM
FT                   DLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKM
FT                   PCPPLSGMSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYAN
FT                   PQEKRLRSKAEHFRLPRHTLLS"
XX
SQ   Sequence 2328 BP; 665 A; 542 C; 595 G; 526 T; 0 other;
     atggcaccgg ccggacacat cctcaccttg ctgctctggg gtcacctgct ggaactctgg        60
     accccaggtc actccgcgaa cccctcctac cccaggctac gcctgtcaca taaagaactt       120
     ttggaactga ataggacttc aatatttcaa agcccccttg gatttcttga tctccataca       180
     atgctgctgg atgagtatca agaacggctc tttgtgggag gcagagacct tgtctattcc       240
     ctgaacttgg aacgagtcag tgacggctac agagagatat actggccgag cacagcagta       300
     aaggtagaag aatgcataat gaaaggaaaa gacgcaaatg agtgtgccaa ttatatccgg       360
     gttttgcatc actacaacag gacacacctt ctgacctgtg ctactggagc ttttgatcca       420
     cactgtgcct tcatcagagt cgggcaccat tcagaggaac ccctgtttca cctggagtca       480
     cacagatctg agagaggaag gggcagatgt ccttttgacc ccaactcctc ctttgtgtcc       540
     acgctagttg ggaatgagct gtttgctgga ctctacagtg actattgggg cagagactcg       600
     gcgatcttcc gcagcatggg gaagttaggc catattcgca ctgagcatga cgatgagcgg       660
     ctcctgaaag aaccaaaatt tgtaggttca tatatgattc ctgataacga agaccgagat       720
     gacaacaaaa tgtacttttt ctttactgag aaggcgctgg aggcggagaa caacgcccac       780
     acgatctaca cccgagtggg gcggctgtgc gtgaatgaca tgggaggaca gagaatcctg       840
     gtgaacaagt ggagcacttt ccttaaagcg cggctggttt gctcagtgcc gggaatgaat       900
     ggaatcgaca catactttga cgaactagag gatgtgtttt tactgccgac cagagatcct       960
     aagaatccag tgatatttgg actgtttaat actaccagca atatatttag aggccatgct      1020
     gtatgtgtgt atcacatgtc aagtatccgg gaagccttta atggcccata tgctcataaa      1080
     gaaggccctg aataccactg gtcactatat gaaggaaaag tcccctaccc aaggcctggt      1140
     tcctgtgcca gcaaagtaaa cggaggcaag tatggaacca ccaaagatta ccccgatgac      1200
     gccatccggt tcgcaaggat cgatcctcta atgtatcagc ccataaaacc tgttcataaa      1260
     aaaccaatac tggtaaaaac agatggaaaa tacaacctga ggcaacttgc cgtggatcgg      1320
     gtggaagcgg aggatggcca gtatgacgtc ttatttattg ggacagacac aggaattgtg      1380
     ctgaaagtaa tcacaattta caaccaagaa acagagtgga tggaggaagt cattctagag      1440
     gaacttcaaa tattcaagga tccagcccct atcatttcta tggaaatttc ttcaaagaga      1500
     caacagcttt acattggatc agcctctgct gtggcacaag tcagattcca tcactgcgac      1560
     atgtatggca gtgcttgtgc tgactgctgc ctggctcgag acccgtactg tgcctgggat      1620
     ggcatatcct gctccaggta ctacccaaca ggtgcacacg caaagaggag gttccgcagg      1680
     caggacgttc ggcatggcaa cgccgcccaa cagtgctttg gacagcaatt tgttggagac      1740
     gcgttggaca ggactgaaga gaggctggct tatggcatag agagcaacag tactctgttg      1800
     gaatgcaccc cgcgatcact acaagcaaaa gtcatctggt ttgtacagaa gggacgcgac      1860
     gtaagaaaag aagaggtgaa gacggatgac agagttgtca agatggactt gggcttgctc      1920
     ttcctcagag tacgcaagtc agatgcaggg acctattttt gccagacagt agaacacaat      1980
     tttgtccata ctgtgcgtaa aatcaccttg gaggtggtcg aagagcataa agtggagggc      2040
     atgtttcata aggaccatga agaggaaaga catcacaaga tgccctgccc tcccttaagc      2100
     ggtatgtctc aggggacaaa accgtggtac aaggaattct tgcagctgat tggctacagc      2160
     aacttccaga gagtggaaga atactgcgaa aaggtgtggt gtacagataa gaagaggaaa      2220
     aagcttaaaa tgtctccctc caagtggaag tatgccaacc cccaggaaaa gaggcttcgc      2280
     tctaaagctg agcacttccg cctgcccagg cacacgctgc tctcctga                   2328
//