Dbfetch

ID   Z71268; SV 1; linear; mRNA; STD; MUS; 1185 BP.
XX
AC   Z71268;
XX
DT   08-AUG-1996 (Rel. 48, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   M.musculus mRNA for CMP-sialic acid transporter
XX
KW   CMP-sialic acid transporter.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1185
RX   DOI; 10.1073/pnas.93.15.7572.
RX   PUBMED; 8755516.
RA   Eckhardt M., Muehlenhoff M., Bethe A., Gerardy-Schahn R.;
RT   "Expression cloning of the Golgi CMP-sialic acid transporter";
RL   Proc. Natl. Acad. Sci. U.S.A. 93(15):7572-7576(1996).
XX
RN   [2]
RP   1-1185
RA   Gerardy-Schahn R.;
RT   ;
RL   Submitted (18-APR-1996) to the INSDC.
RL   Gerardy-Schahn R., Medizinische Hochschule Hannover, Institut fuer
RL   Medizinische Mikrobiologie, Konstanty-Gutschow Strasse 8, Hannover,
RL   Germany, 30625
XX
DR   MD5; 8e21cb1886da77e5968dd7dcd91516a6.
DR   Ensembl-Gn; ENSMUSG00000028293; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028087; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028050; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028098; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027827; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028540; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027282; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028051; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027942; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028599; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027001; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027358; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000029970; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064997; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0065028; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0064967; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064947; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0064637; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0065437; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064986; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0064586; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0064709; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0064657; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0064841; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0064660; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0065653; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0064506; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063887; mus_musculus_wsbeij.
DR   EuropePMC; PMC38787; 8755516.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1185
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="AtT-20"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1011
FT                   /product="CMP-sialic acid transporter"
FT                   /function="translocation of CMP-sialic acid"
FT                   /db_xref="GOA:Q61420"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="MGI:MGI:1345622"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61420"
FT                   /protein_id="CAA95855.1"
FT                   /translation="MAPARENVSLFFKLYCLAVMTLVAAAYTVALRYTRTTAEELYFST
FT                   TAVCITEVIKLLISVGLLAKETGSLGRFKASLSENVLGSPKELAKLSVPSLVYAVQNNM
FT                   AFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWISVFMLCGGVTLVQWKPA
FT                   QASKVVVAQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIVVTL
FT                   AGTYLSDGAEIQEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIV
FT                   LSTIASVLLFGLQITLSFALGALLVCVSIYLYGLPRQDTTSIQQEATSKERIIGV"
XX
SQ   Sequence 1185 BP; 344 A; 228 C; 266 G; 347 T; 0 other;
     atggctccgg cgagagaaaa tgtcagttta ttcttcaagc tgtactgctt ggcggtgatg        60
     actctggtgg ctgccgctta caccgtagct ttaagataca caaggacaac agctgaagaa       120
     ctctacttct caaccactgc cgtgtgtatc acagaagtga taaagttact gataagtgtt       180
     ggcctgttag ctaaggaaac tggcagtttg ggtagattta aagcctcatt aagtgaaaat       240
     gtcttgggga gccccaagga actggcgaag ttgagtgtgc catcactagt gtatgctgtg       300
     cagaacaaca tggccttcct ggctctcagt aatctggatg cagcagtgta ccaggtgacc       360
     tatcaactga agatcccctg cactgcttta tgtactgttt taatgttaaa tcgaacactc       420
     agcaaattac agtggatttc cgtcttcatg ctgtgtggtg gggtcacact cgtacagtgg       480
     aaaccagccc aagcttcaaa agtcgtggta gcgcagaatc cattgttagg ctttggtgct       540
     atagctattg ctgtattgtg ctctggattt gcaggagttt attttgaaaa agtcttaaag       600
     agttccgaca cttccctttg ggtgagaaac attcagatgt atctgtcagg gatcgttgtg       660
     acgttagctg gtacctactt gtcagatgga gctgaaattc aagaaaaagg attcttctat       720
     ggctacacgt attatgtctg gtttgttatc ttccttgcta gtgtgggagg cctctacacg       780
     tcagtggtgg tgaagtatac agacaacatc atgaaaggct tctctgctgc cgcagccatt       840
     gttctttcta ccattgcttc agtcctactg tttggattac agataacact ttcatttgca       900
     ctgggagctc ttcttgtgtg tgtttccata tatctctatg ggttacccag acaagatact       960
     acatccattc aacaagaagc aacttcaaaa gagagaatca ttggtgtgtg atttgaatct      1020
     caagagattc ctataaggac ttaaactgtt gataataaat tagagcctta agtcaacccc      1080
     agatggtagg ttaaataatg tcaacaaaat aattgtatga cataagaatc aagaagaaaa      1140
     ctctgaatga aatgctaaaa cagatttaaa aaaaaaaaaa aaaaa                      1185
//