spacer

EBI Dbfetch

ID   Z50190; SV 1; linear; mRNA; STD; MUS; 4457 BP.
XX
AC   Z50190;
XX
DT   30-OCT-1995 (Rel. 45, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 15)
XX
DE   M.musculus mRNA for adenylyl cyclase type 9.
XX
KW   adenylyl cyclase; adenylyl cyclase type 9.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4457
RX   DOI; 10.1006/bbrc.1995.2385.
RX   PUBMED; 7575502.
RA   Paterson J.M., Smith S.M., Harmar A.J., Antoni F.A.;
RT   "Control of a novel adenylyl cyclase by calcineurin";
RL   Biochem. Biophys. Res. Commun. 214(3):1000-1008(1995).
XX
RN   [2]
RP   1-4457
RX   DOI; 10.1074/jbc.270.47.28055.
RX   PUBMED; 7499291.
RA   Antoni F.A., Barnard R.J., Shipston M.J., Smith S.M., Simpson J.,
RA   Paterson J.M.;
RT   "Calcineurin feedback inhibition of agonist-evoked cAMP formation";
RL   J Biol Chem 270(47):28055-28061(1995).
XX
RN   [3]
RC   Revised by [4]
RA   Paterson J.M.;
RT   ;
RL   Submitted (28-JUL-1995) to the INSDC.
RL   Janice M. Paterson, Pharmacology, MRC Brain Metabolism Unit, University of
RL   Edinburgh, 1 George Square, Edinburgh, Scotland, EH8, 9JZ, UK
XX
RN   [4]
RP   1-4457
RA   Paterson J.M.;
RT   ;
RL   Submitted (06-DEC-1996) to the INSDC.
RL   Janice M. Paterson, Pharmacology, MRC Brain Metabolism Unit, University of
RL   Edinburgh, 1 George Square, Edinburgh, Scotland, EH8, 9JZ, UK
XX
DR   MD5; fbbce82dee98ad5bee3f7a88769eae3f.
DR   Ensembl-Gn; ENSMUSG00000005580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005719; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117801; mus_musculus.
DR   EuropePMC; PMC15096; 9874775.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4457
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="AtT20 anterior pituitary corticotroph tumor"
FT                   /db_xref="taxon:10090"
FT   CDS             43..4104
FT                   /product="adenylyl cyclase type 9"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="GOA:P51830"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:108450"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51830"
FT                   /protein_id="CAA90570.1"
FT                   /translation="MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKH
FT                   CKYSISSSCSSSGDSGGLPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSMNLEEAC
FT                   LERCFPQTQRRFRYALFYVGFACLLWSIYFAVHMKSKVIVMVVPALCFLVVCVGFFLFT
FT                   FTKLYARHYAWTSLALTLLVFALTLAAQFQVWTPLSGRVDSSNHTLTATPADTCLSQVG
FT                   SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGALHWEL
FT                   LSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPR
FT                   IIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFAD
FT                   IVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADH
FT                   AYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLA
FT                   NLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQLKGLKTYLISGQRA
FT                   KESHCSCAEALLSGFEVIDDSRESSGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGI
FT                   TFAPKSEAGAEGGTVQNGCQDEPKTSTKASGGPNSKTQNGLLSPPAEEKLTNSQTSLCE
FT                   ILQEKGRWAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLN
FT                   FLDQELERSYRTSYQEEVIKNSPVKTFASATFSSLLDVFLSTTVFLILSITCFLKYGAT
FT                   ATPPPPAALAVFGADLLLEVLSLIVSIRMVFFLEDVMTCTKWLLEWIAGWLPRHCIGAI
FT                   LVSLPALAVYSHITSEFETNIQVTMFTGSAVLVAVVHYCNFCQLSSWMRSSLATIVGAG
FT                   LLLLLHISLCQDSSIVMSPLDSAQNFSAQRNPCNSSVLQDGRRPASLIGKELILTFFLL
FT                   LLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQ
FT                   TYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKI
FT                   KTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVG
FT                   FNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDY
FT                   RGTVNVKGKGQMKTYLYPKCTDNGVVPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPS
FT                   VQYSDKASLGSDDSTQAKEAHLSSKRSWREPVKAEERFPFGKAIEKDSCEDIGVEEASE
FT                   LSKLNVSKSV"
XX
SQ   Sequence 4457 BP; 1012 A; 1195 C; 1223 G; 1027 T; 0 other;
     tgcccctgac ctggtcggga aaggttccaa gagctcggca acatggcttc ctcaccccac        60
     cagcagctgc tgcatcacca tagcaccgag gtgagctgcg actcaagcgg agacagcaac       120
     agcgtgaggg tcaagatcaa ccctaagcag ctgtcctcca acacccaccc gaagcactgc       180
     aagtacagca tctcctccag ctgtagcagc tcgggagact cagggggcct tccccggagg       240
     gttggcggcg ggggtcgcct gcgcagacag aagaagctgc cccagctttt tgagagggcc       300
     tccagccggt ggtgggaccc caaattcgac tccatgaacc tggaggaggc ctgcctggag       360
     cgctgctttc cgcagaccca gcgccgcttc cggtacgcac tcttttatgt gggcttcgcc       420
     tgccttctct ggagcatcta tttcgctgtc cacatgaaat ccaaagtgat tgtcatggtg       480
     gtcccagctc tgtgcttcct ggtggtgtgt gtgggctttt tcctgtttac tttcaccaag       540
     ctgtacgccc ggcattatgc gtggacctcg ctggctctca ccctgctggt gttcgccctg       600
     accctggctg cgcagtttca ggtttggaca cctctgtcag gacgtgttga cagctccaat       660
     catactctca cggccactcc ggcggacact tgcttatctc aagtaggaag cttctccata       720
     tgcatcgaag tgctcctttt gctctacaca gtcatgcagt tacctctgta cctgagcttg       780
     tttttggggg tggtctattc tgtccttttt gagaccttcg gctaccactt ccgaaacgaa       840
     gactgctacc cttctccggg ccctggggcc ctgcactggg agctgctgag cagagccctg       900
     cttcacgtgt gcattcacgc tatcgggatc catctgtttg tcatgtctca ggtgaggtcc       960
     aggagcacct ttctcaaggt gggacaatcc attatgcacg gcaaagatct ggaagtagag      1020
     aaagccctga aagagaggat gattcattca gtgatgccaa gaatcatagc cgacgactta      1080
     atgaaacaag gggacgagga gagtgagaat tctgtcaaga ggcatgccac ctccagtccc      1140
     aagaacagga agaagaagtc ctccatacag aaggcaccga tagcattccg cccctttaag      1200
     atgcagcaga ttgaagaagt cagtatttta tttgcagaca ttgtgggttt caccaagatg      1260
     agcgccaaca aatctgcgca tgccttggta ggcctactca atgacctgtt cggtcgcttt      1320
     gaccgcctgt gtgagcagac caagtgtgag aagatcagca ctctggggga ctgttattac      1380
     tgtgtggcag ggtgtccgga gccccgggca gaccatgcct actgctgcat tgaaatgggc      1440
     ttaggcatga taaaagccat cgagcagttc tgccaggaga agaaagagat ggtgaacatg      1500
     cgtgttgggg ttcacacggg gactgtcctg tgtggcatcc tgggcatgag gaggtttaaa      1560
     tttgatgtgt ggtccaacga tgtgaacttg gctaatctca tggagcagct gggagtggct      1620
     ggcaaagttc acatatctga ggccactgca aaatacttag acgacaggta tgaaatggaa      1680
     gatgggagag ttattgagcg ccttgggcag agtgtggtgg ctgaccagtt gaaaggtttg      1740
     aagacatacc tgatatcggg tcagagagcc aaggagtccc actgcagctg tgcagaggcc      1800
     ctgctttctg gctttgaggt cattgacgac tcacgggagt cctcaggccc taggggacag      1860
     gggacagcat cgccagggag tgtcagtgat ttggcgcaga ctgtcaaaac ctttgataac      1920
     cttaagactt gcccttcttg tggaatcaca tttgctccca aatctgaagc tggtgcagaa      1980
     ggaggaactg tgcaaaatgg ctgtcaagac gagcctaaga ccagcaccaa ggcttctgga      2040
     ggacccaact ccaaaaccca gaatggactt ctgagccctc ctgcagagga gaagctcact      2100
     aacagccaga cctccctctg tgagatcctg caagagaagg gacggtgggc aggcgtgagc      2160
     ttggaccagt cagccctcct cccgctcagg ttcaagaaca tccgtgagaa aactgatgcc      2220
     cactttgttg atgtcatcaa agaagacagc ctgatgaaag attatttctt caagccgccc      2280
     atcaatcagt tcagcctgaa cttcctggac caggagctgg agcgatcata tagaaccagc      2340
     taccaggaag aggtcataaa gaattctcct gtgaagacgt tcgccagtgc caccttcagc      2400
     tcccttctgg atgtgtttct gtcaaccacc gtgttcctga ttctctccat cacctgcttc      2460
     ctaaagtatg gagccaccgc cacccctccc ccaccggctg ccctggccgt ctttggtgca      2520
     gacctgctgc tggaggtgct ttccctcata gtgtccatca gaatggtgtt tttcctagag      2580
     gatgtcatga catgcacaaa gtggttgctg gaatggatcg ctggctggct ccctcgccac      2640
     tgcattgggg caatcttggt gtctcttcct gccctggctg tctattcaca catcacctct      2700
     gagtttgaga ccaacataca ggtcaccatg ttcactggct ctgcggtgct ggtggccgtt      2760
     gtgcactact gtaacttctg ccagctcagc tcctggatga ggtcctccct tgccaccatc      2820
     gtgggggctg ggctgctgct tctgctccac atctccctgt gtcaggacag ttccattgtg      2880
     atgtccccct tggactcagc acagaatttc agtgcccaga ggaacccatg caacagctca      2940
     gtgctgcagg acggcaggag gccggccagc ctcataggca aggagcttat cctcaccttc      3000
     ttcctcctgc tcctcttggt ctggttcctg aaccgggagt tcgaggtcag ctaccggctg      3060
     cactaccatg gggatgtgga ggccgaccta caccgcacca agatccagag catgagagac      3120
     caggctgact ggctactgcg gaacatcatc ccctaccatg tggctgagca gctcaaggtc      3180
     tctcagacct actccaagaa ccatgacagc gggggagtca tctttgccag cattgtcaac      3240
     ttcagtgaat tctatgagga gaactatgag gggggcaagg agtgctaccg tgtcctcaac      3300
     gagctgatcg gtgacttcga tgagctcttg agcaagccgg actataatag catcgagaag      3360
     atcaagacca tcggggccac atacatggca gcctcagggc tgaacacggc ccagtgtcag      3420
     gagggtggcc acccacagga gcatctgcgt atcctcttcg agttcgccaa ggagatgatg      3480
     cgcgtggtgg atgacttcaa caacaatatg ttatggttca acttcaagct cagggtcggc      3540
     tttaaccacg gacccctcac agcaggtgtc ataggtacca ccaagctgct gtatgacatc      3600
     tggggggaca ccgtcaacat cgccagcagg atggacacca ctggtgtgga gtgccgtatc      3660
     caggtgagcg aagagagcta ccgtgtgctg agcaagatgg gttatgactt tgactaccga      3720
     gggaccgtga atgtcaaggg gaaagggcag atgaagacct acctttaccc aaagtgcacg      3780
     gacaatggag tggttcccca gcaccagctg tccatctccc cagacatccg agtccaggtg      3840
     gacggcagca ttgggcggtc tcccacagat gagattgcca acttggtgcc ttccgttcag      3900
     tattcggaca aggcttccct gggatctgat gatagcacac aggctaagga agctcacctg      3960
     tcctctaaga ggtcctggag agagccagtc aaagcagagg aaaggtttcc atttggcaaa      4020
     gccatagaaa aggacagctg tgaagacata ggagtagaag aggccagtga actcagcaag      4080
     ctcaatgtct caaagagtgt gtgaggcagc gccgagagct gccaaggtgc tctgcgtgtc      4140
     caaacacagt aacatctgtg tcgataggct gttgtgctat ctagcacctc agtttctgtc      4200
     cccagatgtg gtgtcacgtg gtcatttcag cccgaatctc tgtgtggagc acagttattc      4260
     agggttcatt tccacccatt tcggttttcc tttacttgcg ttcctggaag ccttttcctg      4320
     gaagcctgcc cccagcccag ccaggggatc cagtcagcag cgtggaggga ttcaagtgcc      4380
     ttcagggtct ggccttgcgt ctggggctga ggccactggt ggaatcatgg ccctggggat      4440
     tatttgactt ctttaag                                                     4457
//


spacer
spacer