spacer

EBI Dbfetch

ID   Z38072; SV 1; linear; genomic DNA; STD; HUM; 282 BP.
XX
AC   Z38072;
XX
DT   12-OCT-1994 (Rel. 41, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 18)
XX
DE   H.sapiens MHC class II DNA for HLA-DRB1*1419, exon 2.
XX
KW   HLA-DRB1*1419 gene; major histocompatibility complex class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1111/j.1399-0039.1995.tb02506.x.
RX   PUBMED; 8560458.
RA   Loeffler D., Woelpl A., Kern P., Eiermann T.H.;
RT   "A novel HLA-DR allele, DRB1*1419";
RL   Tissue Antigens 46(4):343-344(1995).
XX
RN   [2]
RC   Revised by [3]
RA   Eiermann T.H.;
RT   ;
RL   Submitted (12-OCT-1994) to the INSDC.
RL   Eiermann T. H., Universitaet Ulm, Transfusionsmedizin, Helmholtzstr.10,
RL   Ulm, Baden-Wuerttemberg, Germany, D-89005
XX
RN   [3]
RP   1-282
RA   Eiermann T.H.;
RT   ;
RL   Submitted (29-MAY-1996) to the INSDC.
RL   Eiermann T. H., Universitaet Ulm, Transfusionsmedizin, Helmholtzstr.10,
RL   Ulm, Baden-Wuerttemberg, Germany, D-89005
XX
DR   MD5; 3a878af878e7b663c05fac66f16f65d5.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /isolate="GERGOL2361/941189M.A."
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /product="HLA-DRB1*1419"
FT                   /note="exon 2"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAA86217.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>282
FT                   /product="HLA-DRB1*1419"
FT                   /number=2
XX
SQ   Sequence 282 BP; 62 A; 69 C; 102 G; 49 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggagagatac ttccataacc aggaggagaa cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aagcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc ga                          282
//


spacer
spacer