spacer

EBI Dbfetch

ID   Z35166; SV 1; linear; mRNA; STD; MUS; 771 BP.
XX
AC   Z35166;
XX
DT   03-SEP-1994 (Rel. 40, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE   M.musculus (Balb/c) mRNA for collagen IV alpha 3 chain
XX
KW   collagen; collagen alpha 3 type IV; collagen type IV.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-771
RX   DOI; 10.1083/jcb.127.3.879.
RX   PUBMED; 7962065.
RA   Miner J.H., Sanes J.R.;
RT   "Collagen IV alpha 3, alpha 4, and alpha 5 chains in rodent basal laminae:
RT   sequence, distribution, association with laminins, and developmental
RT   switches";
RL   J. Cell Biol. 127(3):879-891(1994).
XX
RN   [2]
RC   Revised by [3]
RA   Miner J.H.;
RT   ;
RL   Submitted (13-JUL-1994) to the INSDC.
RL   Jeffrey H. Miner, Anatomy and Neurobiology, Washington University, School
RL   of Medicine, 660 South Euclid Ave., St. Louis, MO, 63110, USA
XX
RN   [3]
RP   1-771
RA   Miner J.H.;
RT   ;
RL   Submitted (28-MAY-1996) to the INSDC.
RL   Jeffrey H. Miner, Anatomy and Neurobiology, Washington University, School
RL   of Medicine, 660 South Euclid Ave., St. Louis, MO, 63110, USA
XX
DR   MD5; 50649e5e8cb102f71eaea238847025a3.
DR   Ensembl-Gn; ENSMUSG00000079465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113457; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..771
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /clone_lib="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..741
FT                   /codon_start=1
FT                   /product="collagen IV alpha 3 chain"
FT                   /db_xref="GOA:Q9QZS0"
FT                   /db_xref="InterPro:IPR001442"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:104688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZS0"
FT                   /protein_id="CAA84529.1"
FT                   /translation="PGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYS
FT                   GFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPAL
FT                   MPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFT
FT                   SAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPI
FT                   PSTVKAGDLEKIISRCQVCMKKRH"
FT   misc_feature    40..738
FT                   /note="noncollagenous domain 1 (NC1)"
XX
SQ   Sequence 771 BP; 212 A; 195 C; 170 G; 194 T; 0 other;
     ccaggcttaa agggaaatcc tggtgacagg ggaacgccgg ccactggtac aagaatgcga        60
     ggcttcatct tcacccgaca cagtcaaacc acggccattc cttcatgccc tgaaggaaca       120
     cagccactct atagtgggtt ttctcttctt tttgtacaag gaaacaaacg tgcacatgga       180
     caagacctag gtactctggg cagctgcctg cagcgattca ccacaatgcc gttcttattc       240
     tgtaacatca ataatgtatg taactttgca tcacgaaatg attattcata ctggctgtca       300
     acaccagctc tgatgccaat ggacatggct ccaattagtg gcagagctct cgaaccctat       360
     attagcagat gcaccgtctg tgaaggtcca gcaatggcca tagctgttca cagtcaaact       420
     actgctatcc ctccgtgtcc ccaggactgg gtttctctct ggaaaggttt ttctttcatt       480
     atgttcacaa gtgcaggctc tgagggtgct ggacaagcac ttgcctcgcc tggctcctgc       540
     ctggaagaat tccgagccag tccatttata gaatgccatg gacgagggac atgtaactac       600
     tactcaaact cctacagttt ctggctggct tcgctgaacc cagaaagaat gttcagaaaa       660
     cctattccat caactgtgaa agctggagac ttagagaaaa tcataagccg ctgtcaggtg       720
     tgcatgaaga aaagacattg acgaaatcaa agaaaccaga ccgttttttt t                771
//


spacer
spacer