Dbfetch

ID   Z31664; SV 1; linear; mRNA; STD; MUS; 1909 BP.
XX
AC   Z31664;
XX
DT   25-MAY-1995 (Rel. 43, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 9)
XX
DE   M.musculus (NIH Swiss) mRNA for ALK-1
XX
KW   activin type IB receptor; ALK-1 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [2]
RP   1-1909
RA   Miyazono K.;
RT   ;
RL   Submitted (30-MAR-1994) to the INSDC.
RL   Kohei Miyazono, Ludwig Instititute for Cancer Research, Biomedical Center,
RL   Uppsala, S-751 24, Sweden
XX
RN   [3]
RP   1-1909
RX   DOI; 10.1210/en.136.6.2652.
RX   PUBMED; 7750489.
RA   Dewulf N., Verschueren K., Lonnoy O., Moren A., Grimsby S., Spiegle K.,
RA   Miyazono K., Huylebroeck D., ten Dijke P.;
RT   "Distinct spatial and temporal expression patterns of two type I receptors
RT   for bone morphogenetic proteins during mouse embryogenesis";
RL   Endocrinology 136(6):2652-2663(1995).
XX
DR   MD5; 86b40efb6dc3d33ec9015e7645dad74c.
DR   Ensembl-Gn; ENSMUSG00000000530; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022327; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022303; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022331; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022101; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022070; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022197; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022176; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022268; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021365; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021676; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121718; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042672; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042634; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042598; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042624; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042361; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043109; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042462; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042275; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042425; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042390; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043148; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041752; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1909
FT                   /organism="Mus musculus"
FT                   /strain="NIH Swiss"
FT                   /mol_type="mRNA"
FT                   /dev_stage="Adult"
FT                   /clone_lib="mouse placental lambda ZAP II cDNA library"
FT                   /clone="mALK-1"
FT                   /tissue_type="Placenta"
FT                   /db_xref="taxon:10090"
FT   CDS             241..1749
FT                   /product="ALK-1"
FT                   /db_xref="GOA:Q61288"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61288"
FT                   /protein_id="CAA83484.1"
FT                   /translation="MTLGSFRRGLLMLSVALGLTQGRLAKPSKLVNCTCESPHCKRPFC
FT                   QGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEA
FT                   TQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLWRVRRRQEKQRDLHSDLGESSLIL
FT                   KASEQADSMLGDFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGSWHG
FT                   ESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEH
FT                   GSLYDFLQRQTLEPQLALRLAVSPACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSN
FT                   LQCCIADLGLAVMHSQSNEYLDIGNTPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWA
FT                   FGLVLWEIARRTIINGIVEDYRPPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADP
FT                   VLSGLAQMMRECWYPNPSARLTALRIKKTLQKLSHNPEKPKVIH"
FT   sig_peptide     241..303
FT                   /gene="ALK-1"
FT   mat_peptide     304..1746
FT                   /codon_start=1
FT                   /product="ALK-1"
XX
SQ   Sequence 1909 BP; 405 A; 554 C; 564 G; 386 T; 0 other;
     gagagcacag cccttcccag tccccggagc cgccgcgcca cgcgcgcatg atcaagacct        60
     tttccccggc cccacagggc ctctggacgt gagaccccgg ccgcctccgc aaggagaggc       120
     gggggtcgag tcgccctgtc caaaggcctc aatctaaaca atcttgattc ctgttgccgg       180
     ctggcgggac cctgaatggc aggaaatctc accacatctc ttctcctatc tccaaggacc       240
     atgaccttgg ggagcttcag aaggggcctt ttgatgctgt cggtggcctt gggcctaacc       300
     caggggagac ttgcgaagcc ttccaagctg gtgaactgca cttgtgagag cccacactgc       360
     aagagaccat tctgccaggg gtcatggtgc acagtggtgc tggttcgaga gcagggcagg       420
     cacccccagg tctatcgggg ctgtgggagc ctgaaccagg agctctgctt gggacgtccc       480
     acggagtttc tgaaccatca ctgctgctat agatccttct gcaaccacaa cgtgtctctg       540
     atgctggagg ccacccaaac tccttcggag gagccagaag ttgatgccca tctgcctctg       600
     atcctgggtc ctgtgctggc cttgccggtc ctggtggccc tgggtgctct gggcttgtgg       660
     cgtgtccggc ggaggcagga gaagcagcgg gatttgcaca gtgacctggg cgagtccagt       720
     ctcatcctga aggcatctga acaggcagac agcatgttgg gggacttcct ggacagcgac       780
     tgtaccacgg gcagcggctc ggggctcccc ttcttggtgc agaggacggt agctcggcag       840
     gttgcgctgg tagagtgtgt gggaaagggc cgatatggcg aggtgtggcg cggttcgtgg       900
     catggcgaaa gcgtggcggt caagattttc tcctcacgag atgagcagtc ctggttccgg       960
     gagacggaga tctacaacac agttctgctt agacacgaca acatcctagg cttcatcgcc      1020
     tccgacatga cttcgcggaa ctcgagcacg cagctgtggc tcatcaccca ctaccatgaa      1080
     cacggctccc tctatgactt tctgcagagg cagacgctgg agccccagtt ggccctgagg      1140
     ctagctgtgt ccccggcctg cggcctggcg cacctacatg tggagatctt tggcactcaa      1200
     ggcaaaccag ccattgccca tcgtgacctc aagagtcgca atgtgctggt caagagtaac      1260
     ttgcagtgtt gcattgcaga cctgggactg gctgtgatgc actcacaaag caacgagtac      1320
     ctggatatcg gcaacacacc ccgagtgggt accaaaagat acatggcacc cgaggtgctg      1380
     gatgagcaca tccgcacaga ctgctttgag tcgtacaagt ggacagacat ctgggccttt      1440
     ggcctagtgc tatgggagat cgcccggcgg accatcatca atggcattgt ggaggattac      1500
     aggccacctt tctatgacat ggtacccaat gaccccagtt ttgaggacat gaaaaaggtg      1560
     gtgtgcgttg accagcagac acccaccatc cctaaccggc tggctgcaga tccggtcctc      1620
     tccgggctgg cccagatgat gagagagtgc tggtacccca acccctctgc tcgcctcacc      1680
     gcactgcgca taaagaagac attgcagaag ctcagtcaca atccagagaa gcccaaagtg      1740
     attcactagc ccagggccac caggcttcct ctgcctaaag tgtgtgctgg ggaagaagac      1800
     atagcctgtc tgggtagagg gagtgaagag agtgtgcacg ctgccctgtg tgtgcctgct      1860
     cagcttgctc ccagcccatc cagccaaaaa tacagctgag ctgaaattc                  1909
//