spacer

EBI Dbfetch

ID   Z27231; SV 1; linear; mRNA; STD; MUS; 3167 BP.
XX
AC   Z27231;
XX
DT   12-NOV-1993 (Rel. 37, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   M.musculus mRNA for type IV collagenase (gelatinase B)
XX
KW   collagenase; gelatinase B; type IV collagenase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3167
RX   DOI; 10.1083/jcb.124.6.1091.
RX   PUBMED; 8132709.
RA   Reponen P., Sahlberg C., Munaut C., Thesleff I., Tryggvason K.;
RT   "High expression of 92-kD type IV collagenase (gelatinase B) in the
RT   osteoclast lineage during mouse development";
RL   J. Cell Biol. 124(6):1091-1102(1994).
XX
RN   [2]
RP   1-3167
RA   Tryggvason K.;
RT   ;
RL   Submitted (05-NOV-1993) to the INSDC.
RL   Tryggvason K., University of Oulu, Dept. of Biochemistry, Linnanmaa, Oulu,
RL   Finland, SF-90570
XX
DR   MD5; 87efeb26c7026ee2990b33e51bbcc7cf.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
DR   EuropePMC; PMC1891983; 11395366.
DR   EuropePMC; PMC2119973; 8132709.
DR   EuropePMC; PMC300851; 10841523.
DR   EuropePMC; PMC316781; 9573048.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3167
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="M92 KD"
FT                   /cell_type="Osteoclast"
FT                   /tissue_type="Bone"
FT                   /db_xref="taxon:10090"
FT   CDS             20..2212
FT                   /gene="CLG4B"
FT                   /standard_name="92 kDa type IV collagenase (gelatinase B)"
FT                   /db_xref="GOA:P41245"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /protein_id="CAA81745.1"
FT                   /translation="MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQL
FT                   AEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPD
FT                   VGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPE
FT                   ADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYY
FT                   GNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHG
FT                   NGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGG
FT                   NSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVA
FT                   AHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTT
FT                   TEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTA
FT                   GSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTAR
FT                   TWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLL
FT                   PRRPGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHG
FT                   KFFWRVSFQNEVNKVDPEVNQVDDVGYVTYDLLQCP"
FT   polyA_site      3152
XX
SQ   Sequence 3167 BP; 693 A; 933 C; 811 G; 730 T; 0 other;
     agaagctgcg gtcctcacca tgagtccctg gcagcccctg ctcctggctc tcctggcttt        60
     cggctgcagc tctgctgccc cttaccagcg ccagccgact tttgtggtct tccccaaaga       120
     cctgaaaacc tccaacctca cggacaccca gctggcagag gcatacttgt accgctatgg       180
     ttacacccgg gccgcccaga tgatgggaga gaagcagtct ctacggccgg ctttgctgat       240
     gcttcagaag cagctctccc tgccccagac tggtgagctg gacagccaga cactaaaggc       300
     cattcgaaca ccacgctgtg gtgtcccaga cgtgggtcga ttccaaacct tcaaaggcct       360
     caagtgggac catcataaca tcacatactg gatccaaaac tactctgaag acttgccgcg       420
     agacatgatc gatgacgcct tcgcgcgcgc cttcgcggtg tggggcgagg tggcacccct       480
     caccttcacc cgcgtgtacg gacccgaagc ggacattgtc atccagtttg gtgtcgcgga       540
     gcacggagac gggtatccct tcgacggcaa ggacggcctt ctggcacacg cctttccccc       600
     tggcgccggc gttcagggag atgcccattt cgacgacgac gagttgtggt cgctgggcaa       660
     aggcgtcgtg atccccactt actatggaaa ctcaaatggt gccccatgtc actttccctt       720
     caccttcgag ggacgctcct attcggcctg caccacagac ggccgcaacg acggcacgcc       780
     ttggtgtagc acaacagctg actacgataa ggacggcaaa tttggtttct gccctagtga       840
     gagactctac acagagcacg gcaacggaga aggcaaaccc tgtgtgttcc cgttcatctt       900
     tgagggccgc tcctactctg cctgcaccac taaaggccgc tcggatggtt accgctggtg       960
     cgccaccaca gccaactatg accaggataa actgtatggc ttctgcccta cccgagtgga      1020
     cgcgaccgta gttgggggca actcggcagg agagctgtgc gtcttcccct tcgtcttcct      1080
     gggcaagcag tactcttcct gtaccagcga cggccgcagg gatgggcgcc tctggtgtgc      1140
     gaccacatcg aacttcgaca ctgacaagaa gtggggtttc tgtccagacc aagggtacag      1200
     cctgttcctg gtggcagcgc acgagttcgg ccatgcactg ggcttagatc attccagcgt      1260
     gccggaagcg ctcatgtacc cgctgtatag ctacctcgag ggcttccctc tgaataaaga      1320
     cgacatagac ggcatccagt atctgtatgg tcgtggctct aagcctgacc caaggcctcc      1380
     agccaccacc acaactgaac cacagccgac agcacctccc actatgtgtc ccactatacc      1440
     tcccacggcc tatcccacag tgggccccac ggttggccct acaggcgccc cctcacctgg      1500
     ccccacaagc agcccgtcac ctggccctac aggcgccccc tcacctggcc ctacagcggc      1560
     ccctactgcg ggctcttctg aggcctctac agagtctttg agtccggcag acaatccttg      1620
     caatgtggat gtttttgatg ctattgctga gatccagggc gctctgcatt tcttcaagga      1680
     cggttggtac tggaagttcc tgaatcatag aggaagccca ttacagggcc ccttccttac      1740
     tgcccgcacg tggccagccc tgcctgcaac gctggactcc gcctttgagg atccgcagac      1800
     caagagggtt ttcttcttct ctggacgtca aatgtgggtg tacacaggca agaccgtgct      1860
     gggccccagg agtctggata agttgggtct aggcccagag gtaacccacg tcagcgggct      1920
     tctcccgcgt cgtcccggga aggctctgct gttcagcaag gggcgtgtct ggagattcga      1980
     tttgaagtct cagaaggtgg atccccagag cgtcattcgc gtggataagg agttctctgg      2040
     tgtgccctgg aactcacacg acatcttcca gtaccaagac aaagcctatt tctgccatgg      2100
     caaattcttc tggcgtgtga gtttccaaaa tgaggtgaac aaggtggacc ctgaggtgaa      2160
     ccaggtggac gacgtgggct acgtgaccta cgacctcctg cagtgccctt gaactagggc      2220
     tccttctttg cttcaaccgt gcagtgcaag tctctagaga ccaccaccac caccaccaca      2280
     cacaaacccc atccgaggga aaggtgctag ctggccaggt acagactggt gatctcttct      2340
     agagactggg aaggagtgga ggcaggcagg gctctctctg cccaccgtcc tttcttgttg      2400
     gactgtttct aataaacacg gatccccaac cttttccagc tactttagtc aatcagctta      2460
     tctgtagttg cagatgcatc cgagcaagaa gacaactttg tagggtggat tctgaccttt      2520
     tatttttgtg tggcgtctga gaattgaatc agctggcttt tgtgacaggc acttcaccgg      2580
     ctaaaccacc tctcccgact ccagcccttt tatttattat gtatgtggtt atgttcacat      2640
     gcatgtattt aacccacaga atgcttactg tgtgtcgggc gcggctccaa ccgctgcata      2700
     aatattaagg tattcagttg cccctactgg aaggtattat gtaactattt ctctcttaca      2760
     ttggagaaca ccaccgagct atccactcat caaacattta ttgagagcat ccctagggag      2820
     ccaggctctc tactgggcgt tagggacaga aatgttggtt cttccttcaa ggattgctca      2880
     gagattctcc gtgtcctgta aatctgctga aaccagaccc cagactcctc tctctcccga      2940
     gagtccaact cactcactgt ggttgctggc agctgcagca tgcgtataca gcatgtgtgc      3000
     tagagaggta gagggggtct gtgcgttatg gttcaggtca gactgtgtcc tcccaggtga      3060
     gatgacccct cagctggaac tgatccagga aggataacca agtgtcttcc tggcagtctt      3120
     ttttaaataa atgaataaat gaatatttac ttaaaaaaaa aaaaaaa                    3167
//


spacer
spacer