Dbfetch

ID   Z23107; SV 1; linear; mRNA; STD; MUS; 1540 BP.
XX
AC   Z23107;
XX
DT   11-AUG-1993 (Rel. 36, Created)
DT   28-SEP-1993 (Rel. 37, Last updated, Version 3)
XX
DE   M.musculus mRNA for 5HTx serotonin receptor
XX
KW   serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1540
RX   PUBMED; 8394987.
RA   PLASSAT J., Amlaiky N., Hen R.;
RT   "Isolation of a mammalian serotonin receptor that activates adenylate
RT   cyclase";
RL   Mol. Pharmacol. 44(2):229-236(1993).
XX
RN   [2]
RP   1-1540
RA   Hen R.;
RT   ;
RL   Submitted (24-JUN-1993) to the INSDC.
RL   Rene Hen, Laboratoire de genetique moleculaire des eucaryotes, 11,Rue
RL   Humann, STRASBOURG, 67085, FRANCE
XX
DR   MD5; b89bd0dbde4fb14445330c0e48e741da.
DR   Ensembl-Gn; ENSMUSG00000024798; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025068; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025012; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025042; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024801; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025483; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024268; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024910; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024871; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024996; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024902; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025541; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024020; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024335; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000164639; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051586; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051603; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051549; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051547; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051279; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052035; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051409; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0051326; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051280; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051445; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052162; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051021; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050562; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1540
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             109..1455
FT                   /product="5HTx serotonin receptor"
FT                   /db_xref="GOA:P32304"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001069"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32304"
FT                   /protein_id="CAA80654.1"
FT                   /translation="MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWM
FT                   PHLLSGFPEVTASPAPTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCL
FT                   VVISVCFVKNVRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIA
FT                   MDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWPLSASITLPPLF
FT                   GWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGF
FT                   PRVQPESVISLNGVVKLQKEVEECANLSRLLKHERKNISSFKREQKAATTLGIIVGAFT
FT                   VCWLPFFLLSTARPFICGTSCSCIPLWVERTCLWLGYANSLINPFIYSFFNRDLRTTYR
FT                   SLLQCQYRNINRKLSAAGMHEALKLAERPERSEFVLQNCDHCGKKGHDT"
XX
SQ   Sequence 1540 BP; 327 A; 445 C; 444 G; 324 T; 0 other;
     gaattcggca cgaggcggac ggagcgggca aggtgaatcc agccctgggg ccggctgccg        60
     gagcgcttgg cgggggcgcc ggctccatgg gcagcggcgc tcggcacgat gatggacgtt       120
     aacagcagcg gccgccccga cctctacggc catctccgct ctctcatcct gccggaggtg       180
     gggcgcaggc tgcaggacct gagccccgac ggtggcgccc actcggtggt gagctcctgg       240
     atgccgcacc tgctgagcgg cttcccagag gtgacagcta gcccggcgcc cacctgggac       300
     gcgcccccgg acaatgtctc cggctgcggg gagcagatca actatggcag agtcgagaaa       360
     gttgtgatcg gctccatcct gacgctcatc acgctgctga cgatcgcggg caactgcctg       420
     gtggtgatct cggtgtgctt tgtcaagaac gtccgccagc cctccaacta cctgattgtg       480
     tccctggcgc tggctgacct ctcggtggcc gtggcggtca tgcctttcgt tagtgtcacg       540
     gacctcatcg ggggcaagtg gatcttcggc cacttcttct gcaacgtctt catcgccatg       600
     gacgtcatgt gctgcacggc ctcgatcatg accctgtgcg tgatcagcat cgacaggtac       660
     cttgggatca ccaggcccct cacgtacccc gtgaggcaga atgggaaatg tatggccaaa       720
     atgattctgt cggtctggcc tctctctgcc tccatcacct tacctcctct cttcggatgg       780
     gctcagaatg tgaacgatga caaagtgtgc ttgatcagcc aggattttgg ctacacgatc       840
     tactccaccg cagtggcgtt ttatatcccc atgtcggtca tgctgttcat gtactatcag       900
     atttacaagg ccgccaggaa gagcgcagcc aaacacaagt tctcaggctt cccacgcgtg       960
     cagccggaga gcgtcatctc cctgaatggc gtggtgaaac tccagaagga ggtggaagag      1020
     tgtgcgaacc tttcgagact gctcaaacac gaaaggaaaa acatttccag cttcaagagg      1080
     gaacagaaag cagccactac cttggggatc atcgtgggag ccttcacggt gtgctggctg      1140
     ccgtttttcc tcttgtccac agcaaggccc tttatctgtg gcacctcctg tagctgcatc      1200
     ccgctgtggg tggagaggac atgtctgtgg ctgggctatg caaactctct cattaaccct      1260
     tttatatatt ccttcttcaa ccgggacctg aggaccacct atcgtagcct actccagtgc      1320
     cagtaccgga atatcaaccg gaagctctct gctgcaggca tgcacgaagc cctgaaactt      1380
     gctgagaggc ctgagagaag cgagtttgtg ctacaaaact gtgaccactg tgggaaaaaa      1440
     ggtcatgata catgatccag agcggaaccc tggagaagaa gtaatgcaga acagggggaa      1500
     acaacgaaac cattggctga gactgcacaa cagaacttgg                            1540
//