spacer

EBI Dbfetch

ID   Z18278; SV 1; linear; genomic DNA; STD; MUS; 1686 BP.
XX
AC   Z18278; S51274;
XX
DT   17-DEC-1992 (Rel. 34, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   Mus musculus of 5HT5 receptor cDNA gene encoding 5HT5 serotonin receptor.
XX
KW   5HT5 serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1686
RX   PUBMED; 1464308.
RA   Plassat J.L., Boschert U., Amlaiky N., Hen R.;
RT   "The mouse 5HT5 receptor reveals a remarkable heterogeneity within the
RT   5HT1D receptor family";
RL   EMBO J. 11(13):4779-4786(1992).
XX
RN   [2]
RP   1-1686
RA   Hen R.;
RT   ;
RL   Submitted (14-OCT-1992) to the INSDC.
RL   RENE HEN, LABORATOIRE DE GENETIQUE MOLECULAIRE DES EUCARYOTES, 11,RUE
RL   HUMANN, STRASBOURG, 67085, FRANCE
XX
DR   MD5; 01b1add6221e6e3a6d782e64c08eda23.
DR   Ensembl-Gn; ENSMUSG00000039106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036227; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1686
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            7..>1686
FT   CDS             509..1582
FT                   /product="5HT5 serotinin receptor"
FT                   /db_xref="GOA:P30966"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001397"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96283"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30966"
FT                   /protein_id="CAA79155.1"
FT                   /translation="MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLT
FT                   LLGFLAAATFTWNLLVLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSG
FT                   RRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMIL
FT                   LTWALSTVISLAPLLFGWGETYSEPSEECQVSREPSYTVFSTVGAFYLPLWLVLFVYWK
FT                   IYRAAKFRMGSRKTNSVSPVPEAVEVKNATQHPQMVFTARHATVTFQTEGDTWREQKEQ
FT                   RAALMVGILIGVFVLCWFPFFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTA
FT                   FNRSYSSAFKVFFSKQQ"
XX
SQ   Sequence 1686 BP; 333 A; 506 C; 442 G; 405 T; 0 other;
     ggcacgaggc cgtctccaga aagcaggtat ctacgtggct tccagtcccc aacccccacc        60
     cctcggagcc actgccggga gaggggggag gtgggcaagg agcaaccctg gaccagcgac       120
     tgttctgacg cactagctga gttctgggca tccaccctgc actgggcggg ggcgacccaa       180
     ggatgctctg ctgcaggcga ccagacaaca gtctccgcct aggtgaggaa cagcaaggca       240
     tgtgatagca aaaggcgggc cctggcttct agattcagcc ccttgagtcc gctttccata       300
     tctctaagga tacctgggct gtgctgcttg tagcccagca ccctcctctc tgctacaatt       360
     tcctccggac tctgactggg tggagactga ggccaggttc ttggctctta gcaaaatcct       420
     ctccattggc catcggtcgc aaacatctag attgacttca gtgggctcgg tggcaacaca       480
     gtctaaacac aggtgtcctg ggacagcaat ggatctgcct gtaaacttga cctccttttc       540
     tctctctact ccctcctctt tggaacctaa ccgcagcttg gacacggaag tcctgcgccc       600
     tagtcggcct tttctctcag ctttccgagt gctagtcctg actttgttgg gctttctagc       660
     tgcggccaca ttcacttgga acctgctggt gctggctacc atcctcaagg tacgcacctt       720
     ccaccgagta ccacacaacc tggtagcttc catggccatc tcggatgtgc tagtggctgt       780
     gctggttatg ccactgagcc tggtacatga gctgtctggg cgccgctggc agctgggccg       840
     gcgtctatgc cagctgtgga tcgcatgtga cgtgctctgc tgtactgcca gcatctggaa       900
     tgtgacagca atagcactgg accgctactg gtcaatcacg cgccacctgg agtacacact       960
     ccgtacccgc aagcgtgtct ccaatgtgat gatcctgctc acctgggcac tctccactgt      1020
     catctctctg gctccactgc tatttggctg gggagagact tattctgagc ccagtgagga      1080
     atgccaagtc agtcgcgagc cttcctacac cgtgttctcc accgtgggtg ccttctacct      1140
     gccgctgtgg ctggtgctct ttgtgtactg gaaaatttac agggcggcga aattccgcat      1200
     gggctccagg aagactaaca gcgtctcccc cgtacccgaa gctgtggagg tgaagaatgc      1260
     tacacaacat ccccagatgg tgttcacggc ccgccatgcc accgtcacct tccagacaga      1320
     aggggatacg tggagggagc agaaggagca aagggcagcc ctcatggtgg gcatcctcat      1380
     cggagtgttt gtgctctgct ggttcccttt cttcgtcaca gagctcatca gtcccctgtg      1440
     ttcctgggac gtccctgcca tctggaagag catcttcctg tggttgggct attctaattc      1500
     cttcttcaac ccactcatct acacagcatt caacaggagc tacagcagtg ctttcaaggt      1560
     cttcttctcc aagcaacaat gagagaccac atgggagtgc cttcttccca tagcttgtag      1620
     ctcagtgggt tatattgtcc catgaacctt tgcaggctgc ccagctgtct ttgaggacaa      1680
     gatcca                                                                 1686
//


spacer
spacer