spacer

EBI Dbfetch

ID   Z15119; SV 1; linear; mRNA; STD; MUS; 1550 BP.
XX
AC   Z15119; S47893;
XX
DT   15-OCT-1992 (Rel. 33, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 10)
XX
DE   M.musculus mRNA for serotonin receptor.
XX
KW   serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1550
RX   DOI; 10.1016/0014-5793(92)80936-B.
RX   PUBMED; 1426253.
RA   Loric S., Launay J.M., Colas J.F., Maroteaux L.;
RT   "New mouse 5-HT2-like receptor. Expression in brain, heart and intestine";
RL   FEBS Lett. 312(2-3):203-207(1992).
XX
RN   [2]
RP   1-1550
RA   Maroteaux L.;
RT   ;
RL   Submitted (15-SEP-1992) to the INSDC.
RL   Luc Maroteaux, CNRS-LGME, INSERM-U184, Strasbourg Medical School, 11 rue
RL   Humann, Strasbourg, 67000, FRANCE
XX
DR   MD5; 3634550bb27048beb35e91d1d9c2bac4.
DR   Ensembl-Gn; ENSMUSG00000026228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027431; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1550
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="Adult"
FT                   /tissue_type="Brain"
FT                   /db_xref="taxon:10090"
FT   CDS             36..1550
FT                   /product="serotonin receptor"
FT                   /db_xref="GOA:Q02152"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000482"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109323"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02152"
FT                   /protein_id="CAA78824.1"
FT                   /translation="MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQT
FT                   VEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGL
FT                   FVMPIALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQAN
FT                   QCNTRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSL
FT                   AAFFVPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVA
FT                   MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFF
FT                   ITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYR
FT                   ATKSVKALRKFSSTLCFGNSMVENSKFFTKHGIRNGINPAMYQSPMRLRCSTIQSSSII
FT                   LLDTLLTENDGDKAEEQVSYILQERAGLILREGDEQDARAPWQVQE"
XX
SQ   Sequence 1550 BP; 416 A; 378 C; 338 G; 418 T; 0 other;
     actgtctgga actggactga gtcaccaaaa ggcgaatggc ttcatcttat aaaatgtctg        60
     aacaaagcac aacttctgag cacattttac agaagacatg tgatcacctg atcctgacta       120
     accgttctgg attagagaca gactcagtag cagaggaaat gaagcagact gtggagggac       180
     aggggcatac agtgcactgg gcagctctcc tgatactcgc ggtgataata cccaccattg       240
     gtgggaacat ccttgtgatt ctggctgttg cactggagaa aaggctgcag tacgctacca       300
     actacttttt aatgtccttg gcgatagcag atttgctggt tggattgttt gtgatgccga       360
     ttgccctctt gacaatcatg tttgaggcta tatggcccct cccactggcc ctgtgtcctg       420
     cctggttatt cctcgatgtt ctcttttcaa ctgcctccat catgcatctc tgtgccattt       480
     ccctggaccg ctatatagcc atcaaaaagc caattcaggc caatcagtgc aacacccggg       540
     ctactgcatt catcaagatt acagtggtat ggttaatttc aataggcatc gccatcccag       600
     tccctattaa aggaatcgag actgatgtga ttaatccaca caatgtcacc tgtgagctga       660
     caaaggaccg ctttggcagt tttatggtct ttgggtcact ggctgctttc ttcgtacctc       720
     tcaccatcat ggtagtcact tactttctca ccattcacac tttacagaag aaagcttact       780
     tggtcaaaaa taagccacct caacgcctaa cacggtggac tgtgcccaca gttttcctaa       840
     gggaagactc atccttttca tcaccagaaa aggtggcaat gctggatggg tctcacaggg       900
     ataaaattct acctaactca agtgatgaga cacttatgcg aagaatgtcc tcagttggaa       960
     aaagatcagc ccaaaccatt tctaatgagc agagagcctc gaaggccctt ggagtcgtgt      1020
     ttttcctttt tctgcttatg tggtgcccct tttttattac aaatctaact ttagctctgt      1080
     gtgattcctg caatcagacc actctcaaaa cactcctgga gatatttgtg tggataggct      1140
     acgtttcctc gggggtgaat cctctgatct atacactctt caataagaca tttcgggaag      1200
     catttggcag gtacatcacc tgcaattacc gagccacaaa gtcagtaaaa gcacttagga      1260
     agttttccag tacactttgt tttgggaatt caatggtaga aaactctaaa tttttcacaa      1320
     aacatggaat tcgaaatggg atcaaccctg ccatgtacca gagcccaatg aggctccgat      1380
     gttcaaccat tcagtcctca tcaatcatcc tcctcgatac ccttctcact gaaaacgatg      1440
     gcgacaaagc ggaagagcag gtcagctaca tattgcagga acgggccggc ctcatcttga      1500
     gagagggtga tgagcaggac gcacgcgcac catggcaggt tcaagagtga                 1550
//


spacer
spacer