Dbfetch

ID   Z14224; SV 1; linear; mRNA; STD; MUS; 1539 BP.
XX
AC   Z14224; S46903;
XX
DT   27-OCT-1992 (Rel. 33, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   M.musculus mRNA for 5HT1E beta serotonin receptor.
XX
KW   serotonin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1539
RX   PUBMED; 1328180.
RA   Amlaiky N., Ramboz S., Boschert U., Plassat J.L., Hen R.;
RT   "Isolation of a mouse "5HT1E-like" serotonin receptor expressed
RT   predominantly in hippocampus";
RL   J Biol Chem 267(28):19761-19764(1992).
XX
RN   [2]
RP   1-1539
RA   Hen R.;
RT   ;
RL   Submitted (30-JUL-1992) to the INSDC.
RL   R.Hen, Laboratoire de Genetique Moleculaire des Eucaryotes, 11 Rue Humann,
RL   Strasbourg, 67085, FRANCE
XX
DR   MD5; 5eeea09ac95898a2ed3bf56b22a2f59f.
DR   Ensembl-Gn; ENSMUSG00000050783; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022943; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022911; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022881; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022913; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022675; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023361; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022198; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022646; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022778; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022752; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022847; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022771; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023377; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021941; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022245; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000063076; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0044842; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0044823; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0044795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0044800; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0044539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0045282; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0044658; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0044453; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0044604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0044553; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0044678; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044533; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045336; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0044236; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0043908; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1539
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             310..1410
FT                   /product="5HT1E beta serotonin receptor"
FT                   /db_xref="GOA:Q02284"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000450"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02284"
FT                   /protein_id="CAA78593.1"
FT                   /translation="MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVI
FT                   AAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDI
FT                   ICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRH
FT                   QGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIK
FT                   EELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQ
FT                   KISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNS
FT                   LINPLIYTIFNEDFKKAFQKLVRCRY"
XX
SQ   Sequence 1539 BP; 438 A; 337 C; 355 G; 409 T; 0 other;
     gtcggcctcg agtggactgg cgtctggaac ccgccctaga gctgcgcccc aagctgcagc        60
     gcgcattcag ctcgccaccc aagaggcagc cgggacgcgc tgttgtcgcc agagaacgac       120
     cgcggcgggc tagggaccag agccccttag cttcgctctg gggaagctga gttgagatgg       180
     cattgaactg tgaatggctg actaatttct caccagatca ggaggtgaag tgagaatgaa       240
     gaccaacagt tgagcctgcc acaccacggt attcatttct tcaactatat taacatttta       300
     acaaaaaaaa tggatttttt aaacgcatca gaccaaaact tgacctctga ggaactgtta       360
     aaccgaatgc catccaaaat tctggtatcc ctcactctgt ctgggctggc attgatgaca       420
     accaccatca actccctcgt gatcgctgcg atcattgtga ctcggaagct gcaccaccca       480
     gccaactatt taatttgttc cttggcagtt acagattttc ttgtagctgt cctggtgatg       540
     cccttcagta ttgtgtacat tgtgagagag agctggatta tgggacaagt actctgtgac       600
     atttggctga gtgtcgacat catctgttgt acgtgttcca tcttgcatct gtcggctata       660
     gccttggata ggtaccgcgc catcacagat gcagttgaat acgccaggaa gaggactccc       720
     aggcatgccg gcatcatgat cacgatcgtg tgggttatat ctgtgttcat ctctatgcct       780
     cctctcttct ggaggcacca aggaactagc cgtgatgatg agtgtgtcat caaacatgac       840
     cacattgttt ccacaattta ctccacgttt ggagctttct acatcccgct tgtattgata       900
     ttgatcctct actacaaaat atacagagca gcaaggacac tgtaccacaa gagacaagcg       960
     agtcggatga taaaggagga gctgaacggt caagtcttct tggagagcgg tgagaagagc      1020
     attaaactgg tctccacatc ctacatgtta gaaaaatcct tgtccgatcc atcaacggac      1080
     tttgatagaa ttcacagcac cgtgaaaagt cccagatcgg aactgaagca tgagaaatct      1140
     tggagaagac agaaaatctc aggcaccaga gaacgcaaag cagccactac cctgggattg      1200
     atcttgggtg catttgtaat atgttggctg cccttttttg taaaagaatt ggttgttaat      1260
     gtctgtgaaa aatgtaaaat ttctgaagaa atgtcaaact ttttggcatg gcttggttac      1320
     ctgaattccc ttataaatcc actgatttat accatcttta atgaagactt caagaaagct      1380
     ttccaaaaac ttgtacgatg ccgatattag gataaaagaa acctaatttt aaagtgcgga      1440
     ggctttattt gttgggggga ggggcaggga taattaaatg aatgtaaagt aagaaaacat      1500
     ttaaattttt agagaaaata tattaaaact gctaaaatt                             1539
//