spacer

EBI Dbfetch

ID   Z14044; SV 1; linear; mRNA; STD; MUS; 3143 BP.
XX
AC   Z14044; S45829;
XX
DT   23-SEP-1992 (Rel. 33, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   M.musculus mRNA for valosin-containing protein.
XX
KW   CDC48 homologue; valosin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3143
RX   PUBMED; 1382975.
RA   Egerton M., Ashe O.R., Chen D., Druker B.J., Burgess W.H., Samelson L.E.;
RT   "VCP, the mammalian homolog of cdc48, is tyrosine phosphorylated in
RT   response to T cell antigen receptor activation";
RL   EMBO J. 11(10):3533-3540(1992).
XX
RN   [2]
RP   1-3143
RA   Samelson L.E.;
RT   ;
RL   Submitted (09-JUL-1992) to the INSDC.
RL   Lawrence E. Samelson, Cell Biology and Metabolism Branch, NICHD, NIH, Bldg.
RL   18T, Room 101, Bethesda, MD, 20892, USA
XX
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
DR   EuropePMC; PMC556811; 1382975.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3143
FT                   /organism="Mus musculus"
FT                   /strain="MRL/lpr"
FT                   /mol_type="mRNA"
FT                   /cell_type="t cell"
FT                   /db_xref="taxon:10090"
FT   CDS             162..2582
FT                   /product="murine valosin-containing protein"
FT                   /note="The protein sequence contains duplicated  domains
FT                   with nucleotide binding motifs.The protein  is a substrate
FT                   for tyrosine kinases. Gene is  S.cerevisiae CDC48
FT                   homologue."
FT                   /db_xref="GOA:Q01853"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="PDB:1E32"
FT                   /db_xref="PDB:1R7R"
FT                   /db_xref="PDB:1S3S"
FT                   /db_xref="PDB:2PJH"
FT                   /db_xref="PDB:3CF0"
FT                   /db_xref="PDB:3CF1"
FT                   /db_xref="PDB:3CF2"
FT                   /db_xref="PDB:3CF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01853"
FT                   /protein_id="CAA78412.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDVGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA
FT                   CKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIR
FT                   KYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
XX
SQ   Sequence 3143 BP; 828 A; 684 C; 856 G; 775 T; 0 other;
     gaattcatgt cttacggtca agggggaggc tgccagaggg tttgtcactg ctgttgctcc        60
     tccgcctcag cgagtccagc ccgggcctag tcggtcgcct gcctttctca tggccgttac       120
     cctcaggccg ccacagccgc cgaccgggag aggcgcgcgc catggcctct ggagccgatt       180
     caaaaggtga tgatttatca acagccattc tcaaacagaa gaaccgaccc aatcggttaa       240
     ttgttgatga agccatcaat gaagataaca gcgtggtgtc cttgtcccag cccaagatgg       300
     atgaactgca gttgttccga ggtgacacgg tgttgctaaa aggaaagaaa agacgggaag       360
     ctgtatgcat tgttctttct gatgacacgt gttctgatga gaagattcga atgaatagag       420
     ttgttcggaa taacctccga gttcgcctag gagatgtcat cagcatccag ccatgccctg       480
     atgtaaagta tggcaaacgt atccacgttc tacccatcga tgacacagtg gaaggcatca       540
     ctggcaatct ctttgaggta taccttaagc cgtacttcct ggaagcttat cggcccatcc       600
     gtaaaggaga tatttttctt gtccggggtg ggatgcgtgc tgtggagttc aaagttgtag       660
     agacagatcc cagcccttac tgtattgttg ctccagacac agtgatccac tgtgaggggg       720
     agccaatcaa acgagaggat gaggaggaat ccttgaatga agtaggctat gatgacgtcg       780
     gtggttgcag gaagcagcta gctcagataa aggagatggt ggagctgcca ctgagacatc       840
     ctgcgctctt caaggcgatt ggtgtaaagc ctcctcgggg aatcttgttg tatgggcctc       900
     ctgggacagg gaagaccctg attgctcgag ctgtggcaaa tgaaactgga gccttcttct       960
     ttctgatcaa tggtcctgaa atcatgagca aattggctgg tgagtctgag agcaaccttc      1020
     gtaaagcctt tgaggaagct gaaaagaatg ctcctgctat catcttcatc gatgagcttg      1080
     atgccattgc acccaaaaga gagaaaactc atggggaagt ggagcgtcgc atcgtgtctc      1140
     agttgttgac cctcatggat ggcctaaagc agagagcaca tgtgatagtt atggcagcaa      1200
     ccaatagacc caacagcatt gacccagccc tacggcgatt tggtcgcttt gacagagagg      1260
     tagatattgg aatacctgat gctacaggac gtttggagat tcttcagatc cataccaaga      1320
     acatgaaact ggcagatgat gtggacttgg aacaggtagc caatgagact catggtcatg      1380
     ttggtgctga tttggcagcc ctatgttcag aggctgctct gcaggccatc cggaaaaaaa      1440
     tggacctcat tgacctagaa gatgagacca ttgatgctga ggtcatgaat tccctggcag      1500
     ttactatgga tgacttccgg tgggctttga gtcaaagcaa cccatcagca cttcgggaaa      1560
     ctgtggtaga ggtgccacaa gtaacctggg aagatattgg aggcctggag gatgtcaaac      1620
     gtgagcttca ggagttggtt cagtaccccg tggaacatcc agacaaattc ctcaaatttg      1680
     gcatgactcc ctccaaaggt gttcttttct atggacctcc tggctgtggg aaaaccttac      1740
     tggctaaagc cattgctaat gaatgccagg ccaacttcat ctccatcaag ggtcctgagc      1800
     tgcttaccat gtggtttggg gaatctgagg ccaatgtccg ggaaattttt gacaaggcac      1860
     ggcaagctgc cccctgtgta ctcttctttg atgagttaga ttcaattgcc aaggctcgtg      1920
     gtggtaatat tggagatggt ggtggagctg ctgaccgagt catcaatcag atcttgacag      1980
     aaatggatgg catgtctaca aaaaagaatg tgtttatcat tggagctacc aacaggcctg      2040
     acatcattga tcctgctatc ctaagacctg gccgtctaga tcagctcatt tatatcccac      2100
     ttcctgatga gaagtcccgt gttgccatcc taaaagccaa tctgcgaaag tccccagttg      2160
     ccaaggatgt ggatttggag ttcctggcta agatgactaa tggcttttct ggagctgatt      2220
     tgacagaaat ttgccaacgg gcttgtaaac tggccattcg tgaatctatt gagagtgaga      2280
     ttaggcgaga acgagagagg cagacaaatc catcggctat ggaggtagaa gaggatgatc      2340
     cagtgcctga gatccgcaga gatcactttg aggaagccat gcgttttgcc cgacgttctg      2400
     tgagcgataa tgacattcgg aagtatgaaa tgttcgccca gacactgcag cagagtcgag      2460
     gttttggcag cttcagattc ccttcaggga accagggtgg agctggtccc agccagggca      2520
     gtggaggtgg cacaggtggc agtgtgtaca cagaagacaa tgacgatgac ctgtatggct      2580
     aagtgatgtg ccagcatgca gcgagctggc ctggctggac cttgttccct ggggaggggg      2640
     cgcttcgcaa gagggcccag gggtgtgccc atggcctgct ccattcctca gtctgaacag      2700
     ttcagcccag tcagactctg gacaggggtt tcctgttgca aaaaaaaaaa ttacaaaagc      2760
     gataaaataa aagtgatttt catttgggag gtgaagagtg aattaccagc aaggaattgg      2820
     gtcttgggcc cacacggttt ctgtcgtagt ttggggtggt gcaggtaacc tgtgtggtgt      2880
     gaaccaagca ttgccaccac catcaccaca gtaaagcatc tatactcaat gctgtccaag      2940
     tcctctctta ccctagccaa cctgggtagg tggatgaggg gcctcagttt gctgggtgtt      3000
     tatatagaaa gtaggttgat ttttatttta catgcttttg agttacgttg gaagactaat      3060
     cataagcagt ttctaaacca aaaaaaagaa aaaaaaaaaa aaagacatgt tgtaaaagga      3120
     caataaatgt tgggtcaaaa tgg                                              3143
//


spacer
spacer