spacer

EBI Dbfetch

ID   Y18365; SV 1; linear; mRNA; STD; MUS; 3001 BP.
XX
AC   Y18365;
XX
DT   03-MAR-1999 (Rel. 59, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for CD97 antigen
XX
KW   CD97 gene; CD97 protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1093/intimm/12.4.439.
RX   PUBMED; 10744645.
RA   Hamann J., Van Zventer C., Bijl A., Molenaar C., Tesselaar K.,
RA   van Lier R.A.W.;
RT   "Molecular cloning and characterization of mouse CD97";
RL   Int. Immunol. 12(4):439-448(2000).
XX
RN   [2]
RP   1-3001
RA   Hamann J.;
RT   ;
RL   Submitted (06-NOV-1998) to the INSDC.
RL   J. Hamann, Central Lab., Department of Immunobiology, CLB, Plesmanlaan 125,
RL   NL-1066 CX Amsterdam, NETHERLANDS
XX
DR   MD5; 8dd9ae8b6c0a229f773540f781df776e.
DR   Ensembl-Gn; ENSMUSG00000002885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002964; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3001
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /mol_type="mRNA"
FT                   /cell_type="splenocytes"
FT                   /db_xref="taxon:10090"
FT   CDS             33..2489
FT                   /gene="CD97"
FT                   /product="CD97 protein"
FT                   /db_xref="GOA:Q9Z0M6"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003056"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="MGI:MGI:1347095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0M6"
FT                   /protein_id="CAB38246.1"
FT                   /translation="MRSVRCPGLLVVCILLSLSGAGTQKAEIKNCAKWCPINSKCVSNR
FT                   SCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLL
FT                   SGAESFVNESENTCQASVNTGTTPVPSRIHTVTTAPGNLPEQTTTVHQTQMGDSEERTP
FT                   KDVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCEDVDECSSGQ
FT                   HQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPFPTWTLLPTAHSQTLLR
FT                   FSVEVQNLLRDFNPATVNYTIQKLIEAVDKLLEDPMETQTQQVAAQLLSNLEQSLRTLA
FT                   QFLPKGPFTYTSPSNTELSLMVKEQDNKDVTTVHHGQTWMELDWAVTAGAKISENGSSV
FT                   AGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPIPSVSLKLLSNINSVFLTNTNTEKL
FT                   ASNVTFKFDFTSVESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTSFAI
FT                   LMAQYHVQDPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFLGS
FT                   IIFLVGVENEGGEVGLRCRLVAMMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTW
FT                   QRCLIGYGVPLLIVAISMAVVKMDGYGHATYCWLDFRKQGFLWSFSGPVAFIIFCNAAI
FT                   FVITVWKLTKKFSEINPNMKKLRKARVLTITAIAQLLVLGCTWGFGLFLFNPHSTWLSY
FT                   IFTLLNCLQGLFLYVMLCLLNKKVREEYWKWACMVTGSKYTEFNSSTTGTGTSQTRALR
FT                   SSESGM"
FT   sig_peptide     33..95
FT                   /gene="CD97"
FT   mat_peptide     96..2486
FT                   /gene="CD97"
FT                   /product="CD97 protein"
XX
SQ   Sequence 3001 BP; 719 A; 850 C; 753 G; 679 T; 0 other;
     cccagacgct gtccgttccg tgccgcgcca ccatgaggag cgtcagatgc cccggcctgc        60
     ttgtggtgtg cattttactg agtctctcag gagctggaac ccagaaggca gagattaaga       120
     actgtgccaa gtggtgccct atcaactcaa aatgtgtcag taacagaagc tgtgtctgca       180
     agcccggctt cagctcggag aaggaattga tcactaaccc tgcagagagc tgtgaagaca       240
     tcaacgagtg tttactacct ggattttcct gtggagactt tgccatgtgt aagaactcag       300
     aggggagtta tacctgcgtc tgtaacctgg gatataagct cctttctggt gcagaatctt       360
     ttgttaacga gagtgagaat acatgtcaag catcagtgaa cactgggacg acacctgtgc       420
     cctccaggat ccacacagtt actactgcgc ctggaaatct ccccgagcag acaactacag       480
     tgcaccagac acagatggga gactcagaag agaggacacc caaggatgtg aatgagtgca       540
     tctccgggca aaaccattgc caccaatcca cccactgcat caacaaattg ggcggctatt       600
     cttgcatctg tcgtcaaggc tggaaacctg ttcctggatc ccccaatggc cctgtcagca       660
     cagtgtgcga agatgtggat gagtgcagct ctgggcagca tcaatgtcac aattccaccg       720
     tctgcaaaaa caccgtaggc tcctacaagt gccactgccg tccaggttgg aagccaactt       780
     ctgggtccct ccgtggtcca gacaccatat gccaagagcc accgttccct acttggacac       840
     tgctgcccac agcccacagt cagactctct tgagattctc tgttgaagtc cagaatctgc       900
     tccgagactt caatccagcc acggtcaact acaccatcca gaaactcatc gaggctgtgg       960
     acaagctgct ggaagacccc atggagactc aaacccaaca agtagctgcc cagttgctct      1020
     cgaacctgga acaaagcctt cggaccttgg cccagttctt acccaaaggc cccttcacct      1080
     acacgtcccc ttcaaatact gaactgtccc tgatggtgaa ggagcaagac aacaaagatg      1140
     ttaccacagt gcaccacggc caaacttgga tggagctgga ctgggctgtg acagctggag      1200
     ccaaaatctc agaaaatggc tcctcggtgg caggcatcct gtccagccca aacatggaaa      1260
     agctgctggg caacaccccg ctgaacttgg agcagagaag ggcctccttg gaggacttct      1320
     atggaagccc gattccgagc gtctcactta aacttctctc aaacatcaat tctgtcttcc      1380
     tgaccaacac gaacactgag aagcttgcct cgaatgtcac gttcaagttc gactttactt      1440
     ctgtggagtc aattgagcca cgtcacgagc tgatatgtgc cttctggaaa gcccacaacg      1500
     ggaatgggta ctgggacacc gacggctgct caatgaatgg cactggcttc tgccactgca      1560
     accacctgac cagctttgcc atcctaatgg ctcagtacca tgtgcaggac ccaaggctgg      1620
     aattgatcac caaggtgggg ctgttgttgt ccctgatctg cctgctgctg tgcatcctga      1680
     ccttcctgct ggtgaagccc atccagagct ctcgaaccat ggtgcacctg cacctgtgca      1740
     tctgcctctt cctgggctca atcatattcc tggtcggcgt ggagaatgaa gggggtgagg      1800
     tgggcctgcg ctgccgcctg gtggccatga tgctgcattt ctgcttcctg gccgccttct      1860
     gctggatggc actggagggc gtggagctct acttcctggt ggtgcgtgtg ttccagggcc      1920
     aaggcctgag tacatggcaa cgctgcctga ttggctacgg ggtgcccctc ctcatcgtgg      1980
     ccatctcaat ggcagttgtc aaaatggatg gctatgggca tgcaacatac tgctggctgg      2040
     actttaggaa gcagggcttt ctctggagct tttcgggacc cgtggccttc atcattttct      2100
     gcaatgctgc cattttcgtg atcactgtct ggaagctcac aaagaagttt tctgaaatca      2160
     acccaaacat gaagaagtta aggaaggcga gggtgctgac catcaccgcc atcgcccagc      2220
     tccttgtgct gggttgcacc tggggcttcg gcctgttcct cttcaacccc catagcacat      2280
     ggctatccta catctttacc ctgctcaact gcctgcaggg cctattcctc tatgtgatgc      2340
     tctgcctgct caacaaaaag gtgagggaag agtactggaa atgggcctgc atggtcactg      2400
     ggagcaagta cacagagttc aactcttcca caacaggcac tggcaccagc caaacacggg      2460
     ctctcaggtc ctcagaatca gggatgtgaa ggcgagttcc atgaaggaca gcagcacata      2520
     ctcacggctg tcatcctgcc ttctgttcct gccacctttc tgcctttgac cccacttcat      2580
     ataaagaagg gatgcaaacc cagcaatgag ccctgccacg gggcaagggg tcgctggtcc      2640
     tgcttctggt tgtctctgcc tcaccacagc tactgcctac cagagaaaca gaatgcagcc      2700
     agcccagacc tgcagcccac tgcctggtac acgaggcagg cagtcctagg acaaagggaa      2760
     gagcccttga gacctgggct ctttgccagg gtgctgggtt cagtttcctt aagctaagac      2820
     tgtggatgcc acgtcagcca ctgaagcccg cctgctgctg aggctcacgg tacagaggcc      2880
     tcgctgctcc acatccaggg cagaaggtct cacagctaaa gactaggttt tgtaattttt      2940
     ttaacctgta aacctttcaa tgttgacaca caaaattaaa tatcatattg ataaaaaaaa      3000
     a                                                                      3001
//


spacer
spacer