Dbfetch

ID   Y17709; SV 1; linear; mRNA; STD; MUS; 1686 BP.
XX
AC   Y17709;
XX
DT   02-JUN-1999 (Rel. 59, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus mRNA for frizzled receptor
XX
KW   frizzled receptor; FZD3 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RA   Calo L., Mimmack M.L., Keverne E.B., Emson P.C.;
RT   "Localization of the mouse frizzled gene mFZD3 in the olfactory epithelium
RT   and in the vomeronasal organ";
RL   Unpublished.
XX
RN   [2]
RP   1-1686
RA   Mimmack M.L.;
RT   ;
RL   Submitted (02-JUL-1998) to the INSDC.
RL   M.L. Mimmack, The Babraham Institute, Lab. of Molecular and Cognitive
RL   Neurosc., Department of Neurobiology, Babraham, Cambs, CB2 4AT, UK
XX
DR   MD5; 89fb9384b09bf95f725e2c8ef2baa9a5.
DR   Ensembl-Gn; ENSMUSG00000049551; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030146; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030079; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029872; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030609; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029281; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029842; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029993; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029948; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030081; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029980; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030649; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028996; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029355; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000062572; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0074915; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0074998; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0074900; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0074942; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074570; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0075411; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0075121; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0074519; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0074665; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0074567; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0074721; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074569; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075648; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074577; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0073697; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1686
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /clone_lib="VNO Lambda ZAPII"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1350
FT                   /codon_start=1
FT                   /gene="FZD3"
FT                   /product="frizzled receptor"
FT                   /db_xref="GOA:Q9R216"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:1313278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R216"
FT                   /protein_id="CAB44237.1"
FT                   /translation="STRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSA
FT                   PGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVKVFWSRRDKDFALVWMPVWSALCFFST
FT                   AFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQ
FT                   EGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWG
FT                   LPALKTIVFLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVA
FT                   LFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATE
FT                   QPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLC
FT                   YRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL"
XX
SQ   Sequence 1686 BP; 352 A; 477 C; 485 G; 372 T; 0 other;
     tccacgcgca acgacccgca cgcactctgt atggaggcac ccgagaacgc tacagcaggc        60
     cccacagaac cccacaaggg cctgggcatg ctccctgtgg cacctcggcc cgcgaggcca       120
     ccgggagatt cagccccagg tcccggcagc ggtggcacct gcgacaaccc cgagaagttc       180
     cagtacgtgg agaaaagtcg ctcgtgcgct ccgcgctgcg ggccaggcgt caaggtgttc       240
     tggtctcggc gcgataagga cttcgcgctg gtttggatgc ctgtgtggtc cgcgttgtgt       300
     ttcttctcca cggccttcac cgtgttcacc ttcctgctgg agcctcaccg gttccagtac       360
     ccagagcgcc cgattatctt cctttctatg tgctacaatg tctactcctt ggccttcctg       420
     atcagagcgg tggcaggtgc acagagtgtg gcatgcgacc aggaggcagg ggctctgtat       480
     gtgatccagg agggtctgga aaacacaggc tgcaccctgg tcttcctgtt gctctattat       540
     ttcgggatgg ccagctcact ttggtgggtg gttttgactc taacctggtt cctggctgca       600
     ggaaaaaaat ggggccacga ggccatcgag gctcacggca gctacttcca catggcagcg       660
     tggggcctgc cagcactcaa aactattgtg ttcctgactc tgcgcaaggt ggctggcgat       720
     gaactgactg ggctctgcta tgtagccagc atggacccgg cagccctcac tggctttgtg       780
     ttggtacccc tatcttgcta cctggtactg ggtaccagtt tcctcctgac cggttttgtg       840
     gctctcttcc atatccgcaa aatcatgaag acgggaggca ccaatacgga gaagctggag       900
     aagctgatgg tcaaaatcgg agtcttttcc atcctttaca cagtgccggc cacctgcgtc       960
     attgtctgct acgtttatga acgcctcaac atggacttct ggcggcttcg ggccacagag      1020
     caaccatgta ctgctgccac cgtgcctgga ggccggagag actgctcgct gccagggggc      1080
     tcggtgccca ctgtggctgt cttcatgctc aaaatcttca tgtccttggt ggtgggcatc      1140
     accagtggag tctgggtatg gagttccaag acttttcaga cttggcagag cctgtgctac      1200
     cgaaaaatgg cagctggccg agcccgggcc aaggcctgcc gaaccccagg gggctatggc      1260
     cggggtaccc actgccacta caaagccccc acggtggtct tgcacatgac taagacagac      1320
     ccctctctgg agaaccccac acacctctag aacataggct aggctgtgag ttatggttgc      1380
     tccctccttg ccctcccctc cccccttcag agacagctga ctaacagctg cccagctgtc      1440
     aaggtcagac aagtgagaca cagggggctg aggactaggg tggggaccca gtaaagctca      1500
     gggccttgac cttgtgtgtc atgcagggag tggtcctagt ccacagaggg tcccaggata      1560
     agaaggggca gaagggggca gggtccagtg cagagttatt taatgatgta atttattgtg      1620
     gcattttttt ggaagctgtg actggaataa accgtcgtgt ggcaaaaaaa aaaaaaaaaa      1680
     aaaaaa                                                                 1686
//