Dbfetch

ID   Y15004; SV 1; linear; mRNA; STD; MUS; 1904 BP.
XX
AC   Y15004;
XX
DT   02-OCT-1997 (Rel. 52, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for type I galanin receptor
XX
KW   G-protein coupled receptor; galanin receptor; galR1 gene; type I.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1016/S0014-5793(97)00695-9.
RX   PUBMED; 9271210.
RA   Wang S., He C., Maguire M.T., Clemmons A.L., Burrier R.E., Guzzi M.F.,
RA   Strader C.D., Parker E.M., Bayne M.L.;
RT   "Genomic organization and functional characterization of the mouse GalR1
RT   galanin receptor";
RL   FEBS Lett. 411(2-3):225-230(1997).
XX
RN   [2]
RP   1-1904
RA   Wang S.;
RT   ;
RL   Submitted (29-SEP-1997) to the INSDC.
RL   S. Wang, Schering-Plough Res. Inst., 2015 Galloping Hill Road,,
RL   Kenilworth,, WJ 07033, USA
XX
DR   MD5; 466b14bd7ea1431db663c0b719f5b999.
DR   Ensembl-Gn; ENSMUSG00000024553; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024600; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024567; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024538; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024565; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024334; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025012; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023807; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024304; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024434; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024400; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024518; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024430; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025061; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023552; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023869; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000065224; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050217; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050193; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050153; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050147; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049890; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050636; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050025; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049823; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049917; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049888; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050043; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049889; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049617; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049183; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1904
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..321
FT                   /gene="galR1"
FT   CDS             322..1368
FT                   /gene="galR1"
FT                   /product="galanin receptor"
FT                   /db_xref="GOA:P56479"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000405"
FT                   /db_xref="InterPro:IPR003906"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1096364"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56479"
FT                   /protein_id="CAA75237.1"
FT                   /translation="MELAMVNLSEGNGSDPEPPAPESRPLFGIGVENFITLVVFGLIFA
FT                   MGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLG
FT                   AFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALS
FT                   IAMASPVAYHQRLFHRDSNQTFCWEQWPNKLHKKAYVVCTFVFGYLLPLLLICFCYAKV
FT                   LNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVVHLWAEFGAFPLTPASF
FT                   FFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHVCDESPRSETKENKSRMDTP
FT                   PSTNCTHV"
FT   3'UTR           1369..1904
FT                   /gene="galR1"
FT   regulatory      1727..1733
FT                   /gene="galR1"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1904 BP; 423 A; 527 C; 476 G; 478 T; 0 other;
     cctagacccg tacctctgtg ttctggagcc tgccgccccc gcacgggaaa ggcttagctc        60
     gggacttgca gcaccgcctc ctctttagcc aggccaggca cgaggatagt gtgatcgggc       120
     acagccaggg tcgctcttcc aggctttctt gcgggttgcg ggaggtacta gttggagacg       180
     cgcgcgctcg ctctcgccgc tctgtcctgg gccactccgt gatcctaggc tacctccaga       240
     gccagttttc cctggctggc acaactctcc agggcgctcc ggtccgttgc acagcgcccc       300
     aagggggtat cccagtaagt gatggaactg gctatggtga acctcagtga agggaatggg       360
     agcgacccag agccgccagc cccggagtcc aggccgctct tcggcattgg cgtggagaac       420
     ttcattacgc tggtagtgtt tggcctgatt ttcgcgatgg gcgtgctggg caacagcctg       480
     gtgatcaccg tgctggcgcg cagcaaacca ggcaagccgc gcagcaccac caacctgttt       540
     atcctcaatc tgagcatcgc agacctggcc tacctgctct tctgcatccc ttttcaggcc       600
     accgtgtatg cactgcccac ctgggtgctg ggcgccttca tctgcaagtt tatacactac       660
     ttcttcaccg tgtccatgct ggtgagcatc ttcaccctgg ccgcgatgtc tgtggatcgc       720
     tacgtggcca ttgtgcactc gcggcgctcc tcctccctca gggtgtcccg caacgcactg       780
     ctgggcgtgg gcttcatctg ggcgctgtcc atcgccatgg cctcgccggt ggcctaccac       840
     cagcgtcttt tccatcggga cagcaaccag accttctgct gggagcagtg gcccaacaag       900
     ctccacaaga aggcttacgt ggtgtgcact ttcgtctttg ggtaccttct gcccttactg       960
     ctcatctgct tttgctatgc caaggtcctt aatcatctgc ataaaaagct gaaaaacatg      1020
     tcaaaaaagt ctgaagcatc caagaaaaag actgcacaga ccgtcctggt ggtcgttgta      1080
     gtatttggca tatcctggct gccccatcat gtcgtccacc tctgggctga gtttggagcc      1140
     ttcccactga cgccagcttc cttcttcttc agaatcaccg cccattgcct ggcatacagc      1200
     aactcctcag tgaaccccat catatatgcc tttctctcag aaaacttccg gaaggcgtac      1260
     aagcaagtgt tcaagtgtca tgtttgcgat gaatctccac gcagtgaaac taaggaaaac      1320
     aagagccgga tggacacccc gccatccacc aactgcaccc acgtgtgaag gtttgcggga      1380
     gcctcccgac ttccagctcc catgtgtgtt agagagagga gggcggagcg aattatcaag      1440
     taacatggca gcttattctc cacagcaatt cctatcgatc caactacatt ccacagtggt      1500
     aaaaggacgt tgattgttca gggaactcgt gggtctactg aagatcattt tccaatttca      1560
     ttttactcta taattgtata tatgagacaa aagaaacttc tgtatagttt ctagctctca      1620
     aggaatgaaa gtcctacagc actctgcaaa tgttttgatc tccatggtgt aaagtaagtt      1680
     ctgtaaagca gagaataata tttgaaatcc acattttcag gccagttaat atagggaaaa      1740
     agttcttttt aaaaaaaaat ttgagaggag aggtaatagt ctagtctgtg ctttgaaata      1800
     caactgtggg cacagaatag tgatttttat tttattgaac ctttgtggac cggcacctca      1860
     tctgagtcgt gggtgtccat aagtctgtct ggggatgtga gacc                       1904
//