spacer

EBI Dbfetch

ID   Y13192; SV 1; linear; mRNA; STD; MUS; 2356 BP.
XX
AC   Y13192;
XX
DT   20-MAY-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus mRNA for neurotrypsin
XX
KW   neurotrypsin; serine protease.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1006/mcne.1997.0616.
RX   PUBMED; 9245503.
RA   Gschwend T.P., Krueger S.R., Kozlov S.V., Wolfer D.P., Sonderegger P.;
RT   "Neurotrypsin, a novel multidomain serine protease expressed in the nervous
RT   system";
RL   Mol. Cell. Neurosci. 9(3):207-219(1997).
XX
RN   [2]
RP   1-2356
RA   Sonderegger P.;
RT   ;
RL   Submitted (15-MAY-1997) to the INSDC.
RL   P. Sonderegger, University of Zurich, Institute of Biochemistry,
RL   Winterthurerstrasse 190, 8057 Zurich, ZH, SWITZERLAND
XX
DR   MD5; 61882651f89276d1c2edf56cf427ed88.
DR   Ensembl-Gn; ENSMUSG00000027978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029603; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2356
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             24..2309
FT                   /product="neurotrypsin"
FT                   /db_xref="GOA:O08762"
FT                   /db_xref="InterPro:IPR000001"
FT                   /db_xref="InterPro:IPR001190"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="InterPro:IPR017448"
FT                   /db_xref="InterPro:IPR018056"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="MGI:MGI:1100881"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08762"
FT                   /protein_id="CAA73646.1"
FT                   /translation="MALARCVLAVILGALSVVARADPVSRSPLHRPHPSPPRSQHAHYL
FT                   PSSRRPPRTPRFPLPLRIPAAQRPQVLSTGHTPPTIPRRCGAGESWGNATNLGVPCLHW
FT                   DEVPPFLERSPPASWAELRGQPHNFCRSPDGSGRPWCFYRNAQGKVDWGYCDCGQGPAL
FT                   PVIRLVGGNSGHEGRVELYHAGQWGTICDDQWDNADADVICRQLGLSGIAKAWHQAHFG
FT                   EGSGPILLDEVRCTGNELSIEQCPKSSWGEHNCGHKEDAGVSCVPLTDGVIRLAGGKST
FT                   HEGRLEVYYKGQWGTVCDDGWTEMNTYVACRLLGFKYGKQSSVNHFDGSNRPIWLDDVS
FT                   CSGKEVSFIQCSRRQWGRHDCSHREDVGLTCYPDSDGHRLSPGFPIRLVDGENKKEGRV
FT                   EVFVNGQWGTICDDGWTDKHAAVICRQLGYKGPARARTMAYFGEGKGPIHMDNVKCTGN
FT                   EKALADCVKQDIGRHNCRHSEDAGVICDYLEKKASSSGNKEMLSSGCGLRLLHRRQKRI
FT                   IGGNNSLRGAWPWQASLRLRSAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAV
FT                   RVGDYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPA
FT                   CLPLWRERPQKTASNCHITGWGDTGRAYSRTLQQAAVPLLPKRFCKERYKGLFTGRMLC
FT                   AGNLQEDNRVDSCQGDSGGPLMCEKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVP
FT                   WIKSVTSL"
FT   sig_peptide     24..86
FT                   /product="neurotrypsin"
FT   mat_peptide     87..2306
FT                   /product="neurotrypsin"
FT   polyA_signal    2324..2329
FT   polyA_signal    2331..2336
FT                   /note="for alternate longer transcript"
XX
SQ   Sequence 2356 BP; 569 A; 586 C; 708 G; 493 T; 0 other;
     ggaccacact cggcgccgca gccatggcgc tcgcccgctg cgtgctggct gtgattttag        60
     gggcactgtc tgtagtggcc cgcgctgatc cggtctcgcg ctctcccctt caccgcccgc       120
     atccgtcccc accgcgttcc caacacgcgc actaccttcc cagctcgcgg cggccaccca       180
     ggaccccgcg cttcccgctc ccgctgcgga tccccgctgc ccagcgcccg caggtcctca       240
     gcaccgggca cacgcccccg acgattccac gccgctgcgg ggcaggagag tcgtggggca       300
     atgccaccaa cctcggcgtc ccgtgtctac actgggacga ggtgccgccc ttcctggagc       360
     ggtcgccccc ggccagttgg gctgagctgc gagggcagcc gcacaacttc tgccggagcc       420
     cggatggctc gggcagacct tggtgcttct atcggaatgc ccagggcaaa gtagactggg       480
     gctactgcga ttgtggtcaa ggcccggcgt tgcccgtcat tcgccttgtt ggtgggaaca       540
     gtgggcatga aggtcgagtg gagctgtacc acgctggcca gtgggggacc atctgtgacg       600
     accaatggga caatgcagac gcagacgtca tctgtaggca gctggggctc agtggcattg       660
     ccaaagcatg gcatcaggca cattttgggg aaggatctgg cccaatattg ttggatgaag       720
     tacgctgcac cggaaacgag ctgtcaattg agcaatgtcc aaagagttcc tggggcgaac       780
     ataactgtgg ccataaagaa gatgctggag tgtcttgtgt tcctctaaca gatggtgtca       840
     tcagactggc aggaggaaaa agtacccatg aaggtcgcct ggaggtctac tacaaggggc       900
     agtgggggac agtctgtgat gatggctgga ctgagatgaa cacatacgtg gcttgtcgac       960
     tgctgggatt taaatacggc aaacagtcct ctgtgaacca ttttgatggc agcaacaggc      1020
     ccatatggct ggatgacgtc agctgctcag gaaaagaagt cagcttcatt cagtgttcca      1080
     ggagacagtg gggaaggcat gactgcagcc atagagaaga tgtgggcctc acctgctatc      1140
     ctgacagcga tggacatagg ctttctccag gttttcccat cagactagtg gatggagaga      1200
     ataagaagga aggacgagtg gaggtttttg tcaatggcca atggggaaca atctgcgatg      1260
     acggatggac cgataagcat gcagctgtga tctgccggca acttggctat aagggtcctg      1320
     ccagagcaag gactatggct tattttgggg aaggaaaagg ccccatccac atggataatg      1380
     tgaagtgcac aggaaatgag aaggccctgg ctgactgtgt caaacaagac attggaaggc      1440
     acaactgccg ccacagtgag gatgcaggag tcatctgtga ctatttagag aagaaagcat      1500
     caagtagtgg taataaagag atgctctcat ctggatgtgg actgaggtta ctgcaccgtc      1560
     ggcagaaacg gatcattggt gggaacaatt ctttaagggg tgcctggcct tggcaggctt      1620
     ccctcaggct gaggtcggcc catggagacg gcaggctgct ttgtggagct acccttctga      1680
     gtagctgctg ggtcctgaca gctgcacact gcttcaaaag gtacggaaac aactcgagga      1740
     gctatgcagt tcgagttggg gattatcata ctctggtccc agaggagttt gaacaagaaa      1800
     taggggttca acagattgtg attcacagga actacaggcc agacagaagc gactatgaca      1860
     ttgccctggt tagattgcaa ggaccagggg agcaatgtgc cagactaagc acccacgttt      1920
     tgccagcctg tttacctcta tggagagaga ggccacagaa aacagcctcc aactgtcaca      1980
     taacaggatg gggagacaca ggtcgtgcct actcaagaac tctacaacaa gctgctgtgc      2040
     ctctgttacc caagaggttt tgtaaagaga ggtacaaggg actatttact gggagaatgc      2100
     tctgtgctgg gaacctccaa gaagacaacc gtgtggacag ctgccaggga gacagtggag      2160
     gaccactcat gtgtgaaaag cctgatgagt cctgggttgt gtatggggtg acttcctggg      2220
     ggtatggatg tggagtcaaa gacactcctg gagtttatac cagagtcccc gcttttgtac      2280
     cttggataaa aagtgtcacc agtctgtaac ttatggaaag ctcaagaaat agtaaaacag      2340
     taactattca gtcttc                                                      2356
//


spacer
spacer