Dbfetch

ID   Y13185; SV 1; linear; mRNA; STD; MUS; 1744 BP.
XX
AC   Y13185;
XX
DT   14-JAN-1998 (Rel. 54, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for stromelysin-2
XX
KW   MMP-10 gene; stromelysin-2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1016/S0378-1119(97)00456-3.
RX   PUBMED; 9427548.
RA   Madlener M., Werner S.;
RT   "cDNA cloning and expression of the gene encoding murine stromelysin-2
RT   (MMP-10)";
RL   Gene 202(1-2):75-81(1997).
XX
RN   [2]
RP   1-1744
RA   Madlener M.;
RT   ;
RL   Submitted (15-MAY-1997) to the INSDC.
RL   M. Madlener, Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a,
RL   D-82152 Martinsried, FRG
XX
DR   MD5; bd124025ee4b837a9b0425ba4fb19814.
DR   Ensembl-Gn; ENSMUSG00000047562; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034323; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034301; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034229; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034006; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033334; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033979; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034081; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034222; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034836; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033037; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033449; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034488; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091111; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091186; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091128; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091116; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090687; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091257; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090617; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0090832; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090664; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0090851; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090687; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0091952; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090695; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089720; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1744
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..41
FT                   /gene="MMP-10"
FT   sig_peptide     42..92
FT                   /gene="MMP-10"
FT   CDS             42..1472
FT                   /gene="MMP-10"
FT                   /product="stromelysin 2"
FT                   /EC_number="3.4.24.22"
FT                   /db_xref="GOA:O55123"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:97007"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55123"
FT                   /protein_id="CAA73641.1"
FT                   /translation="MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFK
FT                   KNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFP
FT                   GSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISF
FT                   AVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGH
FT                   SLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSP
FT                   RPETPDKCDPALSFDSVSTLRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLD
FT                   AAYEAHNTDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKT
FT                   YFFVGDKYWRFDETRHVMDKGFPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFD
FT                   PNARTVTHILKSNSWLLC"
FT   mat_peptide     339..1469
FT                   /gene="MMP-10"
FT                   /product="stromelysin 2"
FT                   /EC_number="3.4.24.22"
FT   3'UTR           1473..1744
FT                   /gene="MMP-10"
XX
SQ   Sequence 1744 BP; 496 A; 396 C; 397 G; 455 T; 0 other;
     ggcacgagga aggatcggtt tttaaagtaa agactgtctg tatggagcca ctagccatcc        60
     tggcactgct gagcctacca atctgctcag cgtatcctct gcatggggca gtgacacaag       120
     gccacccaag catggatctt gctcagcaat acctagaaaa atactacaac tttaaaaaaa       180
     atgagaaaca aattttcaaa agaaaggaca gtagtcctgt tgtcaaaaaa attcaagaaa       240
     tgcagaagtt cctcgggttg gagatgacag ggaagctgga ctccaacact atggagctga       300
     tgcacaagcc caggtgtggt gttcctgatg ttggtggctt cagtaccttc ccaggttcgc       360
     caaaatggag gaaatcccac atcacctaca ggattgtgaa ttatacacca gatttgccaa       420
     gacagagtgt ggattctgcc attgagaaag ctttgaaggt ctgggaggag gtgaccccac       480
     tcactttctc caggatctct gaaggagagg ctgacataat gatctccttt gcagttggag       540
     aacacggaga cttttaccct tttgatgggc caggacagag tctggctcat gcctacccac       600
     ctggccctgg attttatgga gatgttcact tcgatgatga tgagaaatgg acacttgcac       660
     cctcagggac caacttattc ctggttgcag cccatgaact tggccactcc ctgggtctct       720
     ttcattccga caagaaagaa tctctgatgt acccagtcta caggttctcc acaagcccag       780
     ctaacttcca cctttctcaa gatgatatag agggcattca atccctgtat ggagccggtc       840
     cctcctccga tgccacagtg gttcctgtgt tgtctgtctc tccaagacct gagaccccag       900
     acaaatgtga tcctgctttg tcctttgatt cagtcagcac gctgagaggg gaagtcctat       960
     tctttaaaga caggtacttc tggcgcagat cccattggaa tcccgagcct gaatttcatt      1020
     tgatatcagc attttggccc actcttcctt cagacttaga tgctgcctat gaggctcaca      1080
     acacggacag tgttctgatt tttaaaggaa gtcagttctg ggcagtccga ggaaatgaag      1140
     tccaagcagg ctacccaaag gggatccaca ctctcggttt tcctcccacc gtgaagaaga      1200
     ttgatgcagc tgtttttgaa aaggagaaga agaaaacgta cttctttgta ggggacaaat      1260
     actggagatt tgatgagaca agacatgtta tggataaagg cttcccaaga cagataacag      1320
     atgattttcc aggaattgag ccacaagttg atgctgtgtt acacgaattt gggttttttt      1380
     atttcttccg aggatcatca cagttcgagt ttgaccccaa tgccaggacg gtgacacaca      1440
     tactgaagag caacagctgg ctgctgtgct gatcatcatg acaagacata tacaaccctg      1500
     taaaatgagt ctcatgactt cccacctact ttattatgtg tcagaatgat tagttgctcc      1560
     tgcatgttct gtggctccgg atgagcgcag cagatgtctt tcataatgag tcacaaagca      1620
     tcacctgagc acagaagtga aattttctca ctgcagtagg tgagaggatg catccatccc      1680
     catgggtatt ttattattta ataaagagct ttatttttga aaaaaaaaaa aaaaaaaaaa      1740
     aaaa                                                                   1744
//