spacer

EBI Dbfetch

ID   Y13090; SV 1; linear; mRNA; STD; MUS; 2228 BP.
XX
AC   Y13090;
XX
DT   12-MAY-1997 (Rel. 51, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   M.musculus mRNA for caspase-12
XX
KW   caspase-12; cysteine protease.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1016/S0014-5793(97)00026-4.
RX   PUBMED; 9038361.
RA   Van de Craen M., Vandenabeele P., Declercq W., Van den Brande I.,
RA   Van Loo G., Molemans F., Schotte P., Van Criekinge W., Beyaert R.,
RA   Fiers W.;
RT   "Characterization of seven murine caspase family members";
RL   FEBS Lett. 403(1):61-69(1997).
XX
RN   [2]
RP   1-2228
RA   Van de Craen M.;
RT   ;
RL   Submitted (07-MAY-1997) to the INSDC.
RL   M. Van de Craen, University of Gent, Laboratory of Molecular Biology, K.L.
RL   Ledeganckstraat 35, B-9000 Gent, BELGIUM
XX
DR   MD5; 0bd94c24e8326216b95ac190efecb17f.
DR   CABRI; LMBP 3820.
DR   Ensembl-Gn; ENSMUSG00000025887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027009; mus_musculus.
DR   EuropePMC; PMC2198828; 11591730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2228
FT                   /organism="Mus musculus"
FT                   /strain="C3H/An"
FT                   /mol_type="mRNA"
FT                   /cell_line="L929r2"
FT                   /cell_type="fibrosarcoma"
FT                   /db_xref="taxon:10090"
FT   CDS             34..1293
FT                   /standard_name="casp-12"
FT                   /product="caspase-12"
FT                   /function="cysteine protease"
FT                   /db_xref="GOA:O08736"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR017350"
FT                   /db_xref="MGI:MGI:1312922"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08736"
FT                   /protein_id="CAA73532.1"
FT                   /translation="MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIG
FT                   ESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSS
FT                   PSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAK
FT                   EIYPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQ
FT                   EMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNS
FT                   NCRSLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVET
FT                   DFIAFKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELT
FT                   QMPTIERVSMTRYFYLFPGN"
XX
SQ   Sequence 2228 BP; 753 A; 396 C; 432 G; 647 T; 0 other;
     ggcacgagcg gcacgagcgg cacgagcaca gccatggcgg ccaggaggac acatgaaaga        60
     gatccaatct acaagatcaa aggtttggcc aaggacatgc tggatggggt ttttgatgac       120
     ctggtggaga agaatgtttt aaatggagat gagttactca aaatagggga aagtgcgagt       180
     ttcatcctga acaaggctga gaatctggtt gagaacttct tagagaaaac agacatggca       240
     ggaaaaatat ttgctggcca cattgccaat tcccaggaac agctgagttt acaattttct       300
     aatgatgagg atgatggacc tcagaagata tgtacacctt cttctccatc agaatccaag       360
     agaaaagtag aggatgatga aatggaggta aatgctggat tggcccatga atcacatcta       420
     atgctgacag ctcctcatgg actccagagc tcagaagtcc aagatacact gaagctttgt       480
     ccacgtgatc agttttgtaa gataaagaca gaaagggcaa aagagatata tccagtgatg       540
     gagaaggagg gacgaacacg tctggctctc atcatctgca acaaaaagtt tgactacctt       600
     tttgatagag ataatgctga tactgacatt ttgaacatgc aagaactact tgaaaatctt       660
     ggatactctg tggtgttaaa ggaaaacctt acagctcagg aaatggagac agagttaatg       720
     cagtttgctg gccgtccaga gcaccagtcc tcagacagca cattcctggt gtttatgtcc       780
     catggcatcc tggaaggaat ctgtggggtg aagcaccgaa acaaaaagcc agatgttctt       840
     catgatgaca ctatcttcaa aattttcaac aactctaact gtcggagtct gagaaacaaa       900
     cccaagattc tcatcatgca ggcctgcaga ggcagatata atggaactat ttgggtatcc       960
     acaaacaaag ggatagccac tgctgataca gatgaggaac gtgtgttgag ctgtaaatgg      1020
     aataatagta taacaaaggc ccatgtggag acagatttca ttgctttcaa atcttctacc      1080
     ccacataata tttcttggaa ggtaggcaag actggttccc tcttcatttc caaactcatt      1140
     gactgcttca aaaagtactg ttggtgttat catttggagg aaatttttcg aaaggttcaa      1200
     cactcatttg aggtcccagg tgaactgacc cagatgccca ctattgagag agtatccatg      1260
     acacgctatt tctacctttt tcccgggaat tagcacaggc aactctcatg cagttcccag      1320
     tcaagtattg ctgtagctga gaagaaaaga aaattccaag atcccaggat ttttaaatgt      1380
     gtaaaacttt tcagttagat attttataca atatcataag gctagataat ttccataggt      1440
     tatttttagg ggaaacctga tacgtaaaat tttgcatgaa aagtatagat tcgttccttc      1500
     cttccaaatc tgctcatctt ttactttatt ttattaaatt tatatttgca catttttgta      1560
     aaatgaataa aggaaaaaga cactaaagaa catgtctgaa catatcctgg aacttcttct      1620
     ttgtaaaatg aataaaggaa aaagacacta aagaacaaag atgatacacc ttttgatgaa      1680
     ccactttcac ctataaatta gtagtaagaa tttactcaca aggaagatct tatctacaat      1740
     gtagctgaga aatgaaactg ttgcatatgt aggtaaaact aatcatcttt taggaataag      1800
     ataaagaggt ttatgtccac tgtttgtctc tggcatacat ggttttcatg cctagtggct      1860
     acctaccatt cctttcaatc aatttcttag gatataattg acaaatttat gctatgttta      1920
     taatttttct cttaaatgcc tttgtaataa gatatactca cacatacaca tttaagattc      1980
     tgtctattag tgttattgaa ataaatccta gaaacaaaaa ttaaaagttt aaagcattaa      2040
     agacaatttt gagacaaaat attctatgaa attctatgca aaattgaatt cttctacaag      2100
     tatgtgatga agcccaccta ccactatttt tgtcatcttg aggatgttat atcattattt      2160
     ttacttaact gagctcaaat taaaatcttt gtttattctt tgttctataa aaaaaaaaaa      2220
     aaaaaaaa                                                               2228
//


spacer
spacer