spacer

EBI Dbfetch

ID   Y12004; SV 1; linear; mRNA; STD; MUS; 1787 BP.
XX
AC   Y12004;
XX
DT   01-MAY-1998 (Rel. 55, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   M.musculus mRNA for receptor LR11/gp250 homologue, partial
XX
KW   LR11; mosaic protein; receptor-like protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RA   Boehmelt G., Antonio L., Iscove N.N.;
RT   ;
RL   Unpublished.
XX
RN   [2]
RP   1-1787
RA   Boehmelt G.;
RT   ;
RL   Submitted (24-MAR-1997) to the INSDC.
RL   G. Boehmelt, Ontario Cancer Institute, Medical Biophysics, 610 University
RL   Avenue, Toronto, Ontario, M5G 2M9, CANADA
XX
DR   MD5; c27d42bc9616f36eed9426989f169f06.
DR   Ensembl-Gn; ENSMUSG00000049313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060989; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1787
FT                   /organism="Mus musculus"
FT                   /strain="swiss webster/NIH"
FT                   /isolate="Matchmaker cDNA Library"
FT                   /mol_type="mRNA"
FT                   /dev_stage="whole embryo, day 11"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>1787
FT                   /codon_start=1
FT                   /product="putative LR11/gp250 receptor protein"
FT                   /db_xref="GOA:O88307"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="MGI:MGI:1202296"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88307"
FT                   /protein_id="CAA72732.1"
FT                   /translation="ADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEF
FT                   NCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDA
FT                   DCQDGSDEDPVSCEKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDEQHCEPFCTRFMDF
FT                   VCKNRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGFQCQNGVCISL
FT                   IWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSD
FT                   EKDCGDSHVLPSPTPGPSTCLPNYFRCSSGACVMGTWVCDGYRDCADGSDEEACPSLAN
FT                   STAASTPTQLGQCDRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCTSR
FT                   EFKCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWM
FT                   RPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKV
FT                   HNTNDFVTLRTPEGLPDAPRNLQLSLNREEEGVILGHWAPPVHTHGLIREYIVEYSRSG
FT                   SKMWASQRAASNSTKKKKK"
XX
SQ   Sequence 1787 BP; 430 A; 479 C; 507 G; 371 T; 0 other;
     gcagacactc agttccggtg ccaggagtcg gggacttgca ttccactctc ctataagtgt        60
     gaccttgaag atgactgtgg agataacagt gatgagagtc actgtgagat gcaccagtgt       120
     cgtagcgacg agttcaactg cagctctggg atgtgcatcc ggtcctcctg ggtgtgtgat       180
     ggagacaacg actgtaggga ctggtctgat gaagccaact gtactgccat ctatcatacc       240
     tgtgaggcct ccaacttcca gtgccacaat ggccactgca tcccccagcg atgggcatgt       300
     gacggtgatg cggattgcca ggatggctct gatgaagatc ccgtcagctg tgagaaaaag       360
     tgcaacggat tccactgccc aaacggcacg tgcatcccgt ccagcaagca ttgtgatggg       420
     ctgagggact gccccgacgg ctccgatgag cagcactgtg agcccttctg cacgcgcttc       480
     atggacttcg tgtgtaagaa ccgtcagcag tgtctgttcc actccatggt gtgtgacggg       540
     atcgtccagt gccgagatgg ctctgatgag gatgcggcct tcgctggatg ctcgcaagac       600
     cccgagttcc acaaggagtg cgatgagttc ggcttccagt gtcagaacgg agtgtgcatc       660
     agcttgattt ggaaatgcga tgggatggat gactgcgggg actactctga cgaggccaac       720
     tgtgaaaacc ccacagaagc cccaaactgt tcccgttact ttcagttcca ctgtgagaat       780
     ggccactgca tccccaacag gtggaaatgt gacagagaga acgactgtgg ggactggtct       840
     gatgagaagg attgtggaga ttcacatgtt ctgccctccc cgacccccgg gccctccacg       900
     tgtctgccca attacttccg ctgcagcagc ggggcctgtg tgatgggcac ctgggtgtgc       960
     gacggctaca gggactgtgc agatggctct gatgaggagg cctgcccctc tctagcaaac      1020
     tccactgccg cctccactcc cacccagctc gggcagtgcg accgatttga gttcgagtgt      1080
     caccaaccaa agaaatgtat ccccaactgg aagcgctgtg acggccacca agattgccaa      1140
     gacggccagg atgaagccaa ctgccccact cacagcacct tgacctgtac gagcagggag      1200
     ttcaagtgtg aggacggcga ggcatgcatc gtgctctcag agcgctgtga tggcttcctg      1260
     gattgctccg atgagagcga tgagaaggcc tgcagcgatg agttaactgt atacaaagtg      1320
     cagaatctcc agtggacagc tgatttctcc ggggatgtga ctttgacctg gatgcggcca      1380
     aagaaaatgc catctgcttc ttgtgtatac aatgtctact acagggtggt tggagagagc      1440
     atatggaaga ccctggaaac ccacagcaat aaaacaagca ctgtgctcaa ggtcctgaag      1500
     ccagacacca cgtaccaggt taaggtccag gtgcactgcc tcaacaaggt gcacaacacc      1560
     aatgactttg tgaccctcag gactccagaa gggttgccag atgcccctcg gaatctccag      1620
     ctctccctga acagggaaga ggaaggtgtg attctcgggc actgggctcc tcccgtccac      1680
     acccatggcc tcatccgtga gtacattgtg gaatacagca ggagtgggtc caagatgtgg      1740
     gcctcccaga gagctgctag caactctaca aaaaaaaaaa aaaaaaa                    1787
//


spacer
spacer