Dbfetch

ID   Y10656; SV 1; linear; mRNA; STD; MUS; 2459 BP.
XX
AC   Y10656;
XX
DT   01-MAY-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   M.musculus mRNA for calpain-like protease
XX
KW   calpain-like protease; Capn5 gene.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [2]
RP   1-2459
RA   Dear T.N.;
RT   ;
RL   Submitted (20-JAN-1997) to the INSDC.
RL   T.N. Dear, Deutsches Krebsforschungszentrum, Abteilung 425, Im
RL   Neuenheimerfeld 280, D-69120 Heidelberg, FRG
XX
RN   [3]
RP   1-2459
RX   DOI; 10.1006/geno.1997.4870.
RX   PUBMED; 9339374.
RA   Dear T.N., Matena K., Vingron M., Boehm T.;
RT   "A new subfamily of vertebrate calpains lacking a calmodulin-like domain:
RT   implications for calpain regulation and evolution";
RL   Genomics 45(1):175-184(1997).
XX
DR   MD5; 473acc5a323d5f55b88030f98ea52932.
DR   Ensembl-Gn; ENSMUSG00000035547; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032534; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032508; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032444; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032519; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032234; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033017; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031561; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032201; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032353; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032309; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032342; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033039; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031279; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031678; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000040971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107112; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085081; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085148; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085099; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085120; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084689; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085626; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085209; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0084626; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0084816; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0084673; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0084852; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084720; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085901; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084631; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083742; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2459
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /germline
FT                   /db_xref="taxon:10090"
FT   exon            1..358
FT                   /gene="Capn5"
FT                   /number=1
FT   CDS             194..2116
FT                   /gene="Capn5"
FT                   /product="calpain-like protease"
FT                   /db_xref="GOA:O08688"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR033883"
FT                   /db_xref="InterPro:IPR033884"
FT                   /db_xref="MGI:MGI:1100859"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08688"
FT                   /protein_id="CAA71666.1"
FT                   /translation="MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTP
FT                   GPTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDW
FT                   KEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALV
FT                   EKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVH
FT                   SRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIR
FT                   LRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKC
FT                   RLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPED
FT                   EVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVF
FT                   LRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQ
FT                   VAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQP
FT                   ITVQVWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCSA
FT                   SLTAV"
FT   exon            359..490
FT                   /gene="Capn5"
FT                   /number=2
FT   exon            491..699
FT                   /gene="Capn5"
FT                   /number=3
FT   exon            700..892
FT                   /gene="Capn5"
FT                   /number=4
FT   exon            893..1086
FT                   /gene="Capn5"
FT                   /number=5
FT   exon            1087..1164
FT                   /gene="Capn5"
FT                   /number=6
FT   exon            1165..1360
FT                   /gene="Capn5"
FT                   /number=7
FT   exon            1361..1483
FT                   /gene="Capn5"
FT                   /number=8
FT   exon            1484..1680
FT                   /gene="Capn5"
FT                   /number=9
FT   exon            1681..1796
FT                   /gene="Capn5"
FT                   /number=10
FT   exon            1797..1933
FT                   /gene="Capn5"
FT                   /number=11
FT   exon            1934..2459
FT                   /gene="Capn5"
FT                   /number=12
XX
SQ   Sequence 2459 BP; 520 A; 737 C; 705 G; 497 T; 0 other;
     ctgaagcccg ggggtccaag ttccaacccc cgcctgcggg ctgccggggt atcatctccc        60
     cgcagagtcc cggccgtggc gcgggctggt ctagcctccg ctccagtgcc cgcactgtgc       120
     tctgcatccc gggagtccag ctccagctgc ggcgacgcgg caggtgcctc cccttcttgg       180
     ggacgtggtc accatgttct cctgcgcgaa ggcctatgag gaccagaact actcggcgct       240
     gaagcgggcc tgcctgcgca agaaggtgct gttcgaggat cccctcttcc ctgccaccga       300
     cgactccctt tactataagg gcaccccagg gcccacagtc aggtggaagc ggcctaagga       360
     tatctgcgac gatccccggc tcttcgtaga tggcatcagc tcccatgacc tgcaccaggg       420
     ccaggtgggc aactgctggt ttgtggctgc ctgctcatca ctggcctccc gagagtcact       480
     ctggcagaag gtcatcccag actggaagga gcaggaatgg aaccccgaga agcctgacag       540
     ctatgctggc atcttccact tcaacttctg gcgctttggg gagtgggtgg acgtaatcgt       600
     cgatgaccgg ctgcccacag tcaacaacca gctcatttac tgccattcca actccaaaaa       660
     tgagttctgg tgtgccctgg tggagaaggc ctatgccaag ctggccggct gttaccaggc       720
     cctggacgga ggcaacacgg ccgatgcatt ggtggatttc acaggtggtg tttctgaacc       780
     cattgacctg accgaggggg acttggccac tgacgaggct aagaggaatc agctctttga       840
     gcgagtgctg aaggtgcaca gcagaggcgg gctcatcagt gcctccatca aggctgtgac       900
     agcagctgac atggaggccc gcctggcatg tggcctggtg aagggccatg catacgctgt       960
     caccgatgtg cgcaaggtgc gcctgggcca tggcctgctg gccttcttca agtcagagaa      1020
     gcttgatatg atccgtctga ggaacccctg gggcgagcgg gagtggacgg ggccctggag      1080
     tgacacgtca gaggaatggc agaaagtgag caagagtgag agggagaaga tgggcgtgac      1140
     cgtgcaggat gatggggaat tctggatgac ctttgaggac atgtgccggt actttactga      1200
     catcattaaa tgccgcctga ttaacacgtc ctacctgagc atccataaga catgggagga      1260
     ggcccggctg catggtgcct ggacgagaca tgaggaccca cagcagaacc gcagtggagg      1320
     ctgcatcaac cacaaggaca ctttcttcca gaacccacag tacgtatttg aagtcaagaa      1380
     gccagaagat gaagtgttga tcagtatcca gcagcggccg aagcgctcaa ctcgccggga      1440
     gggcaaaggc gagaatctgg ccattggctt cgacatctat aaggtggaag agaaccgcca      1500
     ataccgtatg cacagcctac agcataaggc cgccagctcc atctacatca attcccgcag      1560
     cgtttttttg aggacagagc tgcccgaggg ccgctacgtt atcatcccta ccacctttga      1620
     gccaggccac actggcgagt tcctgctccg agtcttcaca gatgtcccct ccaactgccg      1680
     ggaactacgc ctggatgagc cccctcggac ctgttggagt tccctctgtg gctaccctca      1740
     gcaggtggcc caggtacatg tcctgggggc tgctggcctc aaggactccc caacaggagc      1800
     aaactcatat gtgatcatca agtgtgaggg cgaaaaggtt cgctcagctg tgcagagagg      1860
     gacctcgaca ccagagtaca atgtaaaagg catcttctat cgcaagaagc tggctcagcc      1920
     tatcaccgtg caggtttgga atcaccgagt cctgaaggat gaattcctgg gccaggtgca      1980
     cctgaagact gccccggatg acctgcagga cctccacacc ctccatctcc aggaccgcag      2040
     tagccggcag cccagtgacc tgccaggcat tgtagctgtg cgagtcctct gcagtgcctc      2100
     tctcacggct gtctgacccc agcctgcctg tcctgcccca ctagtcctca ccactactcg      2160
     catgtcccca ccttgcctgg gaccagcctg ggaaccagac actggggccc tttcctcact      2220
     cttccactga cccactgtgt gacctgaaga gagccctgcc ctctctgagc ctcagtgttt      2280
     ggagggcccc aaagaattcc cgtcttgtgg gggagttttc ttgcctaaga tttaatgcag      2340
     ttctctctac ccagtgggcg ctgctgttaa ggggccatct gctgaaaacg tttccccagg      2400
     ccctgctgtc tgccaggagt gccaagtgtc aactgtttac acacaaactg ccatgtccc       2459
//