Dbfetch

ID   Y09588; SV 1; linear; mRNA; STD; MUS; 1266 BP.
XX
AC   Y09588;
XX
DT   22-SEP-1998 (Rel. 57, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for serotonin 4 receptor (m5-HT4(e)), splice variant
XX
KW   5-HT4; serotonin 4 receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [2]
RP   1-1266
RA   Dumuis A.;
RT   ;
RL   Submitted (22-NOV-1996) to the INSDC.
RL   A. Dumuis, CCIPE, CNRS UPR-9023, 141 Rue de La Cardonille, Montpellier
RL   Cedex 05, 34094, FRANCE
XX
RN   [4]
RX   PUBMED; 10220570.
RA   Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.;
RT   "Novel brain-specific 5-HT4 receptor splice variants show marked
RT   constitutive activity: role of the C-terminal intracellular domain";
RL   Mol. Pharmacol. 55(5):910-920(1999).
XX
DR   MD5; 3829799a729bacc79088ad0b0386f8f4.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024490; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024457; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024456; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024224; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024903; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023697; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024194; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024324; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024290; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024319; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024950; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023440; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023761; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049847; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049829; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049792; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049785; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049519; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050274; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049452; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049546; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049675; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049518; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050392; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049241; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048814; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1266
FT                   /organism="Mus musculus"
FT                   /strain="Swiss"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /cell_type="neuron"
FT                   /tissue_type="brain (colliculus)"
FT                   /db_xref="taxon:10090"
FT   CDS             3..1118
FT                   /gene="5-HT4"
FT                   /product="serotonin 4 receptor"
FT                   /note="splice variant m5-HT4(e)"
FT                   /db_xref="GOA:P97288"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001520"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97288"
FT                   /protein_id="CAA70776.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLSFPLLFRNRPVPV"
XX
SQ   Sequence 1266 BP; 275 A; 346 C; 293 G; 352 T; 0 other;
     taatggacaa acttgatgct aatgtgagtt ccaacgaggg tttcaggtcc gtggagaagg        60
     tcgtgctgct cacgttcctt gcagtggtta tcctgatggc catcttgggc aacctgctgg       120
     tgatggtggc tgtgtgcagg gacaggcagc tcaggaaaat aaaaaccaac tatttcattg       180
     tgtctctcgc ctttgctgac ctgctggttt cggtgctggt gatgcccttt ggtgccattg       240
     agctggtcca agacatctgg gcttatgggg agatgttctg cctggtccgg acctctctgg       300
     atgtcctact caccacagca tcgatctttc acctgtgctg tatttccctg gacaggtatt       360
     acgccatctg ctgccagcct ttggtttata ggaacaagat gacccctcta cgcatcgcat       420
     taatgttggg aggctgctgg gtccttccca tgtttatatc ttttctcccc ataatgcaag       480
     gctggaacaa catcggcata gttgatgtga tagagaaaag gaaattcagc cacaactcta       540
     actccacgtg gtgtgtcttc atggtcaaca agccctatgc tatcacctgc tctgtggtgg       600
     ccttctacat cccgtttctc ctcatggtgc tggcctatta ccgaatctat gtcactgcta       660
     aggagcatgc ccagcagata cagatgttac aacgggcagg agccacctct gaaagcaggc       720
     cccagccagc tgaccagcac agcacacatc gcatgaggac agagaccaag gcagccaaga       780
     ctttatgtgt catcatgggc tgcttctgtt tctgctgggc ccccttcttt gtcaccaata       840
     ttgtggaccc tttcatagac tacactgtcc ccgagcaggt gtggactgct ttcctctggc       900
     ttggctatat caattcgggg ttgaaccctt ttctctatgc cttcttgaat aagtctttca       960
     gacgtgcctt cctcatcatc ctctgctgtg atgatgagcg ctacaaaaga ccccccattc      1020
     tgggccagac tgtcccctgt tcaaccacaa ccattaatgg atccacccat gtactaagtt      1080
     tccccctgct cttccgcaat agacctgttc ccgtctaact gagcgtgctc tgcaaggctg      1140
     tgtatacagt tttgcacagt ggccatcacc aggaactgga gaaattgccc atacacaatg      1200
     acccggagtc tctggaatca tgcttttgat tgaagacatg gctttccatt tagccatcca      1260
     tcccca                                                                 1266
//