spacer

EBI Dbfetch

ID   Y09585; SV 1; linear; mRNA; STD; MUS; 1293 BP.
XX
AC   Y09585;
XX
DT   27-NOV-1996 (Rel. 50, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for serotonin 4L receptor (5-HT4L)
XX
KW   5-HT4; serotonin 4 receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1016/S0014-5793(96)01132-5.
RX   PUBMED; 8946946.
RA   Claeysen S., Sebben M., Journot L., Bockaert J., Dumuis A.;
RT   "Cloning, expression and pharmacology of the mouse 5-HT(4L) receptor";
RL   FEBS Lett. 398(1):19-25(1996).
XX
RN   [2]
RC   Revised by [3]
RA   Dumuis A.;
RT   ;
RL   Submitted (22-NOV-1996) to the INSDC.
RL   A. Dumuis, CCIPE, CNRS UPR-9023, 141 Rue de La Cardonille, Montpellier
RL   Cedex 05, 34094, FRANCE
XX
RN   [3]
RP   1-1293
RA   Dumuis A.;
RT   ;
RL   Submitted (23-SEP-1998) to the INSDC.
RL   A. Dumuis, CCIPE, CNRS UPR-9023, 141 Rue de La Cardonille, Montpellier
RL   Cedex 05, 34094, FRANCE
XX
DR   MD5; b40a65ac8091c6171c555147c2bf87bf.
DR   Ensembl-Gn; ENSMUSG00000026322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027560; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1293
FT                   /organism="Mus musculus"
FT                   /strain="Swiss"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /cell_type="neuron"
FT                   /tissue_type="brain (colliculus)"
FT                   /db_xref="taxon:10090"
FT   CDS             3..1169
FT                   /gene="5-HT4L"
FT                   /product="serotonin 4L receptor"
FT                   /db_xref="GOA:P97288"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001520"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109246"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97288"
FT                   /protein_id="CAA70773.1"
FT                   /translation="MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVC
FT                   RDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLT
FT                   TASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNN
FT                   IGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEH
FT                   AQQIQMLQRAGATSESRPQPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIV
FT                   DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPIL
FT                   GQTVPCSTTTINGSTHVLRDAVECGGQWESRCHLTATSPLVAAQPSDT"
XX
SQ   Sequence 1293 BP; 278 A; 346 C; 318 G; 351 T; 0 other;
     taatggacaa acttgatgct aatgtgagtt ccaacgaggg tttcaggtcc gtggagaagg        60
     tcgtgctgct cacgttcctt gcagtggtta tcctgatggc catcttgggc aacctgctgg       120
     tgatggtggc tgtgtgcagg gacaggcagc tcaggaaaat aaaaaccaac tatttcattg       180
     tgtctctcgc ctttgctgac ctgctggttt cggtgctggt gatgcccttt ggtgccattg       240
     agctggtcca agacatctgg gcttatgggg agatgttctg cctggtccgg acctctctgg       300
     atgtcctact caccacagca tcgatctttc acctgtgctg tatttccctg gacaggtatt       360
     acgccatctg ctgccagcct ttggtttata ggaacaagat gacccctcta cgcatcgcat       420
     taatgttggg aggctgctgg gtccttccca tgtttatatc ttttctcccc ataatgcaag       480
     gctggaacaa catcggcata gttgatgtga tagagaaaag gaaattcagc cacaactcta       540
     actccacgtg gtgtgtcttc atggtcaaca agccctatgc tatcacctgc tctgtggtgg       600
     ccttctacat cccgtttctc ctcatggtgc tggcctatta ccgaatctat gtcactgcta       660
     aggagcatgc ccagcagata cagatgttac aacgggcagg agccacctct gaaagcaggc       720
     cccagccagc tgaccagcac agcacacatc gcatgaggac agagaccaag gcagccaaga       780
     ctttatgtgt catcatgggc tgcttctgtt tctgctgggc ccccttcttt gtcaccaata       840
     ttgtggaccc tttcatagac tacactgtcc ccgagcaggt gtggactgct ttcctctggc       900
     ttggctatat caattcgggg ttgaaccctt ttctctatgc cttcttgaat aagtctttca       960
     gacgtgcctt cctcatcatc ctctgctgtg atgatgagcg ctacaaaaga ccccccattc      1020
     tgggccagac tgtcccctgt tcaaccacaa ccattaatgg atccacccat gtactaaggg      1080
     atgcagtgga atgtggtggc cagtgggaga gtcggtgtca cctcacagca acttctcctt      1140
     tggtggctgc tcagcccagt gatacttagg cccctggaca atgacctaga agacagctgt      1200
     ggcttgaaac gaagccagtc ctaagctgct acttgtgtgt atgtggctgg ccctggcact      1260
     ctcttctcca aggctttcca agagcagagg caa                                   1293
//


spacer
spacer