spacer

EBI Dbfetch

ID   Y08682; SV 1; linear; mRNA; STD; HUM; 2592 BP.
XX
AC   Y08682;
XX
DT   06-MAR-1997 (Rel. 51, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   H.sapiens mRNA for carnitine palmitoyltransferase I type I
XX
KW   carnitine palmitoyltransferase I; CPT1B gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   DOI; 10.1016/S0167-4781(97)00037-7.
RX   PUBMED; 9199240.
RA   van der Leij F.R., Takens J., van der Veen A.Y., Terpstra P.,
RA   Kuipers J.R.G.;
RT   "Localization and intron usage analysis of the human CPT1B gene for muscle
RT   type carnitine palmitoyltransferase I";
RL   Biochim. Biophys. Acta 1352(2):123-128(1997).
XX
RN   [2]
RP   1-2592
RA   van der Leij F.R.;
RT   ;
RL   Submitted (04-OCT-1996) to the INSDC.
RL   F.R. van der Leij, Dept of Pediatrics, University of Groningen, Research
RL   Lab CMCV 2nd floor, PO Box 30 001, 9700 RB Groningen, NETHERLANDS
XX
DR   MD5; c3f619f92e321168ba1a12cac1288e31.
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000440709; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
CC   Related sequences U62317 and D64178
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2592
FT                   /organism="Homo sapiens"
FT                   /chromosome="22"
FT                   /map="q telomere"
FT                   /isolate="21 year old caucasian male"
FT                   /mol_type="mRNA"
FT                   /clone_lib="CLONTECH Marathon first strand cDNA, Cat.nr.
FT                   7413-1"
FT                   /tissue_type="skeletal muscle"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..32,33..192,193..332,333..510,511..612,613..750,
FT                   751..828,829..936,937..1021,1022..1217,1218..1403,
FT                   1404..1509,1510..1626,1627..1791,1792..1926,1927..2079,
FT                   2080..2193,2194..2286,2287..2372,2373..2592)
FT                   /gene="CPT1B"
FT   exon            1..32
FT                   /number=1
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            33..192
FT                   /number=2
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             join(52..192,193..332,333..510,511..612,613..750,751..828,
FT                   829..936,937..1021,1022..1217,1218..1403,1404..1509,
FT                   1510..1626,1627..1791,1792..1926,1927..2079,2080..2193,
FT                   2194..2286,2287..2370)
FT                   /gene="CPT1B"
FT                   /product="carnitine palmitoyltransferase I"
FT                   /EC_number="2.3.1.21"
FT                   /note="type I"
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000325465.14"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92523"
FT                   /protein_id="CAA69938.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIR
FT                   IKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTR
FT                   ALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRH
FT                   PMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKY
FT                   LVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAM
FT                   IMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHK
FT                   GRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAF
FT                   FSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFT
FT                   LISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTR
FT                   LQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQL
FT                   AHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQK
FT                   AAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQI
FT                   RMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNH
FT                   IRKALLDIADLFQVPKAYS"
FT   exon            193..332
FT                   /number=3
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            333..510
FT                   /number=4
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            511..612
FT                   /number=5
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            613..750
FT                   /number=6
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            751..828
FT                   /number=7
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            829..936
FT                   /number=8
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            937..1021
FT                   /number=9
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1022..1217
FT                   /number=10
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1218..1403
FT                   /number=11
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1404..1509
FT                   /number=12
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1510..1626
FT                   /number=13
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1627..1791
FT                   /number=14
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1657..1791
FT                   /number=14
FT                   /note="alternative exon"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1792..1926
FT                   /number=15
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            1927..2079
FT                   /number=16
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2080..2193
FT                   /number=17
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2194..2286
FT                   /number=18
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2287..2372
FT                   /number=19
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2373..2592
FT                   /number=20
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2379..2592
FT                   /number=20
FT                   /note="alternative exon"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   polyA_signal    2568..2573
XX
SQ   Sequence 2592 BP; 560 A; 770 C; 710 G; 552 T; 0 other;
     gccccacgca cggacaggag tgaacccgag ctgtgccgac caacccccag gatggcggaa        60
     gctcaccagg ccgtggcctt ccagttcacg gtgaccccag acggggtcga cttccggctc       120
     agtcgggagg ccctgaaaca cgtctacctg tctgggatca actcctggaa gaaacgcctg       180
     atccgcatca agaatggcat cctcaggggc gtgtaccctg gcagccccac cagctggctg       240
     gtcgtcatca tggcaacagt gggttcctcc ttctgcaacg tggacatctc cttggggctg       300
     gtcagttgca tccagagatg cctccctcag gggtgtggcc cctaccagac cccgcagacc       360
     cgggcacttc tcagcatggc catcttctcc acgggcgtct gggtgacggg catcttcttc       420
     ttccgccaaa ccctgaagct gcttctctgc taccatgggt ggatgtttga gatgcatggc       480
     aagaccagca acttgaccag gatctgggct atgtgtatcc gccttctatc cagccggcac       540
     cctatgctct acagcttcca gacatctctg cccaagcttc ctgtgcccag ggtgtcagcc       600
     acaattcagc ggtacctaga gtctgtgcgc cccttgttgg atgatgagga atattaccgc       660
     atggagttgc tggccaaaga attccaggac aagactgccc ccaggctgca gaaatacctg       720
     gtgctcaagt catggtgggc aagtaactat gtgagtgact ggtgggaaga gtacatctac       780
     cttcgaggca ggagccctct catggtgaac agcaactatt atgtcatgga ccttgtgctc       840
     atcaagaata cagacgtgca ggcagcccgc ctgggaaaca tcatccacgc catgatcatg       900
     tatcgccgta aactggaccg tgaagaaatc aagcctgtga tggcactggg catagtgcct       960
     atgtgctcct accagatgga gaggatgttc aacaccactc ggatcccggg caaggacaca      1020
     gatgtgctac agcacctctc agacagccgg cacgtggctg tctaccacaa gggacgcttc      1080
     ttcaagctgt ggctctatga gggcgcccgt ctgctcaagc ctcaggatct ggagatgcag      1140
     ttccagagga tcctggacga cccctcccca cctcagcctg gggaggagaa gctggcagcc      1200
     ctcactgcag gaggaagggt ggagtgggcg caggcacgcc aggccttctt tagctctgga      1260
     aagaataagg ctgccttgga ggccatcgag cgtgccgctt tcttcgtggc cctggatgag      1320
     gaatcctact cctatgaccc cgaagatgag gccagcctca gcctctatgg caaggccctg      1380
     ctacatggca actgctacaa caggtggttt gacaaatcct tcactctcat ttccttcaag      1440
     aatggccagt tgggtctcaa tgcagagcat gcgtgggcag atgctcccat cattgggcac      1500
     ctctgggagt ttgtcctggg cacagacagc ttccacctgg gctacacgga gaccgggcac      1560
     tgcctgggca aaccgaaccc tgcgctcgca cctcctacac ggctgcagtg ggacattcca      1620
     aaacagtgcc aggcggtcat cgagagttcc taccaggtgg ccaaggcgtt ggcagacgac      1680
     gtggagttgt actgcttcca gttcctgccc tttggcaaag gcctcatcaa gaagtgccgg      1740
     accagccctg atgcctttgt gcagatcgcg ctgcagctgg ctcacttccg ggacaggggt      1800
     aagttctgcc tgacctatga ggcctcaatg accagaatgt tccgggaggg acggactgag      1860
     actgtgcgtt cctgtaccag cgagtccaca gcctttgtgc aggccatgat ggaggggtcc      1920
     cacacaaaag cagacctgcg agatctcttc cagaaggctg ctaagaagca ccagaatatg      1980
     taccgcctgg ccatgaccgg ggcagggatc gacaggcacc tcttctgcct ttacttggtc      2040
     tccaagtacc taggagtcag ctctcctttc cttgctgagg tgctctcgga accctggcgt      2100
     ctctccacca gccagatccc ccaatcccag atccgcatgt tcgacccaga gcagcacccc      2160
     aatcacctgg gcgctggagg tggctttggc cctgtagcag atgatggcta tggagtttcc      2220
     tacatgattg caggcgagaa cacgatcttc ttccacatct ccagcaagtt ctcaagctca      2280
     gagacgaacg cccagcgctt tggaaaccac atccgcaaag ccctgctgga cattgctgat      2340
     cttttccaag ttcccaaggc ctacagctga agcccttagg tacctgtgtt ttgtttggga      2400
     actcggaggc cctccccctc ccccagctca gaccacagag gtggcaagag aagggctgaa      2460
     gctggaagac tgttcatgag ggacttgtgt gacctgcttt gaaatgtgtg actctgctga      2520
     gtgacgtagg ctctgagata gctgtccacg cccacgtgtt tgcttggaat aaatacttgc      2580
     ctcagaacct tc                                                          2592
//


spacer
spacer