spacer

EBI Dbfetch

ID   Y07611; SV 1; linear; genomic DNA; STD; MUS; 7233 BP.
XX
AC   Y07611;
XX
DT   12-NOV-1996 (Rel. 49, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   M.musculus PKN gene and gene for prostanoid EP1 receptor
XX
KW   PKN gene; prostanoid EP1 receptor; protein kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RX   DOI; 10.1006/bbrc.1996.1469.
RX   PUBMED; 8858105.
RA   Batshake B., Sundelin S.;
RT   "The mouse genes for the EP1 prostanoid receptor and the PKN protein kinase
RT   overlap";
RL   Biochem. Biophys. Res. Commun. 227(1):70-76(1996).
XX
RN   [2]
RP   1-7233
RA   Batshake B.;
RT   ;
RL   Submitted (21-AUG-1996) to the INSDC.
RL   B. Batshake, Lund University, Div. Of Molecular Neurobiology, Wallenberg
RL   Neurocentre, Soelvegatan 17, S-223 62 Lund, SWEDEN
XX
DR   Ensembl-Gn; ENSMUSG00000019464; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144258; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7233
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(<100..276,460..522,636..712,988..1130,1400..1507,
FT                   1610..1690,2061..2264)
FT                   /codon_start=2
FT                   /gene="PKN"
FT                   /product="protein kinase"
FT                   /db_xref="GOA:P70268"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="MGI:MGI:108022"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70268"
FT                   /protein_id="CAA68883.1"
FT                   /translation="LMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLM
FT                   LHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCK
FT                   EGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEE
FT                   VFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDV
FT                   LLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFDFVAG
FT                   GY"
FT   mRNA            join(100..276,460..522,636..712,988..1130,1400..1507,
FT                   1610..1690,2061..2593)
FT                   /gene="PKN"
FT                   /note="short transcript"
FT   mRNA            join(100..276,460..522,636..712,988..1130,1400..1507,
FT                   1610..1690,2061..6536)
FT                   /gene="PKN"
FT                   /note="long transcript"
FT   exon            100..276
FT                   /gene="PKN"
FT                   /note="exon t"
FT   intron          277..459
FT                   /gene="PKN"
FT                   /note="intron t"
FT   exon            460..522
FT                   /gene="PKN"
FT                   /note="exon u"
FT   intron          523..635
FT                   /gene="PKN"
FT                   /note="intron u"
FT   exon            636..712
FT                   /gene="PKN"
FT                   /note="exon v"
FT   intron          713..987
FT                   /gene="PKN"
FT                   /note="intron v"
FT   exon            988..1130
FT                   /gene="PKN"
FT                   /note="exon w"
FT   intron          1131..1399
FT                   /gene="PKN"
FT                   /note="intron w"
FT   exon            1400..1507
FT                   /gene="PKN"
FT                   /note="exon x"
FT   intron          1508..1609
FT                   /gene="PKN"
FT                   /note="intron x"
FT   exon            1610..1690
FT                   /gene="PKN"
FT                   /note="exon y"
FT   intron          1691..2060
FT                   /gene="PKN"
FT                   /note="intron z"
FT   exon            2061..6536
FT                   /gene="PKN"
FT                   /note="long transcript"
FT                   /note="exon z"
FT   exon            2061..2593
FT                   /gene="PKN"
FT                   /note="short transcript"
FT                   /note="exon z"
FT   mRNA            complement(join(2326..3162,3583..4550,5513..5789))
FT                   /product="prostanoid EP1 receptor"
FT   exon            complement(2326..3162)
FT                   /number=3
FT   CDS             complement(join(2896..3162,3583..4533))
FT                   /product="prostanoid EP1 receptor"
FT                   /db_xref="GOA:P35375"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000708"
FT                   /db_xref="InterPro:IPR001244"
FT                   /db_xref="InterPro:IPR008365"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97793"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35375"
FT                   /protein_id="CAA68884.1"
FT                   /translation="MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSM
FT                   TLGAVSNVLALALLAQVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAG
FT                   RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVL
FT                   AAMALAVALLPLVHVGRYELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALV
FT                   CNTLSGLALLRARWRRRRSRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRS
FT                   SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAV
FT                   RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRH
FT                   SGFSHL"
FT   intron          complement(3163..3582)
FT                   /number=2
FT   exon            complement(3583..4550)
FT                   /number=2
FT   intron          complement(4551..5512)
FT                   /number=1
FT   exon            complement(5513..5789)
FT                   /number=1
XX
SQ   Sequence 7233 BP; 1542 A; 2150 C; 1957 G; 1584 T; 0 other;
     aattgcacag cagtgcaact caacagatac ctgagtgaac ctggagggca tgggtattgg        60
     aggggcagct gggctctctg acttctgcct cctgtccagc ctgatgtgtg agaagcggat       120
     tttggcggcc gtgaccaggg caggacatcc cttcctggtg aaccttttcg gctgtttcca       180
     gaccccagag cacgtgtgct ttgtgatgga gtactcggca ggtggagacc tgatgctgca       240
     cattcatagc gacgtgttct cagagcctcg ggctgtgtga gtctatccca gcaccatgcc       300
     cctcctgcac accacccgag gccccgcctt tctgccccac ctcctagccc tccaccctca       360
     ggccttcctc ctgcacagct ttgggacccc ccaccccccg gggtcaggga ctttggtgcc       420
     tgaggaacca ggcttgtgcg atcttatgca tctccgcagc ttctattcgg cctgtgtggt       480
     gctgggactg cagttcctcc atgaacacaa gattgtctac aggtgtgtac gtgagaatgt       540
     tctgcccaca gactggacat ggtcaagctc tgcacagagc cccgatccct acccagtcac       600
     ccctctttac atcccctgac acccccattc cccagggacc tgaagttgga caatttgctc       660
     ctggatactg agggctacgt caagatcgca gactttggcc tctgcaagga gggtgagggg       720
     ctgcaatcct gggatgagag gaataggggg tgggctaccc tctggtgcag ctgtacctag       780
     gtggtcaggt gacattttct tctctatggg ctttgctgcc agccacctgc tcaccctagc       840
     agcgtcagaa tagttcacca gctctagccc catctgggtc accccatact gacttggggt       900
     agggctggat ggatatttgg agcatctcat gctcctaccc ccctagcaac tataggctca       960
     cgtggccttg ctctccatcc cacccaggga tgggctatgg ggaccggacc agcacgttct      1020
     gcggaactcc ggagttcctg gcgccggaag tgctcacaga cacatcctac acgcgagcag      1080
     tggactggtg gggactgggt gtgctgctct atgagatgtt ggttggagag gtgaggccca      1140
     ggctgccttt tcttttttct gtagagaaca tgcatgtgcc tcagagtgag atgggaatct      1200
     gctcctacca cgtgaagtat gatctggagc cggcagcctt acctctctaa tctttctgta      1260
     gttgtaaagt gggatactta cccctgtaag ccagcagcgg tgcaagagtg ctcccggagg      1320
     ggtgaggcca tttggtagtg ctgggtgtgt ggattggcta aaagtgggat tttacaaacc      1380
     cgcatcctct gccccccagt ctccgttccc tggggatgat gaggaggagg tatttgacag      1440
     cattgtcaac gacgaagttc gctatccccg cttcctgtct gcagaggcca ttggcatcat      1500
     gagaagggta ggcacacctc ccgcctcccg accacctccg gaaaggtagg ctgggaaggg      1560
     gtctcgggac tggactcaga tatagatcaa ctcctgtgca tgctcacagc tactgcggag      1620
     gaacccggag cggaggctgg ggtccactga gcgcgatgca gaagatgtga aaaaacagcc      1680
     tttcttccgg gtgagcggac ccctccccat cctctcagtc accccaagga cctgagtatt      1740
     cttctcagtt ccagttcatt cccaccccaa atctagtagc tgtatcttaa agagctttgt      1800
     agccccacac ctcacaggca ccatgattct tcacaaatgt tacctccgtt tgtctgcaac      1860
     cttcatttcc cttaattgtc atccccactg cttctccagg cccaaatcat catcacaggg      1920
     cttaccctgg actacctcag gctccctaga tttatctgag ttcccagtcc ctccccatct      1980
     tatctgcttc ctgctgatct ctagacttcc cttcagaccc tcaaagtcca tcatgactca      2040
     ctctgtcccc ctctccacag tctctgggct gggatgtcct gctggcccgc cgcctgcctc      2100
     cacccttcgt gcctacactt tcagggcgca cagatgtcag caacttcgat gaggagttca      2160
     ctggggaggc ccccacactg agtcctcccc gggatgcacg gcccctcaca gctgcggagc      2220
     aggcagcctt ccgggatttc gactttgtgg ccggaggcta ctagccccaa gcccctgcct      2280
     tacccaagag ttcttgattt tttaaaaaac aagcctttgg ggtttactcc atacatgcat      2340
     tttcagcctc tgtgtgcatc tggactggag tgtgcttgga gcaggtgaca gaggcaaggc      2400
     agactcttgg gggcaggact gatggggcac atttgaaagg tcaagatggg aacatgcagt      2460
     agtgggctta ggggtgtgtt ggagagcatt ggggttttaa gcccgtgtgg gtagaaggtg      2520
     ttgagattct tgggatagtt tgggatagac gcttgcaaga gtctattggg gtggtgacag      2580
     agatgggaag tgaatcctaa accctgctct atttacggag agcccgaatc ttagaactaa      2640
     ggttgcggcg ctgtgcgcat gctcttcaag ctgttggcct ggggagtccc acctctggtg      2700
     tttcgagcat cccatgtatc tgggccatcg cgtgaccatc gttagaactg tactcgtccc      2760
     cagtggagcc tctttcaccc ctgtgcggtg acagtgttgt ggacccacag gacgcagcgc      2820
     cctaggcaca ctgagtttga gactctatgc ccttgagccc agcccagaat ggtttgactt      2880
     agcttctggg cacattcaga ggtgactgaa accactgtgc cgggaactac gcagtgaact      2940
     ggcttcccag gcactcttgg ttaggcccag ctccgttgga ccacccttgg cactgaccct      3000
     caggggtagg aggcgaagca gttggcgcag catggcctgg cgcagcagga tgtacaccca      3060
     tgggtccagg atctggttcc acgatgcgag gcgtacagcc agaaagagtg gccgctgcag      3120
     ggagttagag ttccagcccc cgatggccaa caccaccaac acctgcgaga gaagcaggtg      3180
     tgagcagtgg agcccgccgg agagaagggg tggggtggag ggtcaggatg ccggggcgag      3240
     ccatgcagga caaataggat ctgtgcagga aggagagtga ctaagcaaag gtcatcagag      3300
     attgcggaga gtccggctag agaagaccca gtattacaac acacatacga ctctaaggtc      3360
     aacaagctgg gaaggaaaaa ggctatgaat ggatggagcg gagggatgta gaaagtgaaa      3420
     ggcttgagtg tgtgagacta tttacagaga tcctaaagag agtgaagaaa agggtcccgg      3480
     atagcagagg ggcaggcttt gtctgcaggc agggtcttca ggaggcagag cccaggaggg      3540
     ggcagaaaag agtttggctt gaggagcgac tgcgcccctc accagcaggg ggctccagca      3600
     gatgcacgac accaccatga tgcccacgag ctggcccacc atttccacat cgtgtgcgtg      3660
     aaccctgcgc gcggagccgc cgccccgaga gctgcggagg gtggctgtgg ctgaagtgat      3720
     ggatgaggca gacgaggcgg aggccaagcg gggtccacga gatccccagc gccggcgatc      3780
     atcgggacct gcggtctttc ggaatcgtcg agagcgacgc cgtctccagc gggcacggag      3840
     gagcgccagg ccgctgagcg tattgcacac taatgccgca aggagcgcgg ccaggccaag      3900
     gccggcgaag aggccggcaa gcaacgcctg gcgccaacct ccacgaggcc caaggctaat      3960
     aaaacaccag gtgccagggt actgtaactc gtagcgaccc acgtgtacca gtggcagcag      4020
     cgccactgcc aaagccatgg cagccagcac ggctagtgcc aggcgtgcgc gggccacaga      4080
     tacgcgcgcc gcgtggatca gtggctgcgt gacacccaca cagcgctcta cggccatgcc      4140
     acagccaagc aaaagtgggc acaggccgaa gaagaccatg cagccaccca ggaaatgaca      4200
     cgcccctcca gcaggcgcac gccccgcagt atacaggcga agcaccaggg cgcccgggat      4260
     cacatggcct gctaggtcga tggcaagcag gctggcgacg aacaacagga aggtggcagc      4320
     cgagcggcgc cgccgcattc ggcctgcaac ctgggccagc agcgccagcg ccagcacgtt      4380
     ggacacagca cccagcgtca tggagaagat aggcagcgct ggtgatgtgc cattatcgcc      4440
     tgttggcagc accacagatg tattggggag cctgggtgtt gcgcacgttg ctgcctcatc      4500
     cgctaggctc aggttaagcc cgcaggggct catatcagtg gccaagaggg ctgcgtagat      4560
     aagaagaggg cacagtgagg tagggtccca accttctgtg cccagggcac cgccacatga      4620
     ccctagctgc tccatttcag atcctattca cctgtcactg gccccatctc gtgtctggct      4680
     tcattctgcc ctcgtatctg ctgggggtct tgactgacct ggcacgggtc ccgggtatct      4740
     agtctcatct ccaccccacc cccacctcca cgtttccacc ccatcagttt cctggtccat      4800
     gatcccatgg gatagaccct tgcccatttc tgatcccaat ttccactttc gtgtctgcct      4860
     gcccatctct ccgttttcag aagtctcctt gacttgccct ggaactggcc aggctaacct      4920
     taaattcaaa agatccacct gcctatgcct cctgtgtctt gggattaaag gctcacacca      4980
     caactagctt tggtcacctt ttaactctgt ccttgatgtc cctgttccaa caacgccacc      5040
     acttatagtt catctcttcc aatggccgtg tgcctgtctc cagagactga tccaatctgc      5100
     agttagatct cttccccaaa caacccatct ctacacctat agacccgttc ttgtgcccca      5160
     aggcctctat gccacatctc tggtctccgt ggtcctctct gtccccacag acccctgcta      5220
     ccccgaaccc atctctgaac tctatggtgc tctcagatcc catgggccca gctcttttcc      5280
     agaatcccat ctctgttgcc ctctctcgtc tccatggcaa tctctcacta gtctggcatt      5340
     gcctcattca gatgcccatc ccatacccct atttgagccg cccccggctt gcccattctc      5400
     tagttgagag gagatggaca gcctaggact gagagccatt aaacagcaag agagcaggag      5460
     ggctatagct agccttcttt ggcttgctat cctcaatgtc ccagcttctt acccagtgct      5520
     gctcaggatg cagggtcccc atggcctgga acttggctcc tgctgcctgc tccagctact      5580
     ccctggctcc cggcaggccg ctccctcttc ctggggcggc tcctcggctc cgtgccgcct      5640
     ccacccgcac ttcactggcc tccaggggct gctccacccc atgcatgttt gctctctggg      5700
     gctgggagcc ttgagtgggc aaaactgctg gcaacagtca gggcaactgg gcccagctcc      5760
     ttcccgccaa ggactgaggt tctctgaatt ggtttggtct ctgtgacccc cctcctctca      5820
     gcggggcagg agcaaacccc cacaccctca cccgggcctc ttgcccgcct cattaataaa      5880
     gtggataaaa tctaaacact ggaaaatgtg agcatcgcct ggggcaggct ggaagggcta      5940
     tgagttcccg tggggggcgg gagagtgagt gtgtgtgtgg aggagtgttg tcctcattgg      6000
     acttgagggg ttgggagttg cctgggtgtg atgggagcta gcaatgcctc ctacccttgc      6060
     ctttatggtt gtcacagttg ggcagaggtg ggcagcctag accagggcaa cagggagtca      6120
     tcctaggtga agagaggtgg ctaaatgact caggggagcc aggctatcat ctgtatcctg      6180
     ccttatgcgg aggtaggcaa ttcatagggc accctgtatc catagctatg tctcaccttc      6240
     tgtcttgaaa aggggcacac atgcagccac tgtcagctta gtcataatgg ggagtaaaca      6300
     ctggatagca ctcaccattg ctgactgtaa catctatccc ccctccccca tatgaaactg      6360
     atgcttacct cagcactggg tgtaaatctc actgtcactg taagtctgtt cccagcccca      6420
     gagcacacct cctgatgtag tctcccttaa accaatgccc atggaccccg agaacttgtc      6480
     ctgagacaca taatcacatc tctaaggcct gtttatcctg aatccccccc cccccaaaaa      6540
     aaagaaagaa tacaccagag acccatgcac acactgaaca cagctccctg aaactcactg      6600
     cacccaaggc ttacccacaa taatcacagc tctggttcaa cctggctacc aaccacccac      6660
     tacacatggt cccagctgct cccagcagac atgcgagacc ccagtatagg acctgggcta      6720
     cagttcagtg acagagcaca tccttagcat gtatgaagcc ctgggttcta ctatcagtac      6780
     tgaaaatggg cttgtgatca gggatagcaa gtagccatct gcagggcttc tgtcctatat      6840
     ccaggatacc catctcctgc ctggtaccag ggaaccagta ccactcagcc ttcctgcagc      6900
     atctctgctg ggcttacccc aaacattcct atggttgctg gagagagacc tctggcctgg      6960
     ttccccttgt tccaattgcc tcccctctcc ccaagtctgg ccagggtccc accccaccct      7020
     ttccttgatc tccttaaatc ctaggatgaa atggactgtc aaaacaagct tggcaggttt      7080
     acatctctgt gaagcactgt gccatggatg cctgtcccct gagtacaact agggtaacag      7140
     ggcaacaggc cttgctgcca cacacggggg ctctcacaca agaggagcat atgtgaggcc      7200
     tgggtgagtg gggaaccagg tctgaacccc aag                                   7233
//


spacer
spacer