spacer

EBI Dbfetch

ID   X99896; SV 1; linear; mRNA; STD; HUM; 911 BP.
XX
AC   X99896;
XX
DT   09-AUG-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   H.sapiens mRNA for major histocompatability complex class II, DRB1*0104
XX
KW   DRB1 gene; major histocompatability complex class II.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [2]
RP   1-911
RA   Tilanus M.G.J.;
RT   ;
RL   Submitted (07-AUG-1996) to the INSDC.
RL   M.G.J. Tilanus, University Hospital Utrecht, Section Molecular Pathology,
RL   Heidelberglaan 100, 3584 CX Utrecht, NETHERLANDS
XX
RN   [3]
RA   Middleton, Versluis, Tilanus;
RT   ;
RL   Unpublished.
XX
DR   MD5; fcea22a58dd2ba21b055c336fba92594.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..911
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /haplotype="DRB1*0104"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..43
FT   CDS             <44..757
FT                   /codon_start=1
FT                   /gene="DRB1"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="CAA68171.1"
FT                   /translation="GXTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDLLEQRRAAVDNYCRHNYGVVESFTVQRRVEPKVTVYPS
FT                   KTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLET
FT                   VPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
FT                   NQKGHSGLQPTGXLS"
FT   exon            44..56
FT                   /gene="DRB1"
FT                   /number=1
FT   exon            57..325
FT                   /gene="DRB1"
FT                   /number=2
FT   exon            326..608
FT                   /gene="DRB1"
FT                   /number=3
FT   exon            609..718
FT                   /gene="DRB1"
FT                   /number=4
FT   exon            719..742
FT                   /gene="DRB1"
FT                   /number=5
FT   exon            743..757
FT                   /gene="DRB1"
FT                   /number=6
FT   3'UTR           758..911
XX
SQ   Sequence 911 BP; 202 A; 216 C; 283 G; 198 T; 12 other;
     acagtgacac tgatggtgac tgagctcccc actggctttg gctgggnaca cccgaccacg        60
     tttcttgtgg cagcttaagt ttgaatgtca tttcttcaat gggacggagc gggtgcggtt       120
     gctggaaaga tgcatctata accaagagga gtccgtgcgc ttcgacagcg acgtggggga       180
     gtaccgggcg gtgacggagc tggggcggcc tgatgccgag tactggaaca gccagaagga       240
     cctcctggag cagaggcggg ccgcggtgga caattactgc agacacaact acggggttgt       300
     ggagagcttc acagtgcagc ggcgagttga gcctaaggtg actgtgtatc cttcaaagac       360
     ccagcccctg cagcaccaca acctcctggt ctgctctgtg agtggtttct atccaggcag       420
     cattgaagtc aggtggttcc ggaacggcca ggaagagaag gctggggtgg tgtccacagg       480
     cctgatccag aatggagatt ggaccttcca gaccctggtg atgctggaaa cagttcctcg       540
     gagtggagag gtttacacct gccaagtgga gcacccaagt gtgacgagcc ctctcacagt       600
     ggaatggaga gcacggtctg aatctgcaca gagcaagatg ctgagtggag tcgggggctt       660
     cgtgctgggc ctgctcttcc ttggggccgg gctgttcatc tacttcagga atcagaaagg       720
     ncactctgga cttcagccaa caggnntcct gagctgaaat gnagatgacc acattcaagg       780
     aagaaccttc tgtcccagct ttgcagaatg aaaagctttc ntgcttggca gttattnttc       840
     cacaagagag ggntttctca ggacntggtt gctactggtt cggnaactgn agaaaatgtc       900
     ctnccttgtg g                                                            911
//


spacer
spacer